Loading...
HomeMy WebLinkAbout2021-09-15 PacketPage 1 of 7 City Council Regular Meeting AGENDA Civic Center Council Chamber ♦ 300 Seminary Avenue ♦ Ukiah, CA 95482 Register for Ukiah City Council Regular Meeting at: https://attendee.gotowebinar.com/rt/3862698010362077965 After registering, you will receive a confirmation email containing information about joining the  webinar. Alternatively, you may view the meeting (without participating) by clicking on the name of the meeting  at www.cityofukiah.com/meetings.  September 15, 2021 ­ 6:00 PM 1. ROLL CALL     2. PLEDGE OF ALLEGIANCE     3. PROCLAMATIONS/INTRODUCTIONS/PRESENTATIONS      3.a. Introduction of Neil Davis, Director of Community Services.    Recommended Action: Receive introduction of Neil Davis, Director of Community Services.     Attachments: None       4. PETITIONS AND COMMUNICATIONS     5. APPROVAL OF MINUTES      5.a. Approval of the Minutes for the August 30, 2021, Special Meeting.    Recommended Action: Approve the Minutes of August 30, 2021, a Special Meeting, as submitted.     Attachments:  1.2021­08­30 Draft Minutes ­ Special Meeting        5.b. Approval of the Minutes for the September 1, 2021, Regular Meeting.    Recommended Action: Approve the Minutes of September 1, 2021, a Regular Meeting, as  submitted.     Attachments:  1.2021­09­01 Draft Minutes       6. RIGHT TO APPEAL DECISION       Persons who are dissatisfied with a decision of the City Council may have the right to a review of that decision by a court. The  City has adopted Section 1094.6 of the California Code of Civil Procedure, which generally limits to ninety days (90) the time  within which the decision of the City Boards and Agencies may be judicially challenged.     Page 1 of 800 Page 2 of 7 7. CONSENT CALENDAR       The following items listed are considered routine and will be enacted by a single motion and roll call vote by the City Council.  Items may be removed from the Consent Calendar upon request of a Councilmember or a citizen in which event the item will  be considered at the completion of all other items on the agenda. The motion by the City Council on the Consent Calendar will  approve and make findings in accordance with Administrative Staff and/or Planning Commission recommendations.      7.a. Report of Disbursements for the Month of August 2021.    Recommended Action: Approve the Report of Disbursements for the Month of August 2021.      Attachments:  1.August 2021 Summary of Disbursements 2.Account Codes for Reference  3.Object Codes for Reference 4.August 2021 Disbursement Detail        7.b. Report to Council for the Emergency Replacement of a Flow Meter at the Water Treatment  Plant (WTP), from JM Integration LLC, in the Amount of $19,366.39.    Recommended Action: Receive Report for the Emergency Replacement of a Flow Meter at the  Water Treatment Plant, from JM Integration LLC, in the amount of $19,366.39.      Attachments:  1.REQ ­JM Int 2.JM Int Quote        7.c. Approval of Budget Amendment in the Amount of $3,000 for CASp Training Expenses for the  Chief Building Official.     Recommended Action: Approve budget amendment in the amount of $3,000 for training  expenses for the Chief Building Official.     Attachments: None        7.d. Adopt Resolution Approving an Initial Study/Negative Declaration and General Plan  Amendment No. 21­01 to Allow for Increased Density and Lot Coverage in Compliance with the  General Plan Housing Element and State Housing Laws.    Recommended Action: Adopt Resolution Approving  an Initial Study/Negative Declaration and  General Plan Amendment No. 21­01 to Allow for Increased Density and Lot Coverage in  Compliance with the General Plan Housing Element and State Housing Laws.      Attachments:  1.Minutes of August 18, 2021 2.Resolution with Exhibits A and B        7.e. Adoption of Resolution Approving Records Destruction for City Manager's Office.    Recommended Action: Adopt resolution authorizing the destruction of outdated documents for  the City Manager's Office.     Attachments:  1.Resolution with Exhibit A ­ Records Destruction Notice       Page 2 of 800 Page 3 of 7  7.f. Approval of Budget Amendment in the Amount of $10,000 for Colantuono, Highsmith &  Whatley PC for Specialized Legal Services Related to LAFCo Matters.    Recommended Action: Approve budget amendment in the amount of $10,000 for Colantuono,  Highsmith & Whatley PC, for legal services under contract no. 1415­099.      Attachments: None        7.g. Authorize City Manager to Execute an Memorandum of Understanding (MOU) to Partner with  Ukiah Unified School District to Expand the After School Education and Safety Program.    Recommended Action: Authorize the City Manager to execute a Memorandum of Understanding  between the City of Ukiah and Ukiah Unified School District to partner to expand the Afterschool  Education and Safety program.      Attachments:  1.ASES MOU with UUSD        7.h. Approve Budget Amendment in the Amount of $565,727 for Contract No. 2021­204 with CWS  Construction Group for the Electric Service Center Site Work, and Approve the Reset of Staff's  10% Change Order Authority Based on the Revised Contract Amount of $2,963,326.85.    Recommended Action: Approve budget amendment in the amount of $565,727 for Contract No.  2021­204 with CWS Construction Group for the Electric Service Center Site Work, and approve  the reset of staff's 10% change order authority based on the revised contract amount of  $2,963,326.85.      Attachments:  1.CWS Construction Group ­ Electric Utility Operation Center Site Work  2021­204 ­ Signed  Contract 2.Spec 16­07 ­ CCO 1 ­ Grading at Dump Site_Signed 3.Spec 16­07 ­ CCO 2 ­ Water Line, Trellis, Patio, Concrete + Roofing_Signed 4.Spec 16­07 ­ CCO 3 ­ AC_AB, Switchgear, Roof Curbs.docx        7.i. Review Landfill Closure Financial Plan Update.    Recommended Action: Receive and file update to the Landfill Closure Financial Plan.      Attachments:  1.CC Reso­Establishing Funding Closure­Ukiah Solid Waste Disposal 2.2021 Inflation Form Factor (ASR)        7.j. Adoption of Resolution Approving the Application to the CA State Parks Outdoor Equity Grant  Program.    Recommended Action: Adopt Resolution approving an application to the CA State Parks Outdoor  Equity Grant Program.     Attachments:  1.Proposed Resolution       Page 3 of 800 Page 4 of 7  7.k. Consideration and Action Regarding Recommendation to Reject All Bids Received for  Specification No. E38915 Percolation Ponds 1­3 Scarification for the Waster Water Treatment  Plant.      Recommended Action: Consideration and Action Regarding Recommendation to Reject All Bids  Received for Specification No. E38915 Percolation Ponds 1­3 Scarification.      Attachments:  1.Percolation Ponds 1­3 Scarafication­ASR 2.Ghilotti Construction Quote       8. AUDIENCE COMMENTS ON NON­AGENDA ITEMS       The City Council welcomes input from the audience. If there is a matter of business on the agenda that you are interested in,  you may address the Council when this matter is considered. If you wish to speak on a matter that is not on this agenda, you  may do so at this time. In order for everyone to be heard, please limit your comments to three (3) minutes per person and not  more than ten (10) minutes per subject. The Brown Act regulations do not allow action to be taken on audience comments in  which the subject is not listed on the agenda.     9. COUNCIL REPORTS     10. CITY MANAGER/CITY CLERK REPORTS     11. PUBLIC HEARINGS (6:15 PM)      11.a. Consideration of the Planning Commission's Recommendation to 1) Adopt an Initial Study and  Mitigated Negative Declaration (SCH No.2021040428); 2) Conditionally approve the Ukiah  Western Hills Open Land Acquisition & Limited Development Agreement Project; and 3)  Introduce by Title Only an Ordinance to Prezone the Conservation Parcels to “PF” Public  Facilities and the Development Parcels to “R1­H” Single Family Residential­Hillside Overlay  District. File No.: 20­5915.    Recommended Action: 1) Adopt the Initial Study and Mitigated Negative Declaration; and 2)  Conditionally Approve the Ukiah Western Hills Open Land Acquisition & Limited Development  Agreement Project; and 3) Introduce by title only the Ordinance in Attachment 6 to prezone the  Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1­H” Single  Family Residential­Hillside Overlay District.      Attachments:  1.Figures & Maps for Western Hills Open Land Acquisition & Limited DA 2.2021­08­25 PC Hearing Staff Report_Western Hills Open Land Acquisition & Limited DA 3.2021­08­25 PC Minutes Draft 4.Draft Conditions of Approval_Western Hills Open Land Acquisition Limited DA 5.Draft Findings_Western Hills Open Land Acquisition Limited DA 6.Draft Ordinance for Prezoning_Western Hills Open Land Acquisition & Limited DA 7.Final Draft ISMND 081621_Western Hills Open Land Acquisition & Limited DA       12. UNFINISHED BUSINESS     Page 4 of 800 Page 5 of 7  12.a. Receive Status Report and Consider Any Action or Direction Related to the Novel Coronavirus  (COVID­19) Emergency Including Operational Preparedness and Response; Continuity of City  Operations and Services; Community and Business Impacts; and Any Other Related Matters.    Recommended Action: Receive status report and consider any action or direction related to the  Novel Coronavirus (COVID­19) Emergency including operational preparedness and response;  continuity of City operations and services; community and business impacts; and any other  related matters.     Attachments: None        12.b. Presentation of Findings to Improve the Efficiency and Productivity of the Paths, Open Space  and Creeks Commission (POSCC) and the Parks, Recreation, and Golf Commission (PRGC);  and Seeking Direction from Council Regarding the Reformation of the Commissions as a Single  Public Spaces Commission.      Recommended Action: Receive report and approve staff initiation of processes to reform the  Paths, Open Space and Creeks Commission (POSCC) and the Parks, Recreation into a combined  Public Spaces Commission.      Attachments: None        12.c. Adoption of Resolution of the City Council of the City of Ukiah Opposing the Application from  the North Coast Railroad Company and Encouraging the Surface Transportation Board to  Support Railbanking Between Willits and Humboldt County.    Recommended Action: Adopt Resolution opposing the application from the North Coast Railroad  Company and encouraging the Surface Transportation Board to support railbanking between  Willits and Humboldt County.     Attachments:  1.Proposed Resolution       13. NEW BUSINESS      13.a. Award Professional Services Agreement to GHD Inc. in the Amount of $312,491 to Prepare  the  Plans, Specifications, and Estimate for the Great Redwood Trail Phase 4 Project.    Recommended Action: Award Professional Services Agreement to GHD Inc. in the Amount of  $312,491 to Prepare the Plans, Specifications, and Estimate for the Great Redwood Trail Phase 4  Project.     Attachments:  1.Great Redwood Trail Phase 4 Proposal_GHD ­ Council        13.b. Possible Introduction by Title Only of an Ordinance Amending Division 1, Chapter 4, Article 4B  of the City Code Regarding the Procedure for Filling Vacancies on the Design Review Board.    Recommended Action: Introduce by Title Only an Ordinance Amending Division 1, Chapter 4,  Article 4B of the City Code Regarding the Procedure for Filling Vacancies on the Design Review  Board.      Attachments:  1.Proposed Ordinance ­ Redline 2.Proposed Ordinance ­ Clean 3.Design Review Board Application 4.Design Review Board Roster       Page 5 of 800 Page 6 of 7  13.c. Receive Updates on City Council Committee and Ad Hoc Assignments, and, if Necessary,  Consider Modifications to Assignments and/or the Creation/Elimination of Ad Hoc(s).     Recommended Action: Receive report(s).  The Council will consider modifications to committee  and ad hoc assignments along with the creation/elimination ad hoc(s).          Attachments:  1.2021 City Council Special Assignments       14. CLOSED SESSION ­ CLOSED SESSION MAY BE HELD AT ANY TIME DURING THE MEETING      14.a. Conference with Legal Counsel—Anticipated Litigation (Government Code Section 54956.9(d)(2)or(4)) Significant exposure to litigation pursuant to paragraph (2) or (4) of subdivision (d) of Section  54956.9. Consideration of potential litigation arising from emergency drought declaration.  (Government Code Section 54956.9(e)(2)): (Number of potential cases: 1)    Recommended Action: Confer in Closed Session     Attachments: None        14.b. Conference with Legal Counsel—Anticipated Litigation (Government Code Section 54956.9(d)(2)or(3)) Significant exposure to litigation pursuant to paragraph (2) or (3) of subdivision (d) of Section  54956.9: (Number of potential cases: 1)    Recommended Action: Confer in Closed Session     Attachments: None        14.c. Conference with Legal Counsel—Anticipated Litigation (Government Code Section 54956.9(d)(2)or(3)) Significant exposure to litigation pursuant to paragraph (2) or (3) of subdivision (d) of Section  54956.9: (1 potential case, involving possible termination of construction contract for cause)    Recommended Action: Confer in Closed Session     Attachments: None        14.d. Conference with Legal Counsel – Existing Litigation  (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK­CVPT­2018­70200    Recommended Action: Confer in Closed Session     Attachments: None        14.e. Conference with Legal Counsel – Existing Litigation  (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK­CVPT­20­74612    Recommended Action: Confer in Closed Session     Attachments: None       Page 6 of 800 Page 7 of 7  14.f. Conference with Legal Counsel – Existing Litigation  (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: City of Ukiah v. Questex, LTD, et al, Mendocino County Superior Court, Case    No. SCUK­ CVPT­15­66036    Recommended Action: Confer in Closed Session     Attachments: None        14.g. Conference with Legal Counsel – Existing Litigation  (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: Siderakis v. Ukiah, et al, Mendocino County Superior Court, Case No.  21CV00603    Recommended Action: Confer in Closed Session     Attachments: None        14.h. Conference with Real Property Negotiators  (Cal. Gov’t Code Section 54956.8) Property:  APN Nos: 003­500­19; 003­190­08; 057­050­12; 157­050­11; 157­060­003; 001­040­ 83;157­050­03, 157­060­02, 157­050­04, 157­050­03, 157­030­02, 157­050­01, 157­050­02,  157­050­10, 157­050­09, 157­070­01, 157­070­02, 003­190­01; 003­181­01; 003­582­38 Negotiator: Sage Sangiacomo, City Manager;  Negotiating Parties: Dave Hull and Ric Piffero  Under Negotiation: Price & Terms of Payment    Recommended Action: Confer in Closed Session     Attachments: None        14.i. Conference with Labor Negotiator (54957.6) Agency Representative: Sage Sangiacomo, City Manager Employee Organizations: All Bargaining Units    Recommended Action: Confer in Closed Session     Attachments: None       15. ADJOURNMENT  Please be advised that the City needs to be notified 72 hours in advance of a meeting if any specific accommodations or interpreter services are needed  in order for you to attend.  The City complies with ADA requirements and will attempt to reasonably accommodate individuals with disabilities upon  request.  Materials related to an item on this Agenda submitted to the City Council after distribution of the agenda packet are available for public  inspection at the front counter at the Ukiah Civic Center, 300 Seminary Avenue, Ukiah, CA  95482, during normal business hours, Monday through  Friday, 8:00 am to 5:00 pm.   I hereby certify under penalty of perjury under the laws of the State of California that the foregoing agenda was posted on the bulletin board at the main  entrance of the City of Ukiah City Hall, located at 300 Seminary Avenue, Ukiah, California, not less than 72 hours prior to the meeting set forth on this  agenda.  Kristine Lawler, CMC/City Clerk Dated: 9/10/21  Page 7 of 800 Page 1 of 2 Agenda Item No: a. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1062 AGENDA SUMMARY REPORT SUBJECT: Approve the Sole Source Purchase of a 2020 F-150 Police Responder XL Truck in the Amount of $57,030.46 from Redwood Ford. DEPARTMENT: Police PREPARED BY: Noble Waidelich, Chief PRESENTER: Captain Noble Waidelich ATTACHMENTS: 1. Purchase Order 2. Price List 3. Retail Worksheet Summary: Council will consider approving the sole source purchase of a 2020 F-150 Police Responder XL Truck from Redwood Ford in the amount of $57,030.46. Background: Approved in the Police Department's current fiscal budget is the purchase of two police vehicles to maintain our current fleet of patrol specific vehicles. Patrol vehicles have an approximate 3 year/100,000 mile life span. The two vehicles identified for this purchase were patrol-related, SUV-style vehicles, which cost approximately $60,400.78 each to purchase, plus necessary labor to install police equipment such as radios. (See attachment #1) It should be noted that these vehicles have not yet been ordered. Discussion: Staff recently learned of an opportunity to purchase a 2020 Ford F-150 Police Responder XL Truck from Redwood Ford in the amount of $57,030.46, which was previously used as a demo model. (See attachment #3) The MSRP on this vehicle is $62,998.00 and the factory warranty would not start until the date of purchase. This is an urgency item, as the vehicle is being sold at a discounted price and being looked at by other law enforcement agencies. Staff further evaluated the price of this vehicle with other similar options. Ford is no longer manufacturing 2021 models, and 2022 models are not available. However, a build sheet for a 2021 F-150 Police Responder Truck was created as a comparison. The total for this vehicle is $63,453.00. (See attachment #2) This vehicle would be delivered nearly completely outfitted with necessary equipment and would be patrol- ready with minimal labor and expense. In addition to the cost savings, current lead times on all patrol vehicles make this an unique and cost-effective opportunity. The addition of a patrol-rated truck to our patrol fleet would allow officers more options to haul prisoners and bulk property, such as bicycles, or other larger items, which officers encounter on a regular basis. This could also include things such as barricades and traffic cones during emergencies. This vehicle would be available almost immediately for use upon its purchase, unlike other current purchase options. Recommended Action: Approve the sole source purchase of a 2020 F-150 Police Responder XL Truck in the amount of $57,030.46 from Redwood Ford. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: 10020210.80100: $100,000 PROPOSED BUDGET AMOUNT: N/A Page 8 of 800 Page 2 of 2 FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Sage Sangiacomo, City Manager; Dave Kirch, Fleet & Plant Maintenance Supervisor; Mary Horger, Financial Services Manager Page 9 of 800 ATTACHMENT 1 Page 10 of 800 Page 11 of 800 Page 12 of 800 ATTACHMENT 3 Page 13 of 800 Page 1 of 2 Agenda Item No: 3.a. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1058 AGENDA SUMMARY REPORT SUBJECT: Introduction of Neil Davis, Director of Community Services. DEPARTMENT: City Manager / Admin PREPARED BY: Shannon Riley, Deputy City Manager PRESENTER: Shannon Riley, Deputy City Manager ATTACHMENTS: None Summary: The Council is invited to welcome Neil Davis to the position of Director of Community Services. Background: Leadership structure in the Community Services Department has varied tremendously in recent years. Sage Sangiacomo, prior to his appointment to City Manager, served as the Director of Community Services and the Assistant City Manager. Since that time, leadership has been divided by Community Service Administrators and division leads, with some guidance from the City Manager's Office. As this department is very large and complex - consisting of Recreation, Parks, the Grace Hudson Museum, Facilities, and the Ukiah Valley Conference Center, it has become increasingly important that the department have dedicated and experienced leadership at its helm. Discussion: Neil Davis started with the City of Ukiah in 2020 as the part-time Program Administrator for the Community Services Department. In his brief tenure, he has quickly established credibility and an exceptional ability to collaborate with other departments. Therefore, as approved through the 2021-22 budget process, Mr. Davis has been appointed to the full-time position of Community Services Director. With more than two decades of experience in public health and the active promotion of community health, including the startup and ongoing management of community organizations and nonprofits - including budget management and grant seeking - Mr. Davis is eminently qualified for this position. He is largely responsible for the extensive trail network and the bicycle infrastructure around the Ukiah Valley, having founded the Ukiah Valley Trail Group and Walk and Bike Mendocino. In addition to his extensive resume, he already had experience and credibility based on his prior work with the City's Community Development, Public Works, City Manager's Office, and Community Services Departments on various project and programs. Neil Davis is a true asset of the Ukiah community, and City leadership is honored to welcome him to the team. Recommended Action: Receive introduction of Neil Davis, Director of Community Services. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A Page 14 of 800 Page 2 of 2 PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 15 of 800 AGENDA ITEM 5a Page 1 of 2 CITY OF UKIAH CITY COUNCIL MINUTES Special Meeting Ukiah Valley Conference Center 200 South School Street Ukiah, CA 95482 August 30, 2021 3:30 p.m. 1. ROLL CALL AND PLEDGE OF ALLEGIANCE Ukiah City Council met at a Special Meeting on August 30, 2021, having been legally noticed on August 27, 2021. Mayor Orozco called the meeting to order at 3:35 p.m. Roll was taken with the following Councilmembers Present: Douglas F. Crane, Mari Rodin, Josefina Duenas, Jim O. Brown, and Juan V. Orozco. Staff Present: Sage Sangiacomo, City Manager; Rapport, City Attorney; and Kristine Lawler, City Clerk. MAYOR OROZCO PRESIDING. The Pledge of Allegiance was led by Councilmember Rodin. 2. AUDIENCE COMMENTS ON NON-AGENDA ITEMS No public comments were received. 3. NEW BUSINESS a. Consideration of a Mutual Aid Agreement for Emergency Assistance (Related to Water) Among the County of Mendocino, City of Ukiah, the City of Fort Bragg and Other Signatory Cities or Special Districts. Presenters: Sage Sangiacomo, City Manager; David Rapport, City Attorney; and Sean White, Director of Water Resources. Motion/Second: Brown/Rodin to approve the mutual aid agreement (in substantial form; COU No. 2122-098) for emergency assistance related to water and authorize the Mayor to execute. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. THE CITY COUNCIL ADJOURNED FOR CLOSED SESSION AT 4:15 P.M. 4. CLOSED SESSION a. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)or(4)) Significant exposure to litigation pursuant to paragraph (2) or (4) of subdivision (d) of Section 54956.9. Consideration of potential litigation arising from emergency drought declaration. (Government Code Section 54956.9(e)(2)): (Number of potential cases: 1) b. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)or(3)) Significant exposure to litigation pursuant to paragraph (2) or (3) of subdivision (d) of Section 54956.9: (Number of potential cases: 1) Page 16 of 800 City Council Minutes for August 30, 2021, Continued: Page 2 of 2 c. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)or(3)) Significant exposure to litigation pursuant to paragraph (2) or (3) of subdivision (d) of Section 54956.9: (1 potential case, involving possible termination of construction contract for cause) d. Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK-CVPT-2018-70200 e. Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK-CVPT-20-74612 f. Conference with Legal Counsel – Existing Litigation (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: City of Ukiah v. Questex, LTD, et al, Mendocino County Superior Court, Case No. SCUK- CVPT-15-66036 g. Conference with Legal Counsel – Existing Litigation (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: Siderakis v. Ukiah, et al, Mendocino County Superior Court, Case No. 21CV00603 h. Conference with Real Property Negotiators (Cal. Gov’t Code Section 54956.8) Property: APN Nos: 003-500-19; 003-190-08; 057-050-12; 157-050-11; 157-060-003; 001-040- 83;157-050-03, 157-060-02, 157-050-04, 157-050-03, 157-030-02, 157-050-01, 157-050-02, 157- 050-10, 157-050-09, 157-070-01, 157-070-02, 003-190-01; 003-181-01; 003-582-38 Negotiator: Sage Sangiacomo, City Manager; Negotiating Parties: Dave Hull and Ric Piffero Under Negotiation: Price & Terms of Payment i. Conference with Real Property Negotiators (Cal. Gov’t Code Section 54956.8) Property: APNs 184-090-07-00 and 184-100-04-00 Negotiator: Sean White, Water Resources Director and Sage Sangiacomo, City Manager; Negotiating Parties: Noble Vineyard Management Under Negotiation: Instruction to negotiator will concern price and terms of payment. j. Conference with Labor Negotiator (54957.6) Agency Representative: Sage Sangiacomo, City Manager Employee Organizations: All Bargaining Units No reportable action was taken. 5. ADJOURNMENT There being no further business, the meeting adjourned at 5:06 p.m. ________________________________ Kristine Lawler, City Clerk Page 17 of 800 AGENDA ITEM 5b Page 1 of 7 CITY OF UKIAH CITY COUNCIL MINUTES Regular Meeting Virtual Meeting Link: https://attendee.gotowebinar.com/rt/9199312935703156493 Ukiah, CA 95482 September 1, 2021 6:00 p.m. 1. ROLL CALL Ukiah City Council met at a Regular Meeting on September 1, 2021, having been legally noticed on August 27, 2021. The meeting was held virtually at the following link: https://attendee.gotowebinar.com/rt/9199312935703156493. Mayor Orozco called the meeting to order at 6:01 p.m. Roll was taken with the following Councilmembers Present: Douglas F. Crane, Mari Rodin, Josefina Dueňas, Jim O. Brown, and Juan V. Orozco. Staff Present: Sage Sangiacomo, City Manager; David Rapport, City Attorney; and Kristine Lawler, City Clerk. MAYOR OROZCO PRESIDING. 2. PLEDGE OF ALLEGIANCE The Pledge of Allegiance was led by Sarah Marshall. The Mayor called for a moment of silence for the fallen service members from Afghanistan. 3. PROCLAMATIONS/INTRODUCTIONS/PRESENTATIONS a. Receive Presentation of Exceptional Employee Recognition Award. Presenters: Sage Sangiacomo, City Manager; Tim Eriksen, Public Works Direction/City Engineer; and Andy Phillips, Police Lieutenant. Andrew Stricklin, Associate Engineer: Andrew was nominated by a City team member for his professionalism, innovation, and dedication in service to our community. As the “Construction Inspector” for the City Streetscape Project, from April 2020 to present, he responded to numerous difficult customer servicerelated project issues, provided innovative solutions to help the business community remain accessible to the public, and consistently adjusted his schedule to meet the needs of both the City and community. Mario Dogali, Water & Sewer Attendant II, and the Water & Sewer Crew: Mario and the Water & Sewer crew were nominated by a member of the public for their professionalism and dedication in service to our community. Mario responded to a utility customer's notification of a significant water leak outside their home just after 5:00 p.m., during one of the hottest days of the summer, and without hesitation he was observed working “blindly” with both arms down in a meter box attempting to seal off the leak as the water poured up obscuring his view below. Realizing the problem required assistance, he left briefly and returned with the crew and equipment, and everyone worked late into the night to resolve the problem. The customer was thoroughly impressed by the responsiveness of the Water and Sewer crew and their timely attention to the matter and dedicated work ethic. Chase Rigby, Police Officer: Chase was nominated by a City team member for his dedication and compassion in service to our community. On May 8th at approximately 1:10 a.m. Chase and a member of the public responded to a burning house. Prior to fire personnel arriving, he took down a portion of a fence and rescued a 50-year-old female who was trapped in her bedroom inside the burning house Page 18 of 800 City Council Minutes for September 1, 2021, Continued: Page 2 of 7 Staff Comment: Andrew Stricklin, Associate Engineer and Don Brown, Streets Supervisor. Certificates were presented. b. Presentation on the Hazards of Nitrous Oxide from the Ukiah Valley Youth Leadership Coalition, a Program of the Redwood Community Services’ Arbor Program, and Provide Direction Regarding the Coalition's Proposed Ordinance to Ban the Retail Sale of Nitrous Oxide. Presenters: Dr. Marvin Trotter; Mina Al-shahed, PharmD; Kate Feigin, Ukiah Valley Youth Leadership Coalition Director; and the Ukiah Valley Youth Leadership Coalition: Mya McCoy, Miranda Ashurst, Hailey Caborn, Wesley Duong, Sofie Knight, Mercy Ruiz, Randi Pielas, and Aiden Hale. Public Comment: Jackeline Orozco, Kida Grimburg, and James M (read by City Clerk). Council Consensus to refer this item to the City Attorney’s office for review of a potential ordinance to ban or limit the sale of nitrous oxide, specifically taking a look at sale in smoke shops and maybe beyond, and work with the Coalition to move forward with education. Recess for technical issues 6:58 – 7:03 p.m. PowerPoint presentations were received. c. Proclamation of the Ukiah City Council Recognizing September 2021, as Hispanic Heritage Month in the City of Ukiah, and Presentation by Ukiah Vecinos en Accion (UVA) Presenters: Mayor Orozco; Xochilt Martinez, City of Ukiah Equity and Diversity Committee; Lydia Lopez and Sarah Marshall, Ukiah Vecinos en Accion (UVA). Proclamation was received by and Toni Martin. Public Comment: Toni Martin. Presentation was received. 4. PETITIONS AND COMMUNICATIONS 5. APPROVAL OF MINUTES a. Approval of the Minutes for the August 18, 2021, Regular Meeting. Motion/Second: Crane/Brown to approve Minutes of August 18, 2021, a regular meeting, as submitted. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. 6. RIGHT TO APPEAL DECISION 7. CONSENT CALENDAR a. Approve the Purchase of a Caterpillar 926M Wheel Loader from Peterson CAT in the Amount of $237,711.75 as Approved in the Fiscal Year 2021-2022 Capital Budget – Public Works. Pulled by Staff. Page 19 of 800 City Council Minutes for September 1, 2021, Continued: Page 3 of 7 b. Approve the Purchase of a 360X-200H Reclaimer from Asphalt Zipper in the Amount of $163,154.63 as Authorized in the Fiscal Year 2021-2022 Capital Budget – Public Works. Pulled by Staff. c. Approval of Notice of Completion for Pedestrian Access Improvements Project, Specification No. 20-16, at the Crosswalk Across South Dora Street and Luce Avenue – Public Works. d. Award of Contract (COU No. 2122-099) to Pavement Coatings Co. in the Amount of $321,078.00 for the 2021 Slurry Seal of Local Streets – Public Works. e. Award of Contract (COU No. 2122-100) to All Star Painting in the Amount of $53,000 for Painting Services at the Alex Thomas Plaza, and Approval of Corresponding Budget Amendment – Community Services. f. Adoption of Ordinance Amending Division 9, Chapter 2 of the Ukiah Municipal Code to Execute General Plan Housing Element Implementation Tasks and Comply with New State Housing Laws – Community Development. ORDINANCE NO. 1216 ORDINANCE OF THE CITY COUNCIL OF THE CITY OF UKIAH AMENDING DIVISION 9, CHAPTER 2 OF THE CITY CODE TO EXECUTE GENERAL PLAN HOUSING ELEMENT IMPLEMENTATION TASKS AND TO COMPLY WITH NEW STATE HOUSING LAWS. g. Report of Acquisition of Professional Services (COU No. 2122-101) from Alpha Analytical Laboratories, Inc. in the Amount of $15,920.80 for Quarterly Water Sampling and Completion of Chemical Examination Reports for the Ukiah Landfill – Public Works. h. Renewal of Revised Lease Agreement (COU No. 2122-102) Between the City of Ukiah and the Ukiah Player’s Theater for the Use of the Property at 1041 Low Gap Road and Authorization for the City Manager to Negotiate and Execute Corresponding Lease – Community Services. i. Consideration of Adoption of Resolution (2021-39) Authorizing Submittal of an Application to the California Department of Housing and Community Development for Funding under the Competitive Permanent Local Housing Allocation (CPLHA) and, if Selected, Providing Authorization to the City Manager to Execute a Standard Agreement (COU No. 2122-103), Any Amendments Thereto, and Any Related Documents Necessary to Participate in the CPLHA Program; and Approval of Corresponding Budget Revenue and Expense Amendments, if Awarded – Community Development. j. Approve the Purchase of a Maintenance and Protection Plan for LifePak15 Monitor/Defibrillator Units and Lucas Chest Compression System from Stryker in the Amount of $41,030.50 for a five (5) year term – Fire. k. Approve Issuing a Notice of Termination to Paymentus for Electronic Bill Payment Services, and Authorize the City Manager to Negotiate a Contract (COU No. 2122-104) with Invoice Cloud for Online Payment Processing – Finance. l. Approve Sole Source Purchase of LED Lighting System for the Galleries at Grace Hudson Museum from Sixteen5hundred for $86,276.50 Plus Tax and Shipping; and Approve Corresponding Budget Amendment – Community Services. Page 20 of 800 City Council Minutes for September 1, 2021, Continued: Page 4 of 7 Motion/Second: Crane/Rodin to approve Consent Calendar Items 7c-7l, as submitted. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. 8. AUDIENCE COMMENTS ON NON-AGENDA ITEMS No public comment was received. 9. COUNCIL REPORTS Presenter: Mayor Orozco 10. CITY MANAGER/CITY CLERK REPORTS Presenters: Sage Sangiacomo, City Manager; and  Construction Update – Tim Eriksen, Public Works Director / City Engineer.  Update of Drought and Water Conditions – Sean White, Water Resources Director Director.  Measure B Update – Shannon Riley, Deputy City Manager. 11. PUBLIC HEARINGS (6:15 PM) a. Consideration and Possible Adoption of a Resolution Adjusting Fees for Pre Hospital Emergency Medical Services and Emergency Ambulance Services Provided by the Ukiah Valley Fire Authority. Presenters: Doug Hutchison, Fire Chief; Tim Maybee and Scott Cough, AP Triton, LLC. PUBLIC HEARING OPENED AT 8:20 P.M. No public comment was received. PUBLIC HEARING CLOSED AT 8:42 P.M. Motion/Second: Crane/Rodin to adopt the proposed Resolution (2021-40) to adjust the fees for Pre- Hospital Emergency Services and Emergency Ambulance Services provided by the Ukiah Valley Fire Authority. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. RECESS at 8:22 – 8:35 p.m. 12. UNFINISHED BUSINESS 13. NEW BUSINESS a. Award Professional Services Agreement to BKF Engineers in the Amount of $195,789 to Prepare the Plans, Specifications, and Estimate for the Gobbi Street Utility Replacement Project, and Approve Corresponding Budget Amendments. Presenter: Tim Eriksen, Public Works Director/City Engineer. Page 21 of 800 City Council Minutes for September 1, 2021, Continued: Page 5 of 7 Motion/Second: Crane/Rodin to award professional services agreement (COU No. 2122-105) to BKF Engineers in the amount of $195,789 to prepare the plans, specifications, and estimate for the Gobbi Street Utility Replacement Project, and approve corresponding budget amendments. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. Staff Directive to agendize an update and policy discussion regarding undergrounding on Gobbi Street and other streets. b. Discussion and Possible Action to Determine the City’s Position on the 2021 Resolutions being Considered by the League of California Cities and Provide Corresponding Voting Instructions to the City of Ukiah’s Voting Delegate. Presenter: Sage Sangiacomo, City Manager. Motion/Second: Crane/Rodin directs the voting delegates to support both resolutions. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. c. Authorization to Purchase a Seasonal Ice Rink in the Amount of $167,737, and Approve Corresponding Budget Amendments. Presenter: Jake Burgess, Recreation Supervisor. Motion/Second: Brown/Duenas to authorize the Purchase of a Seasonal Ice Rink, and approve corresponding budget amendments. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. d. Consider Approval of a Joint Powers Agreement between the City of Ukiah and County of Mendocino Regarding Land Use and Building Code Enforcement on Property Leased from the City of Ukiah by the Ukiah Rifle and Pistol Club. Presenter: David Rapport, City Attorney. Motion/Second: Rodin/Brown to approve Joint Powers Agreement (COU No. 2122-106) regarding land use and building code enforcement on property leased from the City of Ukiah by the Ukiah Rifle and Pistol Club, and authorize Mayor to sign. Motion carried by the following roll call votes: AYES: Crane, Rodin, Dueňas, Brown, and Orozco. NOES: None. ABSENT: None. ABSTAIN: None. e. Receive Updates on City Council Committee and Ad Hoc Assignments and, if Necessary, Consider Modifications to Assignments and/or the Creation/Elimination of Ad hoc(s). No reports were received. THE CITY COUNCIL ADJOURNED TO CLOSED SESSION AT 9:31 P.M. 14. CLOSED SESSION a. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)or(4)) Significant exposure to litigation pursuant to paragraph (2) or (4) of subdivision (d) of Section 54956.9. Consideration of potential litigation arising from emergency drought declaration. (Government Code Section 54956.9(e)(2)): (Number of potential cases: 1) Page 22 of 800 City Council Minutes for September 1, 2021, Continued: Page 6 of 7 b. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)or(3)) Significant exposure to litigation pursuant to paragraph (2) or (3) of subdivision (d) of Section 54956.9: (Number of potential cases: 1) c. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)or(3)) Significant exposure to litigation pursuant to paragraph (2) or (3) of subdivision (d) of Section 54956.9: (1 potential case, involving possible termination of construction contract for cause) d. Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK-CVPT-2018-70200 e. Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK-CVPT-20-74612 f. Conference with Legal Counsel – Existing Litigation (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: City of Ukiah v. Questex, LTD, et al, Mendocino County Superior Court, Case No. SCUK- CVPT-15-66036 g. Conference with Legal Counsel – Existing Litigation (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: Siderakis v. Ukiah, et al, Mendocino County Superior Court, Case No. 21CV00603 h. Conference with Real Property Negotiators (Cal. Gov’t Code Section 54956.8) Property: APN Nos: 003-500-19; 003-190-08; 057-050-12; 157-050-11; 157-060-003; 001-040- 83;157-050-03, 157-060-02, 157-050-04, 157-050-03, 157-030-02, 157-050-01, 157-050-02, 157-050-10, 157-050-09, 157-070-01, 157-070-02, 003-190-01; 003-181-01; 003-582-38 Negotiator: Sage Sangiacomo, City Manager; Negotiating Parties: Dave Hull and Ric Piffero Under Negotiation: Price & Terms of Payment i. Conference with Real Property Negotiators (Cal. Gov’t Code Section 54956.8) Property: APNs 184-090-07-00 and 184-100-04-00 Negotiator: Sean White, Water Resources Director and Sage Sangiacomo, City Manager; Negotiating Parties: Noble Vineyard Management Under Negotiation: Instruction to negotiator will concern price and terms of payment. j. Conference with Labor Negotiator (54957.6) Agency Representative: Sage Sangiacomo, City Manager Employee Organizations: All Bargaining Units City Attorney Rapport reported out that the Council instructed legal counsel to initiate litigation; Motion by Councilmember Crane, Seconded by Vice Mayor Brown and carried unanimously (5-0). The parties and the court will be disclosed later upon inquiry. Note: Gov. Code §54957(a)(2) the identity of the defendants, and the other particulars shall, once formally commenced, be disclosed to any person upon inquiry, unless to do so would jeopardize the agency’s ability to effectuate service of process on one or more unserved parties, or that to do so would jeopardize its ability to conclude existing settlement negotiations to its advantage. Page 23 of 800 City Council Minutes for September 1, 2021, Continued: Page 7 of 7 15. ADJOURNMENT There being no further business, the meeting adjourned at 10:21 p.m. ________________________________ Kristine Lawler, City Clerk Page 24 of 800 Page 1 of 2 Agenda Item No: 7.a. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2019-82 AGENDA SUMMARY REPORT SUBJECT: Report of Disbursements for the Month of August 2021. DEPARTMENT: Finance PREPARED BY: Candice Rasmason, Accounts Payable PRESENTER: Consent Calendar ATTACHMENTS: 1. August 2021 Summary of Disbursements 2. Account Codes for Reference 3. Object Codes for Reference 4. August 2021 Disbursement Detail Summary: The Council will review and consider approval of the Report of Disbursements for the month of August 2021. Background: Payments made during the month of August 2021 are summarized on the Report of Disbursements. Further detail is supplied on the Schedule of Bills, representing the four (4) individual payment cycles within the month. Accounts Payable Check Numbers (City & UVFA): 3043846-3043967; 3043968-3044055; 3044056-3044163; 3044164-3044241 Accounts Payable Wire Transfers: 49, 50 Payroll Check Numbers:509324-509385; 509386-509439 Payroll Manual Check Numbers: 509439 Direct Deposit Numbers: 106402-106643; 106644-106884 Manual Direct Deposit Numbers: N/A Void Check Numbers:3037408, 3043952, 3043828 Void Direct Deposit Numbers: N/A Discussion: This report is submitted in accordance with Ukiah City Code Division 1, Chapter 7, Article 1. Attachment #1: August 2021 Summary of Disbursements Attachment #2: Account Codes for Reference Attachment #3: Object Codes for Reference Attachment #4: August 2021 Disbursement Detail Page 25 of 800 Page 2 of 2 Recommended Action: Approve the Report of Disbursements for the Month of August 2021. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 26 of 800 Attachment 1 FUNDS: 100 General Fund $696,294.66 700 Sanitary Disposal Site Fund $2,480.84 101 GF-(Sub-Fund) Visit Ukiah 701 Landfill Corrective Fund 105 GF-(Sub-Fund) Fire Authority $25,751.93 702 Disposal Closure Reserve Fund $12,799.50 110 Special General Fund 704 Post Closure Fund - Solid Waste 120 Streets Capital Improvement $933,260.42 710 Ambulance Services Fund $165,199.73 200 City Adminstrative Services $158,850.46 720 Golf Fund $30,361.99 201 Worker's Comp Fund $106,765.31 730 Confernence Center Fund $5,387.52 202 Liability Fund $32,728.78 750 Visit Ukiah 203 Garage Fund $7,400.98 777 Airport Fund $103,468.51 204 Purchasing Fund $6,146.01 778 Airport Capital Improvement Fund $3,408.84 205 Billing & Collections Fund $26,583.66 779 Special Aviation Fund 206 Public Safety Dispatch Fund $34,305.18 800 Electric Fund $1,453,199.69 207 Payroll Posting Fund $14,359.51 801 Electric Capital Reserve Fund $362,917.66 208 Building Maintenance/Corp Yard Fund $48,005.46 803 Lake Mendocino Bond Reserve 209 IT Fund $79,948.22 805 Street Lighting Fund $38,381.67 220 Equipment Reserve Fund 806 Public Benefits Fund 249 City Housing Bond Proceeds 807 Cap and Trade 250 Special Revenue Fund $0.00 820 Water Fund $100,904.75 251 Special Projects Reserve Fund $483.75 822 Water Capital Improvement Fund $872,967.68 253 CITY PROP 172 $61.56 830 Recycled Water Fund $15,156.65 300 Park Development Fund 840 City/District Sewer Fund $106,719.96 301 Anton Stadium Fund $0.00 841 Sewer Contruction Fund 302 Observatory Park Fund 843 Sewer Capital Fund 304 Swimming Pool Fund $0.00 900 Special Deposit Trust $17,284.94 305 Riverside Park Fund $0.00 901 General Service (Accts Recv)$1,871.63 306 Skate Park Fund $0.00 902 U.S.W. Billing & Collection $44,682.00 310 Museum Grants 903 Public Safety - AB 109 $0.00 311 Alex Rorbaugh Recreation Center Fund $3,566.46 905 Federal Emergency Shelter Grant 312 Downtown Business Improvement Fund $13,606.23 905 Mendocino Emergency Service Authority 313 LMIHF Housing Asset Fund 911 Russian River Watershed Association $118,537.88 314 Winter Special Events 915 UVFD $11,899.80 315 Advanced Planning Fund $0.00 916 UVFD PROP 172 $20,664.25 500 2106 Gas Tax Fund $303,043.37 917 UVFD Measure B $6,660.94 501 2107 Gas Tax Fund 918 UVFD Mitigation 503 2105 Gas Tax Fund 940 Sanitation District Special Fund 505 Signalization Fund 942 Rate Stabilization - UVSD Fund 506 Bridge Fund 943 Sanitation District Capital Improvement Fund 507 1998 STIP Augmentation Fund 952 REDIP Sewer Enterprise Fund 508 SB325 Reimbursement Fund 960 Community Redevelopment Agency 509 S.T.P. Fund $14,173.65 961 RDA Housing Pass-Through 510 Trans-Traffic Congest Relief Fund 962 Redevelopment Housing Fund 511 Rail Trail Fund 963 Housing Debt 600 Community Development Block Grant 964 RDA Capital Pass-Through 601 EDBG 94-333 Revolving Loan 965 Redevelopment Capital Improvement Fund 602 Community Development Fund 966 Redevelopment Debt Service 603 08-HOME-4688 967 Housing Bond Proceeds 604 CDBG Grant 09-STBG-6417 968 Non-Housing Bond Proceeds 605 11-HOME-7654 Fund $0.00 969 RDA Obligation Retirement Fund $4,000.00 606 CDBG Grant 10-EDEF-7261 844/944 Sewer Capital Projects Fund $41,731.80 607 Prop 84 Grant Fund 609 13-CDBG-8940 610 City RDA Projects Fund 613 Home Program Activities $1,080,812.00 630 Asset Seizure Fund $13,088.92 631 Asset Seizure Fund (Drug/Alcohol)Retainage Withheld $121,801.99 633 H & S Education 11489(B)(2)(A1)611 CDBG 16-CDBG-11147 $3,375.00 634 Federal Asset Seizure Grants 635 SUP Law Enforcement Service Fund $72.45 636 CBTHP Officer 637 Local Law Enforcement Block Grant 638 Asset Forfeiture 11470.2 H & S 639 Special Revenue - Police 640 Parking District Fund $721.03 691 Museum Fund 695 Transfer Station Fund PAYROLL CHECK NUMBERS: 509324-509385 DIRECT DEPOSIT NUMBERS: 106402-106643 TOTAL DEMAND PAYMENTS- A/P CHECKS $7,265,895.22 PAYROLL PERIOD: 7/25/21-8/7/21 TOTAL DEMAND PAYMENTS- EFT's $0.00 PAYROLL CHECK NUMBERS: 509386-509439 TOTAL PAYROLL CHECKS & DIRECT DEPOSITS $1,060,758.65 DIRECT DEPOSIT NUMBERS: 106644-106884 TOTAL PAYROLL EFT's (TAXES, PERS, VENDORS)$619,389.61 PAYROLL PERIOD: 8/8/21-8/21/21 * vendor name( if applicable) PAYROLL CHECK NUMBERS: DIRECT DEPOST NUMBERS: PAYROLL PERIOD: VOID CHECK NUMBERS: 3037408, 3043952, 3043828 TOTAL PAYMENTS $8,946,043.48 509331 509439 WIRE TRANSFER NUMBERS: 49 CERTIFICATION OF CITY CLERK This register of Payroll and Demand Payments was duly approved by the City Council on ____________________. City Clerk APPROVAL OF CITY MANAGER CERTIFICATION OF DIRECTOR OF FINANCE I have examined this Register and approve same.I have audited this Register and approve for accuracy and available funds. ____________________________________________________________________________________________ City Manager Director of Finance MANUAL CHECK NUMBERS: CITY OF UKIAH REPORT OF DISBURSEMENTS REGISTER OF PAYROLL AND DEMAND PAYMENTS FOR THE MONTH OF AUGUST Page 27 of 800 Account Code Summary Attachment 2 10000000 GENERAL FUND 20012500 CITY CLERK 10017200 SUCCESSOR AGENCY 20012600 ECONOMIC DEVELOPMENT 10020000 POLICE - GEN FUND 20012800 EMERGENCY MANAGEMENT 10020210 POLICE PATROL 20013210 ACCOUNTS PAYABLE 10020214 POLICE VOLUNTEERS 20013220 PAYROLL 10020216 COPS GRANT 20013400 ACCOUNTING 10020217 POLICE ANIMAL CONTROL 20013401 BUDGET MANAGEMENT 10020218 POLICE CSO 20014000 CITY ATTORNEY 10020220 CODE ENFORCEMENT 20015100 CITY TREASURER 10020224 MAJOR CRIMES TASK FORCE 20016100 HUMAN RESOURCES 10021210 CITY FIRE 20023510 HOUSING GRANTS 10022100 PARKS 20023520 NON-HOUSING GRANTS 10022300 AQUATICS 20100000 WORKER'S COMP FUND 10022700 MUSEUM - GEN FUND 20116220 WORKERS COMPENSATION 10022810 RECREATION ADMINISTRATION 20200000 LIABILITY FUND 10022821 ADULT BASKETBALL 20216200 RISK MANAGEMENT 10022822 ADULT SOFTBALL 20300000 GARAGE FUND 10022824 CO-ED VOLLEYBALL 20324100 GARAGE 10022831 YOUTH BASKETBALL 20324110 FLEET MAINTENANCE 10022832 YOUTH SOFTBALL 20400000 PURCHASING FUND 10022840 DAY CAMP 20413500 PURCHASING 10022850 CLASSES & CLINICS 20413510 CAPITAL ASSET MANAGEMENT 10022860 SPECIAL ACTIVITIES 20413520 GRANTS AND SPECIAL PROJECTS 10022900 COMM SVCS SPECIAL SERVICES 20414000 LEGAL SERVICES/EXPENSES 10023100 PLANNING SERVICES 20500000 BILLING AND COLLECTION FUND 10023110 CURRENT PLANNING 20513300 UTILITY BILLING 10023300 BUILDING INSPECTION 20513380 METERING-ELECTRIC 10023320 BUILDING INSPECTION 20513382 METERING-WATER 10023411 CDBG GENERAL ADMIN 20600000 PUBLIC SAFETY DISPATCH FUND 10024200 ENGINEERING/STREETS 20620231 POLICE UKIAH DISPATCH 10024210 ENGINEERING 20620232 POLICE FT BRAGG DISPATCH 10024214 TRAFFIC SIGNAL OPERATIONS 20700000 PAYROLL POSTING FUND 10024224 STORM WATER 20800000 BUILDING & MAINTENANCE 10024310 CORP YARD MAINTENANCE 20822500 BUILDING & MAINTENANCE 10024620 STREETS 20824300 BLDG MAINT CORP YARD 10100000 GF- (SUB-FUND) VISIT UKIAH 20900000 IT FUND 10112700 GF-(SUB-FUND) VISIT UKIAH 20913900 INFORMATION TECHNOLOGY 10500000 MEASURE S GENERAL FUND 22000000 FIXED ASSET FUND 10521210 FIRE AUTHORITY 25100000 SPECIAL PROJECTS RESERVE FUND 12000000 STREET REHABILITATION 25300000 PROP 172 FUND 12024200 PUBLIC WORKS ENGINEERING 25321210 CITY FIRE 13000000 GOV'TL DEBT SVC/RESERVE FUND 30000000 PARK DEVELOPMENT FEES FUND 20000000 CITY ADMINISTRATIVE SERVICES 30022200 PARK DEVELOPMENT 20010000 CITY COUNCIL 30100000 ANTON STADIUM FUND 20012100 CITY MANAGER 30200000 OBSERVATORY PARK FUND 20012200 ADMINISTRATIVE SUPPORT 30300000 PLAYGROUND & PARK AMENITIES FU 20012300 COMMUNITY OUTREACH/PUBLIC INFO 30322230 PLAYGROUND AND PARK AMENITIES Page 28 of 800 Account Code Summary Attachment 2 30400000 SWIMMING POOL FUND 63820210 ASSET FORFEITURE 11470 EXPENDI 30522250 RIVERSIDE PARK 63900000 SPECIAL REVENUE POLICE 30600000 SKATE PARK FUND 64000000 PKG. DIST. #1 OPER & MAINT FUN 30700000 SOFTBALL COMPLEX FUND 64012600 ECONOMIC DEVELOPMENT 31100000 ARRC GENERAL OPERATING FUND 64020213 POLICE PARKING ENFORCEMENT 31122000 ARRC 67000000 FEDERAL AMERICAN RESCUE FUNDS 31200000 DOWNTOWN BUSINESS IMPROVEMENT 69500000 TRANSFER STATION 31212600 ECONOMIC DEVELOPMENT 70000000 SANITARY DISPOSAL SITE FUND 31300000 LMIHF HOUSING ASSET FUND 70024500 LANDFILL 700 31323400 HOUSING 70124500 LANDFILL CORRECTIVE 31323431 LMI GENERAL ADMIN 70200000 DISPOSAL CLOSURE RESERVE FUND 31500000 ADVANCED PLANNING FUND 70224500 LANDFILL CLOSURE 31523100 COMMUNITY PLANNING 70400000 POST CLOSURE FUND-SOLID WASTE 50000000 GAS TAX FUND 71000000 AMBULANCE SERVICES FUND 50024214 TRAFFIC SIGNAL OPERATIONS 71021100 AMBULANCE SERVICES 50500000 SIGNALIZATION FUND 72000000 GOLF FUND 50800000 SB325 REIMBURSEMENT FUND 72022400 GOLF 50824210 SB325 ENGINEERING 73000000 CONFERENCE CENTER FUND 50900000 S.T.P.73022600 CONFERENCE CENTER 50924210 STP ENGINEERING 77700000 AIRPORT FUND 51100000 RAIL TRAIL FUND 77714000 CITY ATTORNEY 51124210 Rail Trail 77725200 AIRPORT OPERATIONS 60000000 COMM. DEVELOPMT. BLOCK GRANT F 77800000 AIRPORT CAPITAL IMPROVEMENT FU 60023411 CDBG GENERAL ADMIN 77825200 AIRPORT CAPITAL 60023412 CDBG ACTIVITY DELIVERY 77900000 SPECIAL AVIATION FUND 61100000 CDBG 16-CDBG-11147 77925200 AIRPORT SPECIAL 61112600 CDBG ECONOMIC DEVELOPMENT 80000000 ELECTRIC FUND 61123410 16-CDBG-11147 80014000 CITY ATTORNEY 61123411 CDBG GENERAL ADMIN 80026110 ELECTRIC OVERHEAD 61200000 FUND 612 UNASSIGNED 80026120 ELECTRIC UNDERGROUND 61223400 HOME CDD HOUSING 80026200 TELEMETRY & CALIBRATION 61223422 HOME ACTIVITY DELIVERY 80026210 SUBSTATION 61323400 HOME HOUSING ACTIVITIES 80026220 HYDROELECTRIC PLANT 61323421 HOME GENERAL ADMIN 80026400 ELECTRIC ADMINISTRATION 62000000 CASP CERTIF & TRAINING 80026440 POWER PURCHASES 62023320 CASP CERTIF & TRAINING 80100000 ELECTRIC CAPITAL RESERVE FUND 63000000 ASSET SEIZURE FUND 80126100 ELECTRIC CIP 63020210 ASSET SEIZURE EXPENDITURE 80126220 HYDROELECTRIC PLANT 63300000 H&S EDUCATION 11489(B)(2)(A1)80500000 STREET LIGHTING FUND 63320210 H&S ASSET SEIZURE EXPENDITURE 80526150 STREET LIGHTING 63400000 FEDERAL ASSET SEIZURE GRANTS F 80600000 PUBLIC BENEFITS CHARGES FUND 63420250 FED ASSET SEIZURE EXPENDITURE 80626450 PUBLIC BENEFITS 63500000 SUP.LAW ENFORCE.SVC.FD(SLESF)80700000 ELECTRIC CAP AND TRADE FUND 63520210 SLESF 80800000 ELECTRIC LOW CARBON FUEL STDS 63600000 CBTHP OFFICER 80826100 ELECTRIC LOW CARBON FUEL STDS 63620210 CBTHP OFFICER 82000000 WATER FUND 63800000 ASSET FORFEITURE 11470.2 H&S F 82027110 WATER Page 29 of 800 Account Code Summary Attachment 2 82027111 PROD OPERATIONS & MAINTENANCE 82027114 DISTRIB OPERATIONS & MAINT 82100000 WATER CAPITAL RESERVE FUND 82200000 WATER CONNECTION FEE FUND 82227113 WATER DISTRIBUTION CAPITAL 83000000 RECYCLED WATER 83027330 RECYCLED WATER 84000000 CITY/DIST. SEWER OPERATING FUN 84027220 WASTE WATER 84027221 CITY WASTE O & M 84027225 WASTE TREATMENT O & M 84100000 SEWER BOND DEBT SERVICE FUND 84127226 WASTEWATER TREATMENT CAPITAL 84200000 RATE STABILIZATION-CITY FUND 84300000 CONNECTION FEE SEWER FUND (CAP 84400000 CITY SEWER CAPITAL PROJECTS FU 84427221 CITY WASTEWATER O&M 844 84427222 CITY WASTE CAPITAL 90000000 SPECIAL DEPOSIT TRUST FUND 91500000 UKIAH VALLEY FIRE DEPARTMENT 91521400 UVFD FIRE ADMINISTRATION 91600000 UVFD PROP 172 91621400 UVFD PROP 172 91700000 UVFD MEASURE B UNASSIGNED 91721400 UVFD FIRE 91800000 UVFD MITIGATION FEES 91821400 UVFD MITIGATION 96900000 REDEVELOPMENT OBLIGATION RETIR 96917200 SUCCESSOR AGENCY 96995669 969 - RDA OBLIGATION RETIREMEN Page 30 of 800 51211 PERS UNFUNDED LIABILITY 54101 POSTAGE 51220 INSURANCE 54102 SMALL TOOLS 51230 WORKERS COMP 54103 LAB SUPPLIES 51240 MEDICARE 54106 SPECIALTY SUPPLIES 51260 FICA 54107 EMS SUPPLIES 51270 UNIFORM ALLOWANCE 54120 PW - SPECIAL SUPPLIES 51290 CELL PHONE STIPEND 54121 PW - ASPHALT CONCRETE 52100 CONTRACTUAL SERVICES 54122 PW - AGGREGATE BASE 52110 AMBULANCE BILLING 54124 PW - CONCRETE/SUPPLIES 52111 DEFIBRILLATOR MAINTENANCE 54125 PW - TRAFFIC PAINT 52112 M. S. OVERSIGHT 54126 PW-PREMARKS 52113 PLANNING STUDIES 54127 PW - SIGN POSTS/SHEETING 52114 COMPLIANCE STUDIES 54128 PW - COLD PATCH MATERIAL 52130 EDUCATIONAL & MARKETING MATL'S 54129 PW - TACK OIL 52131 ASSISTANCE TO SENIORS 54130 PW - SAFETY 52133 MONTHLY DISCOUNT PROGRAM 54131 PW - BARRICADES & CONES 52134 GENERAL ADMIN 54161 BACKGROUND & PHYSICALS 52135 ENERGY CONSERVATION PROGRAM 54162 ADVERTISING 52137 PUBLIC BENEFITS PROGRAM MGMT 54163 INTERVIEW SUPPLIES 52139 RESEARCH DEVELOPMENT & DEMO 54165 NEW EMPLOYEE FINGERPRINT 52150 LEGAL SERVICES/EXPENSES 54166 DOT TESTING PROGRAM 52151 EMPLOYEE BENEFIT ADMIN FEES 54167 EMPLOYEE DEVELOPMENT 52155 ACTIVITY DELIVERY 54169 LIVESCAN 52180 SECURITY SERVICES 54201 PRISONER EXPENSE 52181 VOLUNTEER EXPENSES 54202 MAJOR CRIME INVESTIGATIONS 52301 PROPERTY TAX ADMIN FEE 54203 RECRUITMENT 52304 LAFCO FEES AND PROP TAX EXP 54320 SOFTWARE 52500 TRUSTEE FEES 54330 COMPUTER AND TECHNOLOGY 52510 ADVERTISING & PROMOTION 54500 EQUIP RENTS AND LEASES 52515 ADVERTISING & PUBLICATION 54700 FINES & PENALTIES 52521 LIABILITY INSURANCE PREMIUM 55100 TELEPHONE 52522 LIABILITY & PROPERTY DEDUCT 55200 PG&E 52524 PROPERTY INSURANCE PREMIUM 55210 UTILITIES 52525 WORKER'S COMP. EXPENSE 56100 VEHICLE & EQUIPMENT MAINT. & R 52526 REMIF ASSESSMENT PAYMENTS 56112 EQUIPMENT PARTS FOR RESALE 52527 A.D.P. PREMIUM & DEDUCTIBLE 56120 EQUIPMENT MAINTENANCE & REPAIR 52528 LIABILITY INSURANCE 56125 LAB EQUIP-REPAIR & MAINT. 52529 EARTHQUAKE & FLOOD (DIC)56130 EXTERNAL SERVICES 52532 SAFETY & TRAINING SUPPORT 56210 FUEL & FLUIDS 52533 UVFA RETIREE HEALTH INS 56300 BUILDING MAINT. & REPAIR 52600 RENT 56410 EQUIPMENT RENTAL - PRIVATE 52601 DATA STORAGE & CONNECTIVITY 56504 FACILITY MAINTENANCE & REPAIR 52602 RENTAL OF CITY PROPERTY 56600 AIRFIELD MAINTENANCE & REPAIR 52841 SUCCESSOR AGENCY ADMIN 57100 LEARNING AND DEVELOPMENT 53000 LAWSUIT SETTLEMENT 57101 CONF & TRAINING-AQUATICS 54100 SUPPLIES 57300 MEMBERSHIPS & SUBSCRIPTIONS Object Code Summary Attachment 3 Page 31 of 800 58101 NCPA PLANT GENERATION 58102 NCPA POWER PURCHASES 58103 NCPA TRANSMISSION 58104 NCPA MANAGEMENT SERVICES 58105 NCPA THIRD PARTY SALES 58202 CHEMICALS 58401 AVIATION FUEL 58410 GARAGE LUBRICANTS & PARTS 58510 REIMBURSABLE JOBS 59100 PROPERTY TAXES PAID 59101 FEES 59102 FRANCHISE FEES 59105 CONTRIBUTIONS TO OTHER AGENCY 59106 SENIOR TRASH SUBSIDY 59108 BANK FEES 59400 OTHER EXPENSES 59500 LOANS ISSUED 59502 SCHOLARSHIPS 61200 PURCHASING ALLOCATION 61300 BILLING & COLLECTION ALLOCATIO 61410 RENT ALLOCATION 61420 BUILDING MAINTENANCE ALLOCATIO 61422 IT ALLOCATION 61430 CORP YARD ALLOCATION 61500 INSURANCE ALLOCATION 61600 GARAGE ALLOCATION 61700 DISPATCH 62100 ADMIN & OVERHEAD ALLOCATION 63000 INTERFUND SERVICES USED 70101 LOAN PAYMENTS MADE 70102 BOND INTEREST EXPENSE 70103 LOAN INTEREST 70201 LOAN PRINCIPAL PAYMENTS 70202 BOND PRINCIPAL PAYMENTS 74500 CAPITAL LEASE PRINCIPAL 74501 CAPITAL LEASE INTEREST 80100 MACHINERY & EQUIPMENT 80210 LAND ACQUISITION 80220 BUILDING IMPROVEMENTS 80230 INFRASTRUCTURE 90100 LOAN PROCEEDS 90101 LOAN PAYMENT RECEIVED Page 32 of 800 Attachment 4 Page 33 of 800 Page 34 of 800 Page 35 of 800 Page 36 of 800 Page 37 of 800 Page 38 of 800 Page 39 of 800 Page 40 of 800 Page 41 of 800 Page 42 of 800 Page 43 of 800 Page 44 of 800 Page 45 of 800 Page 46 of 800 Page 47 of 800 Page 48 of 800 Page 49 of 800 Page 50 of 800 Page 51 of 800 Page 52 of 800 Page 53 of 800 Page 54 of 800 Page 55 of 800 Page 56 of 800 Page 57 of 800 Page 58 of 800 Page 59 of 800 Page 60 of 800 Page 61 of 800 Page 62 of 800 Page 63 of 800 Page 64 of 800 Page 65 of 800 Page 66 of 800 Page 67 of 800 Page 68 of 800 Page 69 of 800 Page 70 of 800 Page 71 of 800 Page 72 of 800 Page 73 of 800 Page 74 of 800 Page 75 of 800 Page 76 of 800 Page 77 of 800 Page 78 of 800 Page 79 of 800 Page 80 of 800 Page 81 of 800 Page 82 of 800 Page 83 of 800 Page 84 of 800 Page 85 of 800 Page 1 of 1 Agenda Item No: 7.b. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1034 AGENDA SUMMARY REPORT SUBJECT: Report to Council for the Emergency Replacement of a Flow Meter at the Water Treatment Plant (WTP), from JM Integration LLC, in the Amount of $19,366.39. DEPARTMENT: Water Resources PREPARED BY: Mary Williamson, Buyer II PRESENTER: Consent Calendar ATTACHMENTS: 1. REQ -JM Int 2. JM Int Quote Summary: Council will Receive Report for the Emergency Replacement of a Flow Meter at the Water Treatment Plant, from JM Integration LLC, in the amount of $19,366.39. Background: The "effluent flow meter" meters production and flow of finished water leaving the water treatment plant. Accuracy for the effluent meter has been slowly degrading over the last five years. Accuracy has now degraded to the point of being out of compliance. Discussion: Due to the current drought, there is heightened focus on accurately recording and reporting water production. In order to effectively track production and conservation, this meter needed to be replaced immediately. Please refer to Attachment 1- Requisition from Water Treatment Plant Supervisor and Attachment 2 - JM Integration Quote. Pursuant to the requirements of Section 1522 of the Municipal Code, staff is reporting to City Council for this expenditure. Recommended Action: Receive Report for the Emergency Replacement of a Flow Meter at the Water Treatment Plant, from JM Integration LLC, in the amount of $19,366.39. BUDGET AMENDMENT REQUIRED: No CURRENT BUDGET AMOUNT: 82027111.52100: $215,000 PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: PO 47439 COORDINATED WITH: N/A Page 86 of 800 Attachment 1 Page 87 of 800 Attachment 2 Page 88 of 800 Page 89 of 800 Page 90 of 800 Page 91 of 800 Page 1 of 2 Agenda Item No: 7.c. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1044 AGENDA SUMMARY REPORT SUBJECT: Approval of Budget Amendment in the Amount of $3,000 for CASp Training Expenses for the Chief Building Official. DEPARTMENT: Finance PREPARED BY: Olga Keough, Controller PRESENTER: Consent Calendar ATTACHMENTS: None Summary: The City Council will consider approving a budget amendment in the amount of $3,000 for CASp training expenses for the Chief Building Official. Background: On September 19, 2012, Governor Brown signed into law Senate Bill (SB) 1186 which adds a state fee of $1 on any applicant for a local business license, similar instrument or permit, or renewal. The purpose of this fee is to increase disability access and compliance with construction-related accessibility requirements and to develop education resources for business in order to facilitate compliance with federal and state disability laws, as specified. On October 11, 2017, Governor Brown signed into law Assembly Bill (AB) 1379, which changed the State CASp fee starting January 1, 2018. This bill accomplishes the following: • Removes the sunset provision for the CASp fee, establishing it as a permanent fee. • Increases the fee to $4 for six years from January 1, 2018 through December 31, 2023. The fee then reverts back to $1 beginning January 1, 2024. • During the six-year period of the increased fee, the municipality will retain 90% of the fees collected, remitting 10% to the State. When the fee reverts back to $1, the municipality portion will also revert to 70%, with 30% remitted to the State. The City retains the percentage of the fees collected, of which up to five percent of the retained moneys may be used for related administrative costs of this chapter. The City deposited the money in a special fund 620 “CASp Certification and Training Fund.” The moneys in the fund could be used for increased certified access specialist (CASp) training and certification within the City and to facilitate compliance with construction-related accessibility requirements. Discussion: The City has accumulated $50,357 in CASp fund 670 as of June 30, 2021. The FY 2022 budget for the fund was established for $3,000 in training funds. However, an additional $3,000 is needed for the Chief Building Official to attend specialized trainings in FY2022. Staff recommends approval of a budget amendment in the amount of $3,000 for a total FY 2022 training appropriation of $6,000. Recommended Action: Approve budget amendment in the amount of $3,000 for training expenses for the Chief Building Official. Page 92 of 800 Page 2 of 2 BUDGET AMENDMENT REQUIRED: Yes CURRENT BUDGET AMOUNT: 62023320.57100: $3,000 PROPOSED BUDGET AMOUNT: 62023320.57100: $6,000 FINANCING SOURCE: State business license fee PREVIOUS CONTRACT/PURCHASE ORDER NO.: COORDINATED WITH: Dan Buffalo, Finance Director Page 93 of 800 Page 1 of 1 Agenda Item No: 7.d. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1047 AGENDA SUMMARY REPORT SUBJECT: Adopt Resolution Approving an Initial Study/Negative Declaration and General Plan Amendment No. 21-01 to Allow for Increased Density and Lot Coverage in Compliance with the General Plan Housing Element and State Housing Laws. DEPARTMENT: Community Development PREPARED BY: Mireya Turner, Planning Manager PRESENTER: Consent Calendar ATTACHMENTS: 1. Minutes of August 18, 2021 2. Resolution with Exhibits A and B Summary: The City Council is being asked to re-adopt a Resolution that was adopted on August 18, 2021, but had inadvertently left out the corresponding exhibits. Background: On August 18, 2021, the City Council adopted a Resolution approving an initial study/negative declaration and General Plan amendment No. 21-01 to allow for increased density and lot coverage in compliance with the General Plan Housing Element and State housing laws (See Attachment 1 - 8/8/21 Minutes, Agenda Item 11a). However, Exhibits A and B, mentioned in the Resolution, were inadvertently omitted from the agenda packet when the City Council adopted the Resolution. Discussion: Out of an abundance of caution, Staff is recommending that the Council adopt the updated Resolution with Exhibits A and B (Attachment 2). Recommended Action: Adopt Resolution Approving an Initial Study/Negative Declaration and General Plan Amendment No. 21-01 to Allow for Increased Density and Lot Coverage in Compliance with the General Plan Housing Element and State Housing Laws. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 94 of 800 Page 1 of 6 CITY OF UKIAH CITY COUNCIL MINUTES Regular Meeting Virtual Meeting Link: https://attendee.gotowebinar.com/rt/3862698010362077965 Ukiah, CA 95482 August 18, 2021 6:00 p.m. 1. ROLL CALL Ukiah City Council met at a Regular Meeting on August 18, 2021, having been legally noticed on August 13, 2021. The meeting was held virtually at the following link: https://attendee.gotowebinar.com/rt/3862698010362077965. Mayor Orozco called the meeting to order at 6:05 p.m. Roll was taken with the following Councilmembers Present: Douglas F. Crane, Josefina Dueňas, Jim O. Brown, and Juan V. Orozco. Councilmember Absent by Prearrangement: Mari Rodin. Staff Present: Sage Sangiacomo, City Manager; David Rapport, City Attorney; and Kristine Lawler, City Clerk. MAYOR OROZCO PRESIDING. RECESS: 6:05 – 6:15 P.M. (to address technical issues.) 2.PLEDGE OF ALLEGIANCE The Pledge of Allegiance was led by Kristine Lawler, City Clerk. The Mayor led a moment of silence for Ted Goforth, a former City of Ukiah Public Works Director. Council Consensus to include the City Manager’s following remarks: Mr. Goforth was a team member with the City of Ukiah from 1956 to 1993, and served our community with distinction in both employment and beyond. Mr. Goforth started with the City as an engineering aide, and over a 37-year career promoted through the ranks all the way up to Director of Public Works. Mr. Goforth was instrumental in the development of significant infrastructure projects our city uses today, specifically with water and sewer. Some of those project include number of our water wells, the original granny collector, our water treatment plant, the Civic Center reconstruction project, and the list goes on with countless other projects that Mr. Goforth was absolutely instrumental in developing and coordinating. As documented in his retirement proclamation, he was known for his hard work, innovative spirit, and professionalism. Comments: Councilmember Crane and David Rapport, City Attorney. 3.PROCLAMATIONS/INTRODUCTIONS/PRESENTATIONS a.Proclamation in Honor of the 101st Anniversary of the 19th Amendment to the United States Constitution. Presenter: Councilmember Duenas. Proclamation was received by Val Muchowski, Mendocino Women's Political Coalition Chair. ATTACHMENT 1 Page 95 of 800 City Council Minutes for August 18, 2021, Continued: Page 2 of 6 b. Certificate of Recognition for Frank Acosta for his 101 Years of Life Celebration and His Many Years of Service to Our Country and Community. Presenter: Kristine Lawler, City Clerk. Public Comment: Beatrice Acosta and Lisa Acosta. Certificate was received by Frank Acosta. 4. PETITIONS AND COMMUNICATIONS No public comment was received. 5. APPROVAL OF MINUTES a. Approval of the Minutes for the July 21, 2021, Regular Meeting. Motion/Second: Brown/Duenas to approve Minutes of July 21, 2021, a regular meeting. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. b. Approval of the Minutes for the August 2, 2021, Regular Meeting. Motion/Second: Crane/Duenas to approve Minutes of August 2, 2021, a special meeting, as submitted. Motion carried by the following roll call votes: AYES: Crane, Dueňas, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: Brown. 6. RIGHT TO APPEAL DECISION 7. CONSENT CALENDAR a. Report of Disbursements for the Month of June 2021 – Finance. b. Report of Disbursements for the Month of July 2021 – Finance. c. Approval of Settlement Agreement (COU No. 2122-084) in the Amount of $13,391.33 with the Defense Logistics Agency Energy, an Agency within the United States Department of Defense, Related to the Erroneous Charges of Excise and Sales Tax on Department of Defense Fuel Purchases at the Ukiah Regional Airport – Finance. d. Consideration of Adoption of Resolution (2021-35) Approving the Application to the CA Drought, Water, Parks, Climate, Coastal Protection, and Outdoor Access for All Act of 2018 Per Capita Grant Program to Replace the Large Playground Structure at Todd Grove Park – Community Services. e. Consideration of Adoption of Resolution (2021-36) Appointing James Bair to the Paths, Open Space, and Creeks Commission (POSCC) – City Clerk. f. Report of the Purchase (PO No. 47401) of Variable Frequency Drive (VFD) for the High Service Pump Station at the Water Treatment Plant (WTP) from Industrial Technical Services Inc. of La Miranda CA in the Total Amount of $97,255.41 – Water Resources. g. Approval for the City Manager to Negotiate and Execute a Lease Agreement (COU No. 2122-085) Between the City of Ukiah and the Ukiah Youth Baseball League Inc., for the Use of a Portion of Riverside Park – Community Services. h. Approval of Amendment No. 2 to a Professional Services Agreement (COU No. 1920-138-A2) with PSOMAS for an Amount Not to Exceed $2,600 to Provide Land Surveying Services Related to the City's Annexation Efforts; and Approval of Corresponding Budget Amendment – Community Development. Page 96 of 800 City Council Minutes for August 18, 2021, Continued: Page 3 of 6 i. Adoption of Resolution (2021-37) of the City of Ukiah Establishing Two-Hour and Five-Hour Time Limits on Parking on Designated Streets Pursuant to Ukiah City Code Sections 7160, 7163, and 7164, Thereby Replacing 26 Five-Hour Spaces with Two-Hour Spaces, 11 Ninety-Minute Spaces with Two-Hour Spaces, and 9 Two-Hour Spaces with Five-Hour Spaces – Administration. j. Approval of Lease Agreement (COU No. 2122-086) Between the City of Ukiah and Judy Chan for Use of Parks Maintenance Facilities at 185 Mason St, Ukiah – Community Services. k. Approval of Agreement (COU No. 2122-087) with Moss Adams, LLP for Accounting Review Services of Ukiah Waste Solutions, Inc., and Solid Waste Systems, Inc. – Finance. l. Approve Contract Amendment (COU No. 1819-215-A5) with Thomas Hise, Architect, for Architectural Services for the Grace Hudson Museum in the Amount of $14,163, and Approve Corresponding Budget Amendment – Community Services. m. Approval of Change Order #06 (COU No. 2021-087-CO6) to CV Larsen Company in the Amount of $430,773.04 and Extend the Pressure Zone 2 South Reservoir Replacement Project, Specification No. 20-02 for a Total Revised Contract Amount of $1,206,724.09 – Water Resources. n. Approval of Purchase of One (1) Set of Genesis Auto Extrication Tools from Municipal Emergency Services in the Amount of $30,834.41 per the Fiscal Year 2022 Capital Improvement Plan (CIP) – Fire. o. Approval of Purchase of One (1) Breathing Air Compressor from Bauer Compressors in the Amount of $55,131.81 per the Fiscal Year 2022 Capital Improvement Plan (CIP) – Fire. p. Approval of Lease Purchase of Two (2) 2021 North Star 147-1 Type 1 Ambulances from Braun NW Inc., in the Amount of $382,410.00 Plus Tax per the Fiscal Year 2022 Capital Improvement Plan (CIP) and Approval of Corresponding Budget Amendment(s) – Fire. q. Report of Acquisition (PO 47389-00) from Western Fire Supply in the Amount of $23,776.04 for a Solo Rescue SCBA-Decon Washer – Fire. r. Notification of Change Order #2 (COU No. 2021-185-CO2) to Coastal Mountain Electric in the Amount of $15,700.62 for Design Changes due to Unidentified Obstacles with the Electric Service Transfer from Overhead to Underground on State Street, and Approve Corresponding Budget Amendment – Electric Utility. Motion/Second: Brown/Crane to approve Consent Calendar Items 7a-7r, as submitted. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. 8. AUDIENCE COMMENTS ON NON-AGENDA ITEMS No public comment was received. 9. COUNCIL REPORTS Presenters: Councilmembers Duenas and Crane 10. CITY MANAGER/CITY CLERK REPORTS Presenters:  Construction Update – Tim Eriksen, Public Works Director / City Engineer.  Speeding Education/Enforcement – Sage Sangiacomo, City Manager. Page 97 of 800 City Council Minutes for August 18, 2021, Continued: Page 4 of 6 Update of Drought and Water Conditions – Sean White, Water Resources Director. 11. PUBLIC HEARINGS (6:15 PM) a.Consideration and Possible Introduction by Title Only of Proposed Ordinance Amending Division 9, Chapter 2 of the Ukiah Municipal Code to Execute General Plan Housing Element Implementation Tasks and Comply with New State Housing Laws; and Consideration of Adoption of Resolution Approving Initial Study/Negative Declaration and General Plan Amendment No. 21-01 to Allow for Increased Density and Lot Coverage in Compliance with the General Plan Housing Element and State Housing Laws. Presenters: Craig Schlatter, Community Development Director and Mireya Turner, Planning Manager. PUBLIC HEARING OPENED AT 7:42 P.M. No public comment was received. PUBLIC HEARING CLOSED AT 7:42 P.M. Motion/Second: Brown/Crane to approve the minimum duplex parking requirement to be 1.5 space(s) per unit. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. Motion/Second: Brown/Crane to adopt Resolution (2021-38) approving IS/ND and General Plan Amendment No. 21-01 to allow for increased density and lot coverage in compliance with the General Plan Housing Element and State housing laws. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. Motion/Second: Brown/Crane to introduce the Ordinance by title only. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. City Clerk, Kristine Lawler, read the following title into the record: ORDINANCE OF THE CITY COUNCIL OF THE CITY OF UKIAH AMENDING DIVISION 9, CHAPTER 2 OF THE CITY CODE TO EXECUTE GENERAL PLAN HOUSING ELEMENT IMPLEMENTATION TASKS AND TO COMPLY WITH NEW STATE HOUSING LAWS. Motion/Second: Brown/Crane to introduce the proposed Ordinance Amending Division 9, Chapter 2 of the Ukiah Municipal Code to execute General Plan Housing Element Implementation Tasks and comply with new State housing laws. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. 12. UNFINISHED BUSINESS a.Receive Status Report and Consider Any Action or Direction Related to the Novel Coronavirus (COVID-19) Emergency Including Operational Preparedness and Response; Continuity of City Operations and Services; Community and Business Impacts; and Any Other Related Matters. Presenter: Tami Bartolomei, Office of Emergency Services Coordinator. Public Comment: Robert Reveles. Report was received. RECESS: 8:10 – 8:22 P.M. Page 98 of 800 City Council Minutes for August 18, 2021, Continued: Page 5 of 6 Councilmember Duenas returning at 8:32 p.m. 13. NEW BUSINESS a. Discussion and Consideration of Possible Approval of Sale of C & S Holdings’ Stock to Waste Connections US, Inc., and Possible Approval of Sale Agreement, Based on Availability of Information and Staff Recommendations at the time of the August 18th, City Council Meeting. Presenters: David Rapport, City Attorney; Dave Carroll, C&S Waste Solutions; Sue Vandelinder and Dan Schooler, Waste Connections; and Bruce McCracken, Ukiah Waste Solutions. Public Comment: Robert Reveles. Motion/Second: Brown/Orozco to approve the Assignment and Consent Waste Collection Contract (COU No. 2122-088), and the Assignment and Consent Transfer Station Contract and Lease Agreement (COU No. 2122-089), and authorize the City Manager to execute them on behalf of the City. Motion carried by the following roll call votes: AYES: Crane, Dueňas, Brown, and Orozco. NOES: None. ABSENT: Rodin. ABSTAIN: None. c. Receive Updates on City Council Committee and Ad Hoc Assignments and, if Necessary, Consider Modifications to Assignments and/or the Creation/Elimination of Ad hoc(s). No Reports were received. THE CITY COUNCIL ADJOURNED TO CLOSED SESSION AT 9:01 P.M. 14. CLOSED SESSION a. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2) & (4)) Significant exposure to litigation pursuant to paragraph (2) or (4) of subdivision (d) of Section 54956.9. Consideration of potential litigation arising from emergency drought declaration. (Government Code Section 54956.9(e)(2)): (Number of potential cases: 1) Recommended Action: Confer in Closed Session b. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2 & 3)) Significant exposure to litigation pursuant to Government Code Section 54956.9(d)(2)(Number of potential cases: 1) c. Conference with Legal Counsel – Anticipated Litigation (Government Code Section 54956.9(d)(2)) Significant exposure to litigation pursuant to Government Code Section 54956.9(d)(2)(Number of potential cases: 2) d. Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Gerardo Magdaleno, by and through his Guardian Ad Litem, Pedro Francisco Magdaleno v. City of Ukiah, Justin Wyatt (Fed. Dist. Ct. N.D. Cal.) 3:21-2609 VC. Page 99 of 800 City Council Minutes for August 18, 2021, Continued: Page 6 of 6 e.Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK-CVPT-2018-70200 f.Conference with Legal Counsel – Existing Litigation (Government Code Section 54956.9(d)(1)) Name of case: Vichy Springs Resort v. City of Ukiah, Et Al; Case No. SCUK-CVPT-20-74612 g.Conference with Legal Counsel – Existing Litigation (Cal. Gov’t Code Section 54956.9(d)(1)) Name of case: City of Ukiah v. Questex, LTD, et al, Mendocino County Superior Court, Case No. SCUK- CVPT-15-66036 h.Conference with Real Property Negotiators (Cal. Gov’t Code Section 54956.8) Property: APN Nos: 157-050-03, 157-060-02, 157-050-04, 157-050-03, 157-030-02, 157-050- 01, 157-050-02, 157-050-10, 157-050-09, 157- 070-01, 157-070-02, 003-190-01 Negotiator: Sage Sangiacomo, City Manager; Negotiating Parties: Dave Hull and Ric Piffero Under Negotiation: Price & Terms of Payment i.Conference with Real Property Negotiators (Cal. Gov’t Code Section 54956.8) Property: APNs 184-090-07-00 and 184-100-04-00 Negotiator: Sean White, Water Resources Director and Sage Sangiacomo, City Manager; Negotiating Parties: Noble Vineyard Management Under Negotiation: Instruction to negotiator will concern price and terms of payment. j.Conference with Labor Negotiator (54957.6) Agency Representative: Sage Sangiacomo, City Manager Employee Organizations: All Bargaining Units Direction was given to staff. 15. ADJOURNMENT There being no further business, the meeting adjourned at 9:40 p.m. ________________________________ Kristine Lawler, City Clerk Page 100 of 800 1 RESOLUTION NO. 2021-XX RESOLUTION OF THE CITY COUNCIL OF THE CITY OF UKIAH APPROVING AN INITIAL STUDY/NEGATIVE DECLARATION AND GENERAL PLAN AMENDMENT NO. 21-01 TO ALLOW FOR INCREASED DENSITY AND LOT COVERAGE IN COMPLIANCE WITH THE GENERAL PLAN HOUSING ELEMENT AND STATE HOUSING LAWS. WHEREAS: 1.State Planning Law allows any mandatory element of the General Plan to be amended as many as four times in a calendar year; and 2.A duly noticed Planning Commission hearing was held on July 14, 2021 to consider the Draft General Plan Amendment and Negative Declaration, and after receiving testimony, considering the staff report, and due deliberation, the Planning Commission formulated a recommendation to the City Council to adopt the General Plan Amendment and Negative Declaration; and 3.The City Council has reviewed the Draft General Plan Amendment and Negative Declaration and conducted a public hearing; and 4.The Initial Study and Negative Declaration adequately assesses the impacts of this General Plan Amendment NOW, THEREFORE, BE IT RESOLVED that: 1.The City Council hereby approves the Final Initial Study/Negative Declaration and Findings to Adopt a Negative Declaration for General Plan Amendment No. 21-01, dated June 7, 2021, pursuant to the Requirements of the California Environmental Quality Act (CEQA), attached hereto as Exhibit A. 2.The City Council hereby approves General Plan Amendment No. 21-01 (Exhibit B). PASSED AND ADOPTED this 18th day of August, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: Juan V. Orozco, Mayor ATTEST: Kristine Lawler, City Clerk ATTACHMENT 2 Page 101 of 800 CALIFORNIA ENVIRONMENTAL QUALITY ACT DRAFT INITIAL STUDY AND NEGATIVE DECLARATION FOR HOUSING RELATED ZONING CODE UPDATES June 7, 2021 Prepared by: City of Ukiah Community Development Department Planning Division 300 Seminary Avenue, Ukiah, CA 95482 Exhibit A Page 102 of 800 Table of Contents I. PROJECT INFORMATION 1 II. PROJECT DESCRIPTION 2 1. Project Location 2 2. Environmental Setting 2 3. Background 2 4. Project Components 3 2019-2027 Housing Element Implementing Programs 3 Housing-Related State Legislation 4 III. ENVIRONMENTAL FACTORS POTENTIALLY AFFECTED 2 IV. DETERMINATION 3 V. EVALUATION OF ENVIRONMENTAL IMPACTS 5 1. Aesthetics 5 2. Agriculture and Forestry Resources 8 3. Air Quality 9 4. Biological Resources 11 5. Cultural Resources 13 6. Energy 16 7. Geology and Soils 17 8. Greenhouse Gas Emissions 18 9. Hazards and Hazardous Materials 19 10. Hydrology and Water Quality 22 11. Land Use and Planning 23 12. Mineral Resources 25 13. Noise 25 14. Population and Housing 27 15. Public Services 28 16. Recreation 29 17. Transportation 30 18. Tribal Cultural Resources 32 19. Utilities and Service Systems 34 20. Wildfire 35 21. Mandatory Findings of Significance 36 VI. REFERENCES 38 ATTACHMENTS A. Proposed Zoning Code Text Revisions B. Proposed Objective Design and Development Standards for New Residential Construction (Article 5.75) C. Proposed Flexible Parking Standards D. List of California Native American Tribes contacted under Senate Bill 18 Page 103 of 800 1 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah I. PROJECT INFORMATION Project Title: Housing Related Zoning Code Updates Lead Agency Address and Phone Number: City of Ukiah 300 Seminary Avenue Ukiah, California 95482 (707) 463-6200 Project Contact Person and Phone Number: Mireya G. Turner, Planning Manager City of Ukiah Community Development Department (707) 463-6203 mturner@cityofukiah.com CEQA Contact Person and Phone Number: Michelle Irace, Planning Manager City of Ukiah Community Development Department (707) 463-6268 mirace@cityofukiah.com Project Location: All properties within the City of Ukiah limits zoned for commercial and residential land uses City of Ukiah General Plan Designations: Commercial and Residential land use designations • Commercial • Low Density Residential • Medium Density Residential • High Density Residential City of Ukiah Zoning Districts: Commercial and Residentially-zoned properties: • Article 3 “R-1” Single-family Residential • Article 4 “R-2” Medium Density Residential • Article 5 “R-3” High Density Residential • Article 6 “CN” Neighborhood Commercial • Article 7 “C-1” Community Commercial • Article 8 “C-2” Heavy Commercial • Article 20 Administration and Procedures • Article 21 Definitions Page 104 of 800 2 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah II. PROJECT DESCRIPTION 1. Project Location The Housing Related Zoning Code Updates (“Proposed Project”) includes all residential and commercial zoned properties within the City of Ukiah limits. See Figure 1, Location Map and Figure 2, Zoning Map. 2. Environmental Setting The City of Ukiah includes approximately 4.72 square miles. It serves as the County Seat of Mendocino County, as well as the county’s commercial hub. Predominant land uses in the City include single family residential, multi-family residential, and commercial uses ranging from local commercial to service commercial, as well manufacturing, industrial and public facilities. Further west is undeveloped open space, and steep, densely vegetated areas interspersed with rural residential lots within the Western Hills and Mendocino County’s jurisdiction. The City of Ukiah sits in the Ukiah Valley in central Mendocino County, with elevations varying from approximately 600-feet above mean sea level up to approximately 3,000 feet in the hills surrounding the city. Ukiah is located along the Highway 101 corridor and near the east/west intersection of Highway 20, two hours north of the Golden Gate Bridge. The City of Ukiah is situated within the Coast Range geologic province. The North Coast Range is comprised of a geologic feature unique to California, the Franciscan Formation, which dictates the vegetative communities. The Franciscan Formation is comprised of serpentine, sandstone, and other sedimentary rocks. This area is characterized by a Mediterranean climate; the winters are cool and wet, and the summers are hot and dry. Annual temperatures for this region range from about 30 to 100 degrees Fahrenheit. The Ukiah Valley is located approximately 30 miles east and inland from the Pacific Ocean. It runs north-south for approximately nine miles, with a maximum width of three miles. The Russian River enters the valley at the north end and runs south along the valley floor. 3. Background The City’s first General Plan was originally adopted in 1974, updated in 1995, and was last amended in 2019, with adoption of the 2019-2027 Housing Element. The General Plan serves as a blueprint for future development and growth of the community. The City is currently in the process of completing a General Plan Update (the “2040 General Plan”) that will map out the vision for community development through 2040; until the new General Plan is adopted, the 1995 General Plan (as amended in 2019) is considered the applicable plan. The 2019-2027 Housing Element was adopted by the Ukiah City Council on October 23, 2019, and certified by the California Department of Housing and Community Development (HCD) on December 5, 2019. The Housing Element must demonstrate the availability of appropriately zoned land needed to meet the Regional Housing Needs Allocation (RHNA) (Government Code Sections 65582(a)(3)) and 65582.2(a)), and represents the City of Ukiah’s efforts Page 105 of 800 3 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah to fulfill requirements under the State Housing Element Law and responds to Ukiah’s housing needs by identifying policies and implementing actions for meeting those needs. Specifically, the Housing Element contains five (5) Goals, 19 Supporting Policies, and 33 Implementing Programs to promote and facilitate housing within the City of Ukiah. Zoning and land use are governed by the City’s Zoning Ordinance, as outlined in Division 9, Chapter 2 of the Ukiah City Code. The purpose of the Ukiah Zoning Code is to promote the growth of the City in an orderly manner and to promote and protect the public health, safety, peace, comfort and general welfare. Residential development of varying intensity is allowed in all zoning districts of the Ukiah Zoning Code, with the exception of the Manufacturing and Public Facility Zoning Districts. The intent of the Proposed Project is to amend the Zoning Code in order to enact several Implementing Programs identified in the Housing Element. In addition, the proposed amendments are in accordance with recent State laws regarding facilitation of housing. California is in the midst of a housing crisis in which communities throughout the State are challenged with accommodating their fair share of housing production (as identified through the RHNA). The housing shortage has prompted the State legislature and Governor to enact new laws requiring cities and counties to streamline housing approval by establishing a by-right, ministerial approval process for all new residential construction, excluding single-family homes. 4. Project Components The City of Ukiah is proposing Housing-related Zoning Code amendments to the City of Ukiah’s Municipal Code. The Housing-related Zoning Code amendments include enacting both the City of Ukiah’s 2019-2027 Housing Element Implementing Programs and updates required for compliance with new State laws (“Proposed Project”). Summaries of the Implementing Programs and the State laws related to the proposed Zoning Code amendments are listed below. A complete list of Implementing Programs are included as Appendix G of the Housing Element which may be found at http://www.cityofukiah.com/projects/housing-element-update/. 2019-2027 Housing Element Implementing Programs 1e: Develop Objective Multifamily Residential Design and Development Standards. Develop Objective multifamily residential design and development standards, including standards for multifamily in the R-2. R-3, C-1, and C-2 zones (2019-2027 Housing Element Program 2h). If a project is in compliance with these standards, their project will be ministerial, and will only require a building permit, rather than a Use Permit/Site Development Permit. These design standards would both facilitate development at the allowable densities and provide guidance and certainty in design standards to ensure quality housing is developed in the community. The Objective Design and Development Standards (“Objective Standards”) were approved by the City Council, in concept, in December 2020, and are included in Attachment B. The Objective Design and Development Standards will be included in the Proposed Project for final City Council review and approval. 2h: Ensure Capacity of Adequate Sites for Meeting Regional Housing Needs Allocation (RHNA). The following Zoning Code amendments to streamline housing production in order to meet the City’s new RHNA allocation of 239 units from the 2019-2027 Housing Element: Page 106 of 800 4 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah • Revise C-1 and C-2 Zones to allow by-right housing development, with objective design and development standards. Housing types allowed by-right will include multifamily, Single Room Occupancies (SROs), duplexes, triplexes, and fourplexes. • Revise the R-2 Zone to allow up to 15 dwelling units per acre (du/ac) instead of 14 dwelling units per acre. • Revise the C-N Zone to increase residential density from 6 du/ac to 15 du/ac and allow similar housing types as those allowed in R-2. 2l: Compliance with AB 2162. Revisions to the Zoning Code to allow supportive housing by right in zones where multi-family and mixed uses are permitted, including non-residential zones permitting multi-family uses. 3a: Modifications to Development Standards to Maximize Housing Development. Maximize housing development by amending development standards pertaining to height, density, setback reduction, site area. These Zoning Code amendments include: • Increasing maximum allowable height for new residential buildings. • Increasing density. • Reducing yard setbacks. • Reducing minimum site area. • Revising the R-1 (Single-family Residential) and R-1-H (Single-family Residential- Hillside Combining) 1 zoning districts to allow by-right and/or permit other residential building types and densities. 3b: Flexible Parking Standards. Include Flexible Parking Standards that reduce parking requirements, specifically in zoning districts that allow for lower-income housing developments, in order to streamline and remove barriers to multifamily housing development. The Moderate Parking Standards, and Unbundled Parking (with a minimum of one (1) parking space per dwelling unit) were approved by the City Council, in concept, in December, 2020, and are included in Attachment C. Flexible Parking Standards will be included in the Proposed Project for final City Council review and approval. Housing-Related State Legislation Senate Bill 2(Approved by Governor 10/13/2007) amended GC • GC 65583(b)(3): Supportive and transitional housing shall be a use by right anywhere residential uses are by right. Also, they are to be evaluated only by the criteria for residential uses of similar size. • Added definition of supportive and transitional housing to GC Senate Bill 234 (Approved by Governor on 9/5/2019): Jurisdictions cannot require discretionary permits for large or small family daycares in any zoning district allowing for primary residential use. 1 Although identified in Implementation Program 3a, the Hillside Overlay District is not included in the proposed amendments at this time. Page 107 of 800 5 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah Assembly Bill 101 (Approved by Governor on 7/31/19) Adding Low barrier Navigation Centers as a use by right in areas zoned for mixed uses and nonresidential zones permitting multifamily uses if it meets specified requirements. Assembly Bill 3182 (Approved by Governor on 9/28/2020) Regarding Rental Restrictions (amendment to 9016 R-1) Requires ministerial approval of one ADU and one JADU per parcel with a primary SFD. Previously was one ADU or one JADU. Assembly Bill 2162 (Approved by Governor on 9/26/2018) Supportive housing is a use by right in zones where multifamily and mixed uses are permitted, including nonresidential zones permitting multifamily, uses. Prohibits requiring parking if within one-half mile of a public transit stop. A summary of the proposed amendments are provided in Table 1 below, and proposed Zoning Code text amendments are included as Attachment A. Text proposed for deletion is shown in Strikethrough, while text proposed to be added is shown in Underline. The proposed Zoning Code Amendments will also require an amendment to the City of Ukiah’s General Plan to increase allowable building density proposed in the Zoning Code Amendments. While the proposed changes include policy changes to facilitate housing development, no development or physical changes to the environment are proposed. Page 108 of 800 1 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah Table 1, Summary of Proposed Zoning Code Amendments PROPOSED ZONING CODE AMENDMENTS Zoning District Developme nt Standard R1 R2 R3 CN C1 C2 Density No change: 6 dwelling units per acre (du/ac) Changing from 14 du/ac to 15 du/ac No change: 28du/ac) Changing from 6 du/ac to 15 du/ac No change: 28 du/ac) No change: 28 du/ac) Height No change: (30 ft and for accessory buildings a maximum height of twenty feet (20') or the maximum height of the main building whichever is less). Changing from 30 to 35 ft for main bldgs. No change to accessory (20 ft or the maximum height of the main building whichever is less) Changing from 40 to 50 ft for main structures, unless abutting R1 or R2 (then 35 ft). no change to accessory structures (30 ft) Changing from 30 to 35 ft for main bldgs. No change to accessory (20ft) No change (50ft) Changing from 40 ft to 50 ft for primary and 20 to 30 ft for accessory Setbacks Reduced: front- 15 ft (but 25 for garage/accessor y structures); sides-10 ft (no change); rear-15 ft. Sides/rear for accessory-5 ft. Corners-15 ft. No change to 4 ft side and rear for Accessory Dwelling Units (ADUs) No change for SFDs but reduced for multifamily: front-10 ft (25 ft for garage); sides-5 ft; rear-10 ft (but 15 for multi- story); corners- 10 ft. Reducing distance between structures to 10 ft No change for SFDs but reduced for multifamily: front-10 ft (25 ft for garage); sides-5 ft; rear-10 ft (but 15 for multi- story); corners- 10 ft. Reducing distance between structures to 10 ft No change to front (10 ft single story & 15 for second story). Reducing side from 10 ft to 5 ft. Rear stays 10 ft. No change. Front yards for single & multi-story buildings: 5 ft & 10 ft on corner lots. Rear and side yards: None required except where the rear or side of a lot abuts on an R1, R2, or R3 district, in which case such rear or side yard shall be that of the adjoining zone. No change. Front yards for single & multi-story buildings: 5 ft & 10 ft on corner lots. Rear and side yards: None required except where the rear or side of a lot abuts on an R1, R2, or R3 district, in which case such rear or side yard shall be that of the adjoining zone. Page 109 of 800 2 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah Required Site Area No change Removing required minimum area Removing required minimum area Removing minimum required area for residential and Mixed- Use. No change for commercial (7k) Commercial-6k/each building or group of buildings &a minimum width of sixty feet (60’) on interior lots;7k & 70 ft wide for corner lots Residential and Mixed-Use. No minimum building site area. Mobile Home Parks- Minimum of two (2) acres. No change Allowed/- Permitted Uses Allowed: Multiple-family residential dwellings in the form of duplexes, transitional housing, and supportive housing on corner lots. Prohibited: triplex, fourplexes, SROs, and rooming and boarding houses. Multifamily that complies with the design standards are permitted by Allowed: SFDs including manufactured/modul ar homes, transitional housing, and supportive housing. Allowed: Multiple- family dwellings (i.e., duplexes, triplexes, fourplexes, condominiums, apartments houses, transitional housing, supportive housing, SROs, and rooming or boarding houses. multifamily that complies with the design standards are permitted by right (no UP/SDP). Allowed: SFDs, including manufactured/modul ar homes, transitional housing, and supportive housing). Allowed: Multiple- family dwellings (i.e., duplexes, triplexes, fourplexes, condominiums, apartments, transitional housing, supportive housing, single-room occupancies (SROs), and rooming or boarding houses). Multi-family that complies with the design standards are permitted by right (no UP/SDP). Allowed: Low Barrier Navigation Centers Allowed: Multiple- family dwellings (duplexes, triplexes, fourplexes, condominium s, apartment houses, transitional housing, supportive housing, SROs, and rooming or boarding houses). Multiple- family Allowed: Low Barrier Navigation Centers Allowed: Multiple- family dwellings (duplexes, triplexes, fourplexes, condominiums, apartment houses, transitional housing, supportive housing, SROs, and rooming or boarding houses). Multiple-family dwellings that comply with the design t standards are permitted by right (no UP/SDP). Allowed: daycares Allowed: Small emergency shelters; Family daycares, large and small Allowed: Low Barrier Navigation Centers Allowed: Multiple- family dwellings (duplexes, triplexes, fourplexes, condominiums, apartment houses, transitional housing, supportive housing, SROs, and rooming or boarding houses). Multiple-family dwellings that comply with the design t standards are permitted by right (no UP/SDP). Allowed: daycares Allowed: Small emergency shelters; Family daycares, large and small Page 110 of 800 3 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah right (no UP/SDP). Allowed: Family daycares, large and small Allowed: Family daycares, large and small Permitted: Multiple- family dwellings that do not comply with the design standards Allowed: : Family daycares, large and small Permitted: Multiple- family dwellings that do not comply with the design standards dwellings that comply with the design t standards are permitted by right (no UP/SDP) Allowed: : Family daycares, large and small Allowed: Small emergency shelters Permitted: Large emergency shelters Permitted: Multiple- family dwellings that do not comply with the design standards Permitted: Large emergency shelters Permitted:Single- family dwelling (i.e., single-family home, manufactured/modul ar home, transitional housing, and supportive housing). Manufactured/modul ar home shall comply with the additional development standards Permitted: Multiple- family dwellings that do not comply with the design standards Permitted: Mobile home parks. Permitted: Large emergency shelters Permitted:SFD (i.e., single-family home, manufactured/modul ar home, transitional housing, and supportive housing). Manufactured/modul ar home shall comply with the additional development standards Parking No change for SFD. Duplex is reduced to 1.5/unit SFD no change (2/unit). Reducing duplex & multifamily parking: Duplex- 1.5/unit; multifamily- 1/unit SFD no change (2/unit). Reducing duplex & multifamily parking: Duplex- 1.5/unit; multifamily- 1/unit No change for commercial. Adds residential parking: SFD- 2/unit; Duplex- 1.5/unit; No change to commercial (?) Adds residential parking: SFD-2/unit; Duplex-1.5/unit; Multiple-Family- 1/unit . No change to commercial? Adds residential parking: Multiple-Family Dwelling: 1/unit Page 111 of 800 4 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah Multiple- Family-1 space/unit . Removes ADU parking requirement of 1 space Removes ADU parking requirement of 1 space Other Adds standards for manufactured homes Adds standards for manufactured homes. Adds standards for manufactured homes. Lot coverage increases from 40% to 60%. Adds standards for manufactured homes. Removes landscape plan requirements and relies on design standards (see my comment in R3) Clarifies language for ensuring privacy. Adds standards for manufactured homes. Clarifies language for ensuring privacy. Adds standards for manufactured homes. Page 112 of 800 1 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah FIGURE 1 CITY OF UKIAH LIMITS Page 113 of 800 1 Housing Related Zoning Code Updates Draft Initial Study and Negative Declaration City of Ukiah FIGURE 2. ZONING MAP Page 114 of 800 2 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Draft Initial Study and Mitigated Negative Declaration City of Ukiah III. ENVIRONMENTAL FACTORS POTENTIALLY AFFECTED Purpose of the Initial Environmental Study: This Initial Study has been prepared consistent with CEQA Guidelines Section 15063, to determine if the Project, as proposed, would have a significant impact upon the environment. The environmental factors checked below would be potentially affected by this Project, involving at least one impact that is a "Potentially Significant Impact" as indicated by the checklist on the following pages. Aesthetics Agriculture & Forestry Air Quality Biological Resources Cultural Resources Energy Geology / Soils Greenhouse Gas Emissions Hazards & Hazardous Materials Hydrology/Water Quality Land Use / Planning Mineral Resources Noise Population / Housing Public Services Recreation Transportation Tribal Cultural Resources Utilities/Service Systems Wildfire Mandatory Findings of Significance Summary of Findings: Section 15378 of the California Environmental Quality Act (CEQA) defines a “Project” as an activity that (1) is a discretionary action by a governmental agency; and (2) will either have a direct or reasonably foreseeable indirect impact on the environment. (Pub. Res. Code, § 21065). “Project” means the whole of an action, which has a potential for resulting in either a direct physical change in the environment, or a reasonably foreseeable indirect physical change in the environment, and that is any of the following: An activity directly undertaken by any public agency including but not limited to public works construction and related activities, clearing or grading of land, improvements to existing public structures, enactment and amendment of zoning ordinances, and the adoption and amendment of local General Plans or elements thereof pursuant to Government Code Sections 65100–65700. The Proposed Project includes Housing-related Zoning Code amendments to the City of Ukiah’s Municipal Code in order to enacting both the City of Ukiah’s 2019-2027 Housing Element Implementing Programs, and updates required for compliance with new State laws. The amendments are designed to aid in meeting the City’s Regional Housing Needs Allocation (RHNA) by facilitating the development of housing with streamlined review and are intended to facilitate housing development within residential and commercial zoning districts through reduced development standards (increasing maximum height, decreasing or eliminating required minimum site area, and decreasing setbacks, parking and other development standards, in addition to developing objective design and development standards for new residential development ). Page 115 of 800 3 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah While the Proposed Project is intended to facilitate housing development within the City of Ukiah, it does not include specific development designs or proposals, nor does it grant any entitlements for development. Development could also result in impacts to the physical environment depending on location, intensity, and other siting factors. However, the location, intensity, siting, and timing of such development is unknown. All future development associated with the proposed Zoning Code amendments would be in residential or commercial zoning districts where housing development is already generally allowed by right, or with an approved use permit and site development permit. Development could also result in impacts to the physical environment depending on location, intensity, and other siting factors. However, the exact intensity, location, size and timing of future development is unknown. There are many possible scenarios and outcomes of the proposed Zoning Code amendments. Therefore, a general analysis of impacts is provided in this Initial Study. All future development would be analyzed on a project level basis for consistency with land use policies and development standards, and would be subject to Building Permits for consistency with building and safety codes. In addition, depending on the type of development, location, and zoning district, future development could also require discretionary and environmental review of their individual and cumulative environmental impacts, as applicable. Based upon the analysis contained within this Initial Study/Negative Declaration, all potential impacts resulting from the Proposed Project would be less than significant or would have no impact. IV. DETERMINATION On the basis of the initial evaluation that follows: Page 116 of 800 4 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah __X_ I find that the proposed Project COULD NOT have a significant effect on the environment, and a NEGATIVE DECLARATION will be prepared. ____ I find that although the proposed Project could have a significant effect on the environment, there will not be a significant effect in this case because mitigation measures and project revisions have been identified that would reduce all impacts to a less than significant level. A MITIGATED NEGATIVE DECLARATION will be prepared. _____ I find that the proposed Project MAY have a significant effect on the environment. An ENVIRONMENTAL IMPACT REPORT is required. _____ I find that the proposed Project MAY have a “potentially significant impact” or “potentially significant unless mitigated” impact on the environment, but at least one effect 1) has been adequately analyzed in an earlier document pursuant to applicable legal standards, and 2) has been addressed by mitigation measures based on the earlier analysis as described on attached sheets. An ENVIRONMENTAL IMPACT REPORT is required, but it must analyze only the effects that remain to be addressed. _____ I find that although the proposed Project could have a significant effect on the environment, because all potentially significant effects (a) have been analyzed adequately in an earlier EIR or NEGATIVE DECLARATION pursuant to applicable standards, and (b) have been avoided or mitigated pursuant to that earlier EIR or NEGATIVE DECLARATION, including revisions or mitigation measures that are imposed upon the proposed Project, nothing further is required. Signature Date Mireya G. Turner, Planning Manager Planning & Community Development Department City of Ukiah mturner@cityofukiah.com Page 117 of 800 5 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah V. EVALUATION OF ENVIRONMENTAL IMPACTS The purpose of this Initial Study/Negative Declaration (IS/ND) is to provide an analysis of the potential environmental consequences as a result of the proposed Project. The environmental evaluation relied on the following categories of impacts, noted as column headings in the IS checklist, in accordance with CEQA Guidelines Appendix G. “Potentially Significant Impact” is appropriate if there is substantial evidence that an effect may be significant. If there are one or more “Potentially Significant Impact” entries when the determination is made, an EIR is required. Less Than Significant With Mitigation Incorporated” applies where the incorporation of mitigation measures has reduced an effect from “Potentially Significant Impact” to a “Less Than Significant Impact.” “Less Than Significant Impact” applies where the Project would not result in a significant effect (i.e., the Project impact would be less than significant without the need to incorporate mitigation). “No Impact” applies where the Project would not result in any impact in the category or the category does not apply. This may be because the impact category does not apply to the proposed Project (for instance, the Project Site is not within a surface fault rupture hazard zone), or because of other project-specific factors. 1. Aesthetics AESTHETICS. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Have a substantial adverse effect on a scenic vista? b) Substantially damage scenic resources, including, but not limited to, trees, rock outcroppings, and historic buildings within a state scenic highway? c) In nonurbanized areas, substantially degrade the existing visual character or quality of public views of the site and its surroundings? (Public views are those that are experienced from publicly accessible vantage point). If the project is in an urbanized area, would the project conflict with applicable zoning and other regulations governing scenic quality? d) Create a new source of substantial light or glare which would adversely affect day or nighttime views in the area? Significance Criteria: Aesthetic impacts would be significant if the Project resulted in the obstruction of any scenic vista open to the public, damage to significant scenic resources within a designated State scenic highway, substantial degradation to the existing visual character or Page 118 of 800 6 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah quality of the site and its surroundings from public views, or generate new sources of light or glare that would adversely affect day or nighttime views in the area, including that which would directly illuminate or reflect upon adjacent property or could be directly seen by motorists or persons residing, working or otherwise situated within sight of the Project. Environmental Setting: The City of Ukiah is located within the Ukiah Valley, and scenic resources include not only the natural environment, but the built environment as well. One of the most notable scenic resources in the City limits is the Western Hills. Views of expansive hillsides to the north, east and south, mostly within the County’s jurisdiction, also surround the City. Some hillsides are densely forested with evergreen trees, while others are relatively open in comparison, dominated by mature oak trees set amid scrub and grasslands. Views on the Valley floor within the City of Ukiah include those typical of existing residential and commercial development and the majority of the land within the City limits is previously developed. In addition, some views of agricultural land uses within the City limits, or immediately outside of City limits, are available. Discussion: (a & c) Less than significant impact. Proposed Zoning Code amendments including increasing allowable density per acre (in Medium Density Residential (R2) and Community Neighborhood Commercial (CN) zoning districts), increasing maximum height, decreasing or eliminating required minimum site area, and decreasing setbacks, parking and other development standards, are intended to facilitate housing development within residential and commercial zoning districts. Future development facilitated by the proposed amendments have the potential to impact views of scenic resources, degrade the visual character, depending on location, height, siting, design, proximity to public viewpoints and scenic resources, etc. However, future housing development may require discretionary and environmental review (as applicable) and impacts to aesthetics associated with those projects will be considered at that time. All development will be subject to applicable zoning, subdivision and related ordinances, regulating height, setbacks, and density, as well other development standards, established to preserve the visual character within the City. While multifamily residential projects may be allowed by right under the proposed amendments in all residential and commercial zoning districts, they are required to be in compliance with the proposed Objective Design and Development Standards for New Residential Construction (referred to as “Objective Standards” and included in Attachment B); the Objective Standards include provisions to ensure aesthetic compatibility including but not limited to: using specific color pallets, landscaping requirements, lighting, screening of ancillary equipment and parking areas, etc. If the multifamily development does not meet the Objective Standards, then the project requires discretionary review and review by the Design Review Board to ensure aesthetic compatibility. With adherence to development standards within the Zoning Code, the Objective Standards for new multifamily residential development, and the discretionary and environmental review process (as applicable), it can be assumed that all new development would generally be consistent with the visual character of existing development within the City, and would not impact scenic vistas. As previously stated, the Western Hills contain the most notable scenic resources within the City. The portion of the lands within the City’s jurisdiction in the Western Hills are zoned R1 with a Hillside Combining District (-H). The intent of the –H District is to preserve outstanding natural visual and physical features, such as the highest crest of a hill, natural rock outcroppings, major tree belts, etc. The –H District contains strict development standard, including requiring discretionary review of all residential development to ensure visual and natural resources are Page 119 of 800 7 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah protected. The R1-H zoning district is not included proposed amendments. Therefore, scenic resources within the Western Hills will not be impacted by the Proposed Project. For the aforementioned reasons, the Project would not result in a significant impact to scenic vistas, nor the visual character of the site or area. Impacts would be less than significant. (b) No impact. According to the California Department of Transportation’s (Caltrans) State Scenic Highway System Map, there are no designated state scenic highways within, or visible from the City of Ukiah. In addition, there are no highways identified as eligible for state designation. Therefore, the Project would not substantially damage scenic resources, including, but not limited to, trees, rock outcroppings, and historic buildings within a state scenic highway. Lastly, the City’s General Plan does not designate any local scenic roads in the Project area; no impact to scenic resources within a designated scenic corridor would occur. (d) Less than significant impact. New sources of light and glare associated with future residential development could include building-mounted outdoor lighting, indoor residential lighting, and new sources of glare from windows and cars. However, all lighting would be required to be downshielded and comply with the Dark Skies Ordinance to protect nighttime views. In addition, the Design Standards contain regulations for lighting to ensure multifamily development does not create a significant source of lighting or glare. Sources of light and glare associated with future residential development would be typical of those associated with typical residential development in the City and would not be considered “substantial”. Therefore, impacts would be less than significant. Page 120 of 800 8 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 2. Agriculture and Forestry Resources AGRICULTURE AND FORESTRY RESOURCES. In determining whether impacts to agricultural resources are significant environmental effects, lead agencies may refer to the California Agricultural Land Evaluation and Site Assessment Model (1997) prepared by the California Dept. of Conservation as an optional model to use in assessing impacts on agriculture and farmland. In determining whether impacts to forest resources, including timberland, are significant environmental effects, lead agencies may refer to information compiled by the California Department of Forestry and Fire Protection regarding the state’s inventory of forest land, including the Forest and Range Assessment Project and the Forest Legacy Assessment project; and forest carbon measurement methodology provided in Forest Protocols adopted by the California Air Resources Board. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Convert Prime Farmland, Unique Farmland, or Farmland of Statewide Importance (Farmland), as shown on the maps prepared pursuant to the Farmland Mapping and Monitoring Program of the California Resources Agency, to non- agricultural use? b) Conflict with existing zoning for agricultural use, or a Williamson Act contract? c) Conflict with existing zoning for, or cause rezoning of, forest land (as defined in Public Resources Code section 12220(g)), timberland (as defined by Public Resources Code section 4526), or timberland zoned Timberland Production (as defined by Government Code section 51104(g))? d) Result in the loss of forest land or conversion of forest land to non-forest use? e) Involve other changes in the existing environment which, due to their location or nature, could result in conversion of Farmland, to non-agricultural use or conversion of forest land to non-forest use? Significance Criteria: The Proposed Project would have a potentially significant impact on agricultural resources if it would convert prime farmland to a non-agricultural use, conflict with a Williamson Act contract, or disrupt a viable and locally important agricultural use. The Project would have a potentially significant impact on forestry resources if it would result in the loss, rezoning or conversion of forestland to a non-forest use. Environmental Setting: According to the Ukiah Valley Area Plan (UVAP; 2011), early agricultural efforts in the Ukiah Valley included the raising of livestock, and the growing of various grains, hay, alfalfa, and hops. When the Northwestern Pacific Railroad was completed in 1889; prunes, potatoes, pears, and hops could be grown and sent to San Francisco and other regional markets. Wine grapes were planted, and irrigation was practiced on a small scale. Through the 1950’s, hops, pears, prunes and grapes were the most widely planted crops in the Ukiah Valley. After the railroad was completed, lumber mills sprang up in the Ukiah Valley and became the major industry in Mendocino County as trains took redwood logs and processed boards south to the San Francisco region. Today, much of the active agricultural land in the UVAP planning area is located on the valley floor and lower elevations along the Russian River system. There are no zoning districts within the City limits for Agriculture or Timber Preserve. While there is an overlay for agriculture in the Zoning Ordinance, it is not applied over any parcel within the Page 121 of 800 9 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah City limits. There are a small number of City parcels which have current agricultural use, such as existing vineyards. However, they are ongoing non-conforming uses within non-agricultural zoning districts. According to the California Department of Conservation Farmland Mapping & Monitoring Program, California Important Farmland Finder, the majority of lands within the City of Ukiah are identified as “Urban Built-Up Land”, with the exception of some areas within the Western Hills and the Airport Industrial Business Park, which are identified as “Grazing Land”. There are two parcels within the City limits that are identified as “Prime Farmland”: APNs 00102063 and 18012004. APN 00102063 is located at 940 Low Gap Road and is part of the Russian River Cemetery that is partially developed with agricultural uses, as well as a roadway and parking area. APN 18012004 is a vacant parcel with some agricultural uses, located adjacent to 1825 Airport Road within the Airport Industrial Business Park Master Plan Area. Discussion: (a-e) Less than significant. Lands affected by the proposed zoning amendments (commercial and residential zoned properties) are located within the “Urban Built-Up Land” designation that is not identified as having agricultural value or uses. The parcels identified as “Prime Farmland” and “Grazing Land” are either located within the Public Facilities zoning district, the Hillside Overlay District, or within the Airport Industrial Business Park Master Plan area that will not be included, nor impacted by the proposed zoning amendments. The “Prime Farmland” designation is a combination of the active use, soils analysis and animal carrying capacity. While there are parcels identified as ‘Prime Farmland’, there are no lands within the City of Ukiah under Williamson Act Contracts. As such, the Project would not convert Farmland, conflict with existing zoning for agriculture or forest land, and would not involve changes to the environment that would result in the conversion of agricultural resources to non-agriculture uses. Therefore, impacts to agricultural resources would be less than significant. 3. Air Quality AIR QUALITY. Where available, the significance criteria established by the applicable air quality management district or air pollution control district may be relied upon to make the following determinations. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Conflict with or obstruct implementation of the applicable air quality plan? b) Result in a cumulatively considerable net increase of any criteria pollutant for which the project region is non-attainment under an applicable federal or state ambient air quality standard? c) Expose sensitive receptors to substantial pollutant concentrations? d) Result in other emissions (such as those leading to odors) adversely affecting a substantial number of people? Significance Criteria: The Proposed Project would have a significant impact to air quality if it would conflict with an air quality plan, result in a cumulatively considerable net increase of criteria pollutant which the Mendocino County Air Quality Management District (MCAQMD) has Page 122 of 800 10 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah designated as non-attainment, expose sensitive receptors to substantial concentrations of air pollutants, or result in emissions that create objectionable odors or otherwise adversely affect a substantial number of people. Environmental Setting: The Project is located within the North Coast Air Basin (NCAB), which includes Del Norte, Humboldt, Trinity, Mendocino, and northern Sonoma Counties, and is under the jurisdiction of the Mendocino County Air Quality Management District (MCAQMD). The area’s climate is considered Mediterranean, with warm, dry summers and cooler, wet winters. Summer high temperatures average in the 90’s with high temperatures on very warm days exceeding 105 degrees. Summer low temperatures range between 50-60 degrees. Winter high temperatures generally range in the 50’s and 60’s. The average annual temperature is 58 degrees. Winter cold- air inversions are common in the valley from November to February. Prevailing winds are generally from the north. Prevailing strong summer winds come from the northwest; however, winds can come from the south and east under certain short-lived conditions. In early autumn, strong, dry offshore winds may occur for several days in a row, which may cause air pollution created in the Sacramento Valley, Santa Rosa Plain, or even San Francisco Bay Area to move into the Ukiah Valley. The MCAQMD, which includes the City of Ukiah and surrounding areas, is designated as non- attainment for the State Standard for airborne particulate matter less than 10 microns in size (PM10). Particulate matter (PM) has significant documented health effects. The California Clean Air Act requires that any district that does not meet the PM10 standard make continuing progress to attain the standard at the earliest practicable date. The primary sources of PM10 are wood combustion emissions, fugitive dust from construction projects, automobile emissions and industry. Non-attainment of PM10 is most likely to occur during inversions in the winter. Regulation 1 of the MCAQMD contains three rules related to the control of fugitive dust: • Rule 1-400(a) prohibits activities that "cause injury, detriment, nuisance or annoyance to a considerable number of persons...or which endanger the...health or safety of...the public…" • Rule 1-430(a) prohibits activities which "...may allow unnecessary amounts of particulate matter to become airborne..." • Rule 1-430(b) requires that "...reasonable precautions shall be taken to prevent particulate matter from becoming airborne…" The MCAQMD provides the following significance thresholds for construction emissions: 1. 54 pounds per day of ROG 
(reactive organic gas) 2. 54 pounds per day of NOx 
(oxides of nitrogen as nitrogen dioxide) 3. 82 pounds per day of PM10 (particulate matter less than 10 microns in size) 4. 54 pounds per day of PM2.5
(airborne particulate matter with a diameter of 2.5 microns or less) 5. Best Management Practices for Fugitive Dust – PM10 and PM2.5 Discussion: (a-d) Less than significant impact. The Proposed Project includes amendments to the Zoning Code that are designed to facilitate the development of housing to meet the current and future housing needs. Future construction of additional housing within the City may result in Page 123 of 800 11 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah short-term air quality impacts (associated with the use of construction equipment, vegetation removal, grading, etc.) and additional long-term pollutants (typically associated with vehicle trips, wood burning stoves, landscape and maintenance activities, etc.). However, each project that involves the construction of housing will be subject to Building Permits to ensure consistency with existing building codes requiring energy efficient and low emitting equipment and features for new residential development. At such time, project-level analyses will be made to determine whether that project will result in potentially significant impacts to air quality. MCAQMD has established attainment criteria for pollutants and any increase in criteria emissions must address this issue. Future development must remain in attainment for criteria pollutants. Residential construction requires obtaining permits from the MCAQMD for grading and other activities. In addition, MCAQMD has a set of standard Best Management Practices (BMPs) for construction projects that are intended to reduce air quality impacts and ensure that projects remain in attainment with air quality thresholds. The MCAQMD has not established separate significance thresholds for cumulative operational emissions. The nature of air emissions is largely a cumulative impact. As a result, no single project is sufficient in size to, by itself, result in nonattainment of ambient air quality standards. Instead, a project’s individual emissions contribute to existing cumulatively significant adverse air quality impacts. The MCAQMD developed the operational thresholds of significance based on the level above which a project’s individual emissions would result in a cumulatively considerable contribution to the North Coast Air Basin’s existing air quality conditions. Therefore, a project that exceeds the MCAQMD operational thresholds would also be a cumulatively considerable contribution to a significant cumulative impact. Because each individual construction project is required to be in attainment with the established MCAQMD thresholds, it is not likely that cumulative impacts would be significant. With adherence to the aforementioned regulations, and others intended to reduce emissions and impacts to air quality, impacts associated with the Proposed Project would be less than significant. 4. Biological Resources BIOLOGICAL RESOURCES. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Have a substantial adverse effect, either directly or through habitat modifications, on any species identified as a candidate, sensitive, or special status species in local or regional plans, policies, or regulations, or by the California Department of Fish and Wildlife or U.S. Fish and Wildlife Service? b) Have a substantial adverse effect on any riparian habitat or other sensitive natural community identified in local or regional plans, policies, regulations or by the California Department of Fish and Wildlife or U.S. Fish and Wildlife Service? c) Have a substantial adverse effect on state or federally protected wetlands (including, but not limited to, marsh, vernal pool, coastal, etc.) through direct removal, filling, hydrological interruption, or other means? Page 124 of 800 12 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah BIOLOGICAL RESOURCES. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact d) Interfere substantially with the movement of any native resident or migratory fish or wildlife species or with established native resident or migratory wildlife corridors, or impede the use of native wildlife nursery sites? e) Conflict with any local policies or ordinances protecting biological resources, such as a tree preservation policy or ordinance? f) Conflict with the provisions of an adopted Habitat Conservation Plan, Natural Community Conservation Plan, or other approved local, regional, or state habitat conservation plan? Significance Criteria: Project impacts upon biological resources would be significant if any of the following resulted: substantial direct or indirect effect on any species identified as a candidate, sensitive, or special status species in local/regional plans, policies, or regulations, or by the California Department of Fish and Wildlife (CDFW) or U.S. Fish and Wildlife Service (USFWS) or any species protected under provisions of the Migratory Bird treaty Act (e.g. burrowing owls); substantial effect upon riparian habitat or other sensitive natural communities identified in local/regional plans, policies, or regulations or by the agencies listed above; substantial effect (e.g., fill, removal, hydrologic interruption) upon state or federally protected wetlands; substantially interfere with movement of native resident or migratory wildlife species or with established native resident or migratory wildlife corridors; conflict with any local policies/ordinances that protect biological resources or conflict with a habitat conservation plan. Environmental Setting: Parcels within the City limits typically contain small developed parcels. While there are some small, vacant parcels, they are surrounded by urban development that offer little wildlife habitat value. Larger parcels, contiguous parcels, and parcels located in the Western Hills or adjacent to City creeks and Russian River tributaries do provide habitat for flora and fauna species. There are three main creeks, Orrs, Gibson and Doolin, that run through the City of Ukiah. According to the National Wetlands Inventory, these creeks contain riparian habitat and possible wetland areas. The creeks and bordering riparian areas, as well as the largely undeveloped western hillside region of the City have the potential to support nesting birds, Steelhead trout (Oncorhynchus mykiss), Foothill yellow-legged frog (Rana boylii), Red-bellied newt (Taricha rivularis) and Western pond turtle (Emys marmorata). In addition, Chinook salmon (Oncorhynchus tshawytscha), Russian River tule perch (Hysterocarpus traskii traskii), Pacific lamprey (Lampreta tridenta), and Western pearlshell mussel (Margaritifera falcate) potentially occur in the nearby Russian River. In addition, database queries of CDFW’s California Natural Diversity Database (CNDDB) and the California Native Plant Society’s (CNPS) Electronic Inventory of the City limits and its immediate surroundings identify the following seven special-status plant species: Baker’s meadowfoam (Limnanthes bakeri), Baker’s navarretia (Navarretia leucocephala bakeri), Burke’s goldfields (Lasthenia burkei), Mendocino bush-mallow (Malacothamnus mendocinensis), North Coast semaphore grass (Pleuropogon hooverianus), Raiche’s Manzanita (Arctostaphylos stanfordiana), and Toren’s grimmia (Grimmia torenii). Page 125 of 800 13 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Discussion: (a-d) Less than significant impact. Because most of the parcels within the City Limits that are residential and commercial zoned are currently developed, it is unlikely that biological resources would be impacted by future residential development. In addition, parcels within the Western Hills (and R1-H zoning district) are not included in the proposed Zoning Code updates. However, parcels along the Russian River and City creeks have a higher potential for containing resources and development on these parcels has the potential to reduce wildlife habitat and impact biological resources. However, at this time, location, intensity and timing of specific housing development is not known. If future development is proposed on vacant , undisturbed land, or within proximity to the aforementioned creeks, additional environmental review would likely be required and impacts to biological resources would be analyzed on a project level basis. As such, impacts to biological resources from the Project would be less than significant. (e-f) Less than significant impact. There are no adopted Habitat Conservation Plans for the City of Ukiah, nor the larger Ukiah Valley that apply to future development facilitated as a result of the Proposed Project. Impacts would be less than significant. 5. Cultural Resources CULTURAL RESOURCES. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Cause a substantial adverse change in the significance of a historical resource as defined in §15064.5? b) Cause a substantial adverse change in the significance of an archaeological resource pursuant to §15064.5? c) Disturb any human remains, including those interred outside of dedicated cemeteries? Significance Criteria: The proposed Project would significantly impact cultural resources if the significance of a historical or archaeological resource were substantially changed, or if human remains were disturbed. Under CEQA, cultural resources must be evaluated to determine their eligibility for listing in the California Register of Historic Resources (CRHR). If a cultural resource is determined ineligible for listing on the CRHR the resource is released from management responsibilities and a project can proceed without further cultural resource considerations. As set forth in Section 5024.1(c) of the Public Resources Code for a cultural resource to be deemed “important” under CEQA and thus eligible for listing on the California Register of Historic Resources (CRHR), it must meet at least one of the following criteria: Page 126 of 800 14 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 1) Is associated with events that have made a significant contribution to the broad patterns of California History and cultural heritage; or 2) Is associated with the lives of persons important to our past; or 3) Embodies the distinctive characteristics of a type, period, region, or method of construction, or represents the work of an important creative individual, or possess high artistic value; or 4) Has yielded or is likely to yield, information important to prehistory or history. Archaeological resources are commonly evaluated with regard to Criteria 4 (research potential). Historic-era structures older than 50 years are most commonly evaluated in reference to Criteria 1 (important events), Criteria 2 (important persons) or Criteria 3 (architectural value). To be considered eligible under these criteria the property must retain sufficient integrity to convey its important qualities. Integrity is judged in relation to seven aspects including: location, design, setting, materials, workmanship, feeling, and association. Guidelines for the implementation of CEQA define procedures, types of activities, persons, and public agencies required to comply with CEQA. Section 15064.5(b) prescribes that project effects that would “cause a substantial adverse change in the significance of an historical resource” are significant effects on the environment. Substantial adverse changes include both physical changes to the historical resource, or to its immediate surroundings. Public Resources Code Section 21083.2 also defines “unique archaeological resources” as “any archaeological artifact, object, or site about which it can be clearly demonstrated that, without merely adding to the current body of knowledge, there is a high probability that it meets any of the following criteria: • Contains information needed to answer important scientific research questions and show that there is a demonstrable public interest in that information. • Has a special and particular quality, such as being the oldest of its type or the best available example of its type. • Is directly associated with a scientifically recognized important prehistoric or historic event or person." This definition is equally applicable to recognizing “a unique paleontological resource or site.” CEQA Section 15064.5 (a)(3)(D), which indicates “generally, a resource shall be considered historically significant if it has yielded, or may be likely to yield, information important in prehistory or history,” provides additional guidance. Senate Bill 18 (SB 18) and Government Code 65352.3(a)(1) state that prior to the adoption or any amendment of a city or county’s general plan, the city or county shall notify California Native American tribes that are on the contact list maintained by the Native American Heritage Commission to provide an opportunity for formal consultation for the purpose of preserving or mitigating impacts to places, features, and objects described in Sections 5097.9 and 5097.995 of the Public Resources Code that are located within the city or county’s jurisdiction. Environmental Setting: The Ukiah Township lies in a valley of the Russian River, bounded on the north by Calpella Township, on the east by Lake County, on the south by Sanel Township, and on the west by Anderson Township. The City of Ukiah was first settled in 1856 by Samuel Lowry. Initially incorporated into Sonoma County, an independent Mendocino County government was established in 1859 with Ukiah as the chosen county seat. Logging, cattle, and agricultural ventures contributed to the early settlement and growth of Ukiah throughout the remainder of the 19th century and early 20th century. 1889 is the date recorded for the first arrival of the train to Page 127 of 800 15 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Ukiah, quickly resulting in increased settlement of the City and its environs. The City of Ukiah is within the territory of the Northern Pomo. Permanent villages were often established in areas with access to staple foods, often times along eco-tones (transitions between varying environments), with access to good water, and generally flat land (Environmental Science Associates, 2013). Areas that are most typically culturally sensitive include those adjacent to streams, springs, and mid-slope benches above watercourses because Native Americans and settlers favored easy access to potable water. The late 19th century saw slow growth in the community, with a slight decline after the turn of the century. The 1906 earthquake damaged a number of Ukiah buildings, particularly in the commercial core, and considerable re-building and remodeling activity occurred after that time. The City appears to have prospered in the following years, through the early 1920’s. The City contains a number of Colonial Revival and Craftsman style derivations, popular during this era, that reflect the community’s prosperity. An Historical and Architectural Survey Update was last prepared for the City by P.S. Preservation Services in 1999. The survey identified 23 properties with historic importance within the City limits. City Ordinance No. 838 was passed by the City in 1983, requiring that prior to the demolition of any building over 50 years old, the approval of the City Council must be obtained. The ordinance is a positive preservation tool, allowing some review and public input opportunity regarding the potential loss of historically significant buildings. Discussion: (a-c) Less than significant impact. Because most of the parcels within the City Limits that are residential and commercial zoned are currently developed, it is unlikely that cultural resources would be impacted by future residential development. Parcels along City creeks have a higher potential for containing cultural resources and may be impacted by future development facilitated through the Zoning Code amendments in residential and commercial zoning districts. However, there are many possible scenarios and outcomes of the proposed Zoning Code amendments and the intensity, location, size and timing of future development is unknown. All future development is subject to CEQA Guidelines Section 15064.5 (e-f) which specifically addresses what to do in the event that human remains or archeological resources are accidentally discovered, and City Ordinance No. 838, protecting historic buildings; future development would be analyzed on a project level basis and subject to environmental review of their individual impacts, as applicable. The proposed Zoning Code amendments also require amendment to the City of Ukiah’s General Plan to increase allowable building density. While the proposed changes include policy changes to facilitate housing development, no development or physical changes to the environment are proposed. However, in accordance with SB 18, tribal notifications offering the opportunity to request formal consultation and an opportunity to review the proposed Zoning Code amendments were sent to California Native American Tribes identified on the list maintained by the Native Heritage Commission (NAHC) on April 22, 2021. The tribes have 90 days to request consultation; no requests for consultation have been received to date. The list of tribes contacted are included in Attachment 4. For the reasons discussed above, impacts to Cultural Resources from the Proposed Project would be less than significant. Page 128 of 800 16 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 6. Energy ENERGY. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Result in potentially significant environmental impact due to wasteful, inefficient, or unnecessary consumption of energy resources, during project construction or operation? b) Conflict with or obstruct a state or local plan for renewable energy or energy efficiency? Significance Criteria: The Proposed Project would significantly impact energy if construction or operation of the Project would result in wasteful, inefficient or unnecessary consumption of energy resources or if the Project would conflict with a state or local plan for renewable energy or energy efficiency. Environmental Setting: Current building codes require energy efficiency systems to be included in their plans for permit review. These building codes are regularly updated, statewide through California Building Energy Efficiency Standards for Residential and Nonresidential Buildings (California Code of Regulations, Title 24, Part 6), commonly referred to as “Title 24”. In general, Title 24 requires the design of building shells and building components to conserve energy, with standards to promote better windows, insulation, lighting, ventilation systems, and other features that reduce energy consumption in homes and businesses. The standards are updated periodically to allow consideration and possible incorporation of new energy efficiency technologies and methods. The current Title 24 regulations and Building Energy Efficiency Standards promote photovoltaic systems in newly constructed residential buildings. The City’s Electric Utility Department has a solar rebate program for residents and business owners to encouraged local consumers to increasingly rely on renewable resources for their direct power needs. Discussion: (a-b) Less than significant impact. The Proposed Project, including the Development Agreement, does not include specific development designs or proposals, nor does it grant any entitlements for development. Generally speaking, future residential construction would consume energy in two general forms: (1) the fuel energy consumed by construction vehicles and equipment; and (2) once constructed, future residential uses would consume energy for interior and exterior lighting, HVAC systems, refrigeration, electronics systems, appliances, and security systems, among other common household features. However, future housing projects will be analyzed on a project level basis subject to the City’s building and safety codes, as well as the California Air Resources Board (CARB) and Environmental Protection Agency (EPA) emissions standards. Additionally, new residential development must comply with Title 24 Building Energy Efficiency Standards, which provide minimum efficiency standards related to various building features, including appliances, water and space heating and cooling equipment, building insulation and roofing, and lighting. Implementation of these regulations significantly reduces energy usage. In addition, residents would have access to the City’s solar rebate program to incentivize the use of renewal energy. With adherence to the aforementioned regulations, and others intended to reduce energy consumption, impacts from the Proposed Project related to energy consumption would be less than significant. Page 129 of 800 17 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 7. Geology and Soils GEOLOGY AND SOILS. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Directly or indirectly cause potential substantial adverse effects, including the risk of loss, injury, or death involving: i) Rupture of a known earthquake fault, as delineated on the most recent Alquist-Priolo Earthquake Fault Zoning Map issued by the State Geologist for the area or based on other substantial evidence of a known fault? Refer to Division of Mines and Geology Special Publication 42? ii) Strong seismic ground shaking? iii) Seismic-related ground failure, including liquefaction? iv) Landslides? b) Result in substantial soil erosion or the loss of topsoil? c) Be located on a geologic unit or soil that is unstable, or that would become unstable as a result of the project, and potentially result in on- or off-site landslide, lateral spreading, subsidence, liquefaction or collapse? d) Be located on expansive soil, as defined in Table 18-1-B of the Uniform Building Code (1994), creating substantial direct or indirect risks to life or property? e) Have soils incapable of adequately supporting the use of septic tanks or alternative waste water disposal systems where sewers are not available for the disposal of waste water? f) Directly or indirectly destroy a unique paleontological resource or site or unique geologic feature? Significance Criteria: The Proposed Project would result in a significant impact to geological or soil resources if it exposed people or structures to seismic risk; ruptured a known fault; produced strong seismic ground shaking, ground failure, liquefaction, landslides or substantial soil erosion; is located on expansive soil or unstable ground, or would create unstable ground; or destroyed a unique paleontological resource or geologic feature. Environmental Setting: The larger Ukiah Valley is part of an active seismic region that contains the Mayacama Fault, which traverses the valley in a generally northwest-southeast direction east of the Project area. Based on California Geological Survey maps and the Background Report for the County of Mendocino General Plan Update (prepared by P.M.C., 2003), the City of Ukiah is outside of known areas of historic faults, Holocene Fault, Late Quaternary Fault and the Alquist- Priolo Earthquake Fault Zone. It is also removed from the known areas of active and dormant Page 130 of 800 18 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah landslide reports. Slope instability hazards are not a concern, with the exception of the Hillside Overlay District within the Western Hills. Discussion: (a-f) Less than significant impact. Parcels within the Valley floor that are within residential and commercial zoning districts (and included in the proposed Zoning Code amendments) are not located in a California Earthquake Fault Zone and not susceptible to liquefaction or strong seismic ground shaking. Because most of the parcels within the City Limits that are residential and commercial zoned are currently developed, it is unlikely that unique paleontological resources would be impacted by future residential development. In addition, parcels within the Western Hills (and R1-H zoning district) containing more diverse geological features are not included in the proposed Zoning Code updates. Additionally, a Building Permit is required for new construction which will ensure all activities are in compliance with building and seismic safety codes. New development within the City will connect to the existing sewer and water systems. The Building Permit process (and discretionary review process, as applicable) will include review of site plans by internal and external departments and agencies to ensure compliance with all applicable local, state and federal safety standards. Additionally, future residential projects that may require vegetation removal and grading, or be adjacent to creeks will be required to adhere to Ukiah City Code, Division 9, Chapter 7, Erosion and Sediment Control, which requires submittal of sediment and erosion plans identifying Best Management Practices (BMPs) to reduce soil erosion and water runoff. For the above reasons, impacts to geology and soils would be less than significant. 8. Greenhouse Gas Emissions GREENHOUSE GAS EMISSIONS. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Generate greenhouse gas emissions, either directly or indirectly, that may have a significant impact on the environment? b) Conflict with an applicable plan, policy or regulation adopted for the purpose of reducing the emissions of greenhouse gases? Significance Criteria: The Project would have a significant effect on greenhouse gas emissions if it would generate greenhouse gas emissions (GHG), either directly or indirectly, that may have a significant impact on the environment; or conflict with an applicable plan, policy, or regulation adopted for the purpose of reducing the emissions of GHGs. Environmental Setting: Climate change is caused by greenhouse gases (GHGs) emitted into the atmosphere around the world from a variety of sources, including the combustion of fuel for energy and transportation, cement manufacturing, and refrigerant emissions. GHGs are those gases that have the ability to trap heat in the atmosphere, a process that is analogous to the way Page 131 of 800 19 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah a greenhouse traps heat. GHGs may be emitted a result of human activities, as well as through natural processes. Increasing GHG concentrations in the atmosphere are leading to global climate change. Carbon dioxide (CO2) is the most important anthropogenic GHG because it comprises the majority of total GHG emissions emitted per year and it is very long-lived in the atmosphere. Typically, when evaluating GHG emissions they are expressed as carbon dioxide equivalents, or CO2e, which is a means of weighting the global warming potential (GWP) of the different gases relative to the global warming effect of CO2, which has a GWP value of one. In the United States, CO2 emissions account for about 85 percent of the CO2e emissions, followed by methane at about eight percent, and nitrous oxide at about five percent. The state of California has adopted various administrative initiatives and legislation relating to climate change, much of which set aggressive goals for GHG emissions reductions statewide. Although lead agencies must evaluate climate change and GHG emissions of projects subject to CEQA, the CEQA Guidelines do not require or suggest specific methodologies for performing an assessment or specific thresholds of significance and do not specify GHG reduction mitigation measures. No state agency has developed binding regulations for analyzing GHG emissions, determining their significance, or mitigating significant effects in CEQA documents. Thus, lead agencies exercise their discretion in determining how to analyze GHGs. Because there are no adopted GHG thresholds applicable to the Project, and the proposed development is considered “small scale”, the below qualitative analysis is appropriate. Discussion: (a-b) Less than significant impact. Construction activities associated with future housing development could result in direct and indirect emissions of GHG emissions. Direct project-related GHG emissions generally include emissions from construction activities, area sources, and mobile sources, while indirect sources include emissions from electricity consumption, water demand, and solid waste generation. However, as discussed in Section 3, Air Quality, of this Initial Study, future residential construction would be subject to regulations of the Mendocino County Air Quality Management District (MCAQMD), which is responsible for enforcing the state and federal Clean Air Acts as well as local air quality protection regulations. Additionally, future residential uses would be required to adhere to all federal, state, and local requirements for energy efficiency, including the Title 24 Building Energy Efficiency Standards. Therefore, the Proposed Project, including potential future residential development facilitated through the Zoning Code amendments, would not result in a significant impact to GHG emissions. Impacts would be less than significant. 9. Hazards and Hazardous Materials HAZARDS AND HAZARDOUS MATERIALS. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Create a significant hazard to the public or the environment through the routine transport, use, or disposal of hazardous materials? b) Create a significant hazard to the public or the environment through reasonably foreseeable upset and accident conditions involving the release of hazardous materials into the environment? Page 132 of 800 20 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah HAZARDS AND HAZARDOUS MATERIALS. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact c) Emit hazardous emissions or handle hazardous or acutely hazardous materials, substances, or waste within one-quarter mile of an existing or proposed school? d) Be located on a site which is included on a list of hazardous materials sites compiled pursuant to Government Code Section 65962.5 and, as a result, would it create a significant hazard to the public or the environment? e) For a project located within an airport land use plan or, where such a plan has not been adopted, within two miles of a public airport or public use airport, would the project result in a safety hazard or excessive noise for people residing or working in the project area? f) Impair implementation of or physically interfere with an adopted emergency response plan or emergency evacuation plan? g) Expose people or structures, either directly or indirectly, to a significant risk of loss, injury or death involving wildland fires? Significance Criteria: The Project would result in significant hazards or hazardous materials impacts if it exposed people to hazardous materials or placed them into hazardous situations; if it released hazardous materials or emissions into the environment or within 0.25 miles of a school; if it is located on a listed hazardous materials site; if it would create a hazard due to its proximity to a public airport or private airstrip; if it would create excessive noise for people in the area; if it would interfere with an emergency response or evacuation plan; or if it would expose people or structures to significant risks due to wildland fire. Environmental Setting: Mendocino County has adopted numerous plans related to hazard management and mitigation including, but not limited to: Community Wildfire Protection Plan, Hazardous Waste Management Plan, Operational Area Emergency Plan, etc. The most recent plan, the Mendocino County Multi-Jurisdictional Hazard Mitigation Plan (MJHMP) was adopted by the County in December, 2020. The MJHMP provides an explanation of prevalent hazards within the County, identifies risks to vulnerable assets, both people and property, and provides a mitigation strategy to achieve the greatest risk reduction based upon available resources. The four cities within Mendocino County, including the City of Ukiah, participated in preparation of the MJHMP to individually assess hazards, explore hazard vulnerability, develop mitigation strategies, and create their own plan for each respective city (referred to as a “jurisdictional annex” to the MJHMP). The City of Ukiah adopted its jurisdictional annex chapter of the MJHMP on November 18, 2020. Hazards identified for the City if Ukiah include earthquakes, wildfire, dam failure, flood and pandemic. Table 1-13 of the City’s jurisdictional annex lists each hazard and mitigation action for City of Ukiah. The Ukiah Municipal Airport is located within the City of Ukiah jurisdictional limits. The Ukiah Municipal Airport Master Plan and the Ukiah Airport Land Use Compatibility Plan (ALUCP), identify areas with potential hazards, known as “Compatibility Zones” and impacts to persons using or working within the Airport Influence Area (AIA). Page 133 of 800 21 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Under Government Code Section 65962.5, both the State Water Resources Control Board and the California Department of Toxic Substances Control are required to maintain databases of sites known to have hazardous substances present in the environment. According to the State Water Resources Control Board (SWRCB) GeoTracker and the California Department of Toxic Substances Control (DTSC) EnviroStor databases, there are 21 listed hazardous sites within the City of Ukiah; these include gas stations, automobile dismantling and salvage yards, sites associated with the railroad, the waste disposal and transfer station, etc. All lands within the City of Ukiah are within the jurisdiction of the Ukiah Valley Fire Authority. None of the lands within the City of Ukiah are located within a California Department of Forestry (CalFire) State Responsibility Area (SRA). However, County lands immediately west of the City are located within the SRA and are classified as having a “Very High” fire hazard severity. Discussion: (a-b) Less than significant impact. Construction activities and future residential uses facilitated by the proposed Zoning Code amendments would require the routine transport, use, storage, and disposal of small quantities of hazardous materials common for equipment and property maintenance and operation, such as gasoline, diesel fuel, hydraulic fluids, oils, lubricants, cleaning solvents and supplies, pesticides, fertilizers, paint, etc. However, the types and quantities of materials to be used are not expected to pose a significant risk to the public and/or environment and would be managed in accordance with federal, state, and local regulations. Therefore, impacts would be less than significant. (c) Less than significant impact: As discussed in Section 15, Public Services, of this Initial Study, there are several schools within the City of Ukiah. Future residential construction could be located within 0.25-mil of an existing school. However, construction activities would be required to transport and use routine hazardous materials in accordance with all applicable regulations. Adherence to these regulations would ensure that impacts to schools regarding hazardous materials are less than significant. (d) Less than significant impact. As previously noted, there are 21 hazardous sites listed in the City of Ukiah including auto wrecking yards, gas stations, the refuse transfer station, sites associated with the railroad, etc. Because these sites are currently developed with industrial and commercial uses, it is not likely that they will be developed with residential land uses. Additionally, if a residential project were to be proposed at one of the listed sites, clean-up to remove the hazard would be required by the SWRCB and DTSC. Impacts would be less than significant. (e) Less than significant impact. The ALUCP identifies five Compatibility Zones with varying risks and development restrictions. Generally speaking, the Compatibility Zones encompass south Ukiah, including residential and commercial zoned properties subject to the proposed Zoning Code amendments. However, all development would be required to be compatible with the Ukiah Municipal Airport Master Plan and ALUCP. Impacts would be less than significant. (f) Less than significant impact. There are no components of the Project that would impair or interfere with emergency response or evacuation. Since the Project is limited to within the City limits, future residential development would be required to be designed in accordance with state and local standards, including safety and emergency access requirements, and are within existing service areas of emergency responders. There are no components of the Project that would impair implementation of, or physically interfere with, the adopted MJHMP or other emergency response plan or evacuation plan. Impacts would be less than significant. Page 134 of 800 22 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah (g) Less than significant impact with mitigation incorporated. The Project Area is entirely within the jurisdiction of the Ukiah Valley Fire District. Future residential development would be required to adhere to all fire safety standards. See Section 20, Wildfire, for more information. Impacts would be less than significant. 10. Hydrology and Water Quality HYDROLOGY AND WATER QUALITY: Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Violate any water quality standards or waste discharge requirements or otherwise substantially degrade surface or ground water quality? b) Substantially decrease groundwater supplies or interfere substantially with groundwater recharge such that the project may impede sustainable groundwater management of the basin? c) Substantially alter the existing drainage pattern of the site or area, including through the alteration of the course of a stream or river or through the addition of impervious surfaces, in a manner which would: i) result in a substantial erosion or siltation on- or off-site; ii) substantially increase the rate or amount of surface runoff in a manner which would result in flooding on- or offsite; iii) create or contribute runoff water which would exceed the capacity of existing or planned stormwater drainage systems or provide substantial additional sources of polluted runoff; or d) In flood hazard, tsunami, or seiche zones, risk release of pollutants due to project inundation? e) Conflict with or obstruct implementation of a water quality control plan or sustainable groundwater management plan? Significance Criteria: The Project would significantly impact hydrology and water quality if it violated water quality standards or waste discharge requirements or substantially degraded surface or groundwater quality; substantially decreased groundwater supplies or impeded sustainable groundwater management; altered drainage patterns in a manner that would cause substantial on- or off-site erosion, polluted runoff or excessive runoff that caused flooding; impeded or redirected flood flows; risked a release of pollutants due to inundation if in a flood hazard, tsunami or seiche zone; or conflicted with a water quality plan or sustainable groundwater management plan. Environmental Setting: Average rainfall in Ukiah is slightly less than 35 inches. Most of the precipitation falls during the winter. Rainfall is often from brief, intense storms, which move in from the northwest. Virtually no rainfall occurs during the summer months. Page 135 of 800 23 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah The Project area includes the Russian River Hydrologic Unit, Upper Russian River Hydrologic Area, Ukiah Hydrologic Subarea. The Russian River is on the State Water Resources Control Board’s (SWRCB) 303(d) list of impaired water bodies for water temperature and sedimentation/siltation. Sediment impairments in tributaries led to listing the entire Russian River Watershed for sediment. Surface water supplies for the Ukiah Valley include the Eel River, from which water is diverted into the Russian River watershed through the Potter Valley Project, Lake Mendocino, and the Russian River. Groundwater is drawn from the Ukiah Valley groundwater basin. The Ukiah Valley groundwater basin is the northernmost basin in the Russian River water system and underlies an area of approximately 60 square miles. Water enters the groundwater system via percolation of surface waters and through the soil. The creeks and streams in the Ukiah Valley provide drainage channels for groundwater recharge, as well as domestic and agricultural water supply. A groundwater Management Plan has not been prepared for the City, nor County of Mendocino, but according to the 2015 Urban Water Management Plan for the City, based on historical data and use, there is adequate groundwater to serve the City’s existing and future demand. Discussion: (a-c & e) Less than significant impact. The Project does not include specific development designs or proposals, nor does it grant any entitlements for development. Future housing projects will be subject to the City’s development standards and building and safety codes, including review of storm water management practices and waste discharge requirements, where applicable. Specifically, projects that include the addition of 10,000 sf of impermeable surfaces or more are subject to Low Impact Development standards to ensure stormwater runoff is adequately captured and filtered before entering the drainage system. Further, if a project proposes work within a drainage or waterway, the applicant will be required to obtain regulatory permits from the Water Resources Control Board, California Department of Fish and Wildlife and U.S. Army Corps of Engineers, as applicable. Therefore, impacts to water quality, groundwater and drainage would be less than significant. City water services exist to service all properties located within the City limits. As mentioned above, according to the 2015 Urban Water Management Plan for the City, there is adequate groundwater to serve the City’s existing and future demand. Therefore, the Project would not substantially deplete groundwater resources or conflict with the Urban Water Management Plan; impacts would be less than significant. (d) Less than significant impact. As described above, the Project is not located within a tsunami or seiche hazard zone, as identified by the Federal Emergency Management Agency. Some areas within City limits are within a FEMA flood zone. All development within a flood zone must adhere to all safety and building codes related to construction within a flood zone. Impacts would be less than significant. 11. Land Use and Planning LAND USE AND PLANNING. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Physically divide an established community? Page 136 of 800 24 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah b) Cause a significant environmental impact due to a conflict with any land use plan, policy, or regulation adopted for the purpose of avoiding or mitigating an environmental effect? Significance Criteria: The Project would significantly impact land use if it physically divided an established community or conflicted with a land use plan, policy or regulation intended to avoid or mitigate an environmental impact, such as the general plan or zoning code. Environmental Setting: The City of Ukiah includes approximately 4.72 square miles. It serves as the County Seat of Mendocino County, as well as the county’s commercial hub. Predominant land uses in the City include single family residential, multi-family residential, and commercial uses ranging from local commercial to service commercial, as well manufacturing, industrial and public facilities. The City’s first General Plan was originally adopted in 1974, updated in 1995, and was last amended in 2019, with adoption of the 2019-2027 Housing Element. The General Plan serves as a blueprint for future development and growth of the community. The City is currently in the process of completing a General Plan Update (the “2040 General Plan”) that will map out the vision for community development through 2040; until the new General Plan is adopted, the 1995 General Plan (as amended in 2019) is considered the applicable plan. Zoning and land use are governed by the City’s Zoning Ordinance, as outlined in Division 9, Chapter 2 of the Ukiah City Code. The purpose of the Ukiah Zoning Code is to promote the growth of the City in an orderly manner and to promote and protect the public health, safety, peace, comfort and general welfare. Housing development of varying intensity is allowed in all zoning districts of the Ukiah Zoning Code with the exception of the Manufacturing and Industrial Zoning Districts. Discussion: (a) Less than significant impact. Physical division of an existing community would typically be associated with construction of a new highway, railroad, park or other linear feature. The Project area is mostly developed with existing roads and parks. The Project does not propose new linear features that would result in the division of an established community. Impacts would be less than significant. (b) Less than significant. The Project includes amendments to the Zoning Code to encourage and support housing development, designed to ensure fulfillment of the City’s share of the Regional Housing Needs Allocation (RHNA). The Project includes multiple Implementation Tasks approved in the 2019-2027 General Plan Housing Element. Specifically, the Project proposes several zoning code updates including increasing maximum height, decreasing or eliminating required minimum site area, and decreasing setbacks, parking and other development standards, are intended to facilitate housing development within residential and commercial zoning districts. In addition to the Zoning Code updates, the Project includes a General Plan Amendment to increase housing density in the Medium Density Housing from 14 to 15 du/acre, in order to maintain synchronicity between the General Plan and Zoning Code, as well as comply with existing housing-related state laws Because the amendments are General Plan Housing Element Implementation Tasks, the Project would not conflict with a land use plan, policy or regulation intended to avoid or mitigate an environmental impact, such as the general plan or zoning code. Impacts would be less than significant. Page 137 of 800 25 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 12. Mineral Resources MINERAL RESOURCES. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Result in the loss of availability of a known mineral resource that would be of value to the region and the residents of the state? b) Result in the loss of availability of a locally important mineral resource recovery site delineated on a local general plan, specific plan or other land use plan? Significance Criteria: Impacts to mineral resources would be considered significant if the proposed Project were to result in the loss of a known mineral resource that has value to the region and state or is otherwise locally important as designated on a local land use plan. Environmental Setting: The most predominant of the minerals found in Mendocino County are aggregate resource minerals, primarily sand and gravel, found along many rivers and streams. The Ford Gravel Bars are located in Ukiah, along the Russian River. Discussion: (a-b) No impact. Future development associated with the zoning code amendments would be located within residential and commercial zoned areas, which do not contain mineral resources. No impact would occur. 13. Noise NOISE. Would the project result in: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Generation of a substantial temporary or permanent increase in ambient noise levels in the vicinity of the project in excess of standards established in the local general plan or noise ordinance, or applicable standards of other agencies? b) Generation of excessive ground borne vibration or ground borne noise levels? c) For a project located within the vicinity of a private airstrip or an airport land use plan or, where such a plan has not been adopted, within two miles of a public airport or public use airport, would the project expose people residing or working in the project area to excessive noise levels Significance Criteria: The Project would have a significant impact if it temporarily or permanently exceeded local noise standards in the vicinity of the Project, generated excessive ground borne noise or vibration; or would expose people residing or working in the area to excessive noise levels from public airports or private airstrips. Page 138 of 800 26 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Environmental Setting: The Ukiah City Code contains a Noise Ordinance (Division 7, Chapter 1, Article 6) that establishes ambient base noise level standards that apply to specific zoning districts within the City of Ukiah. “Ambient noise" is the all-encompassing noise associated with a given environment, being usually a composite of sounds from many sources near and far. For the purpose of the Noise Ordinance, ambient noise level is the level obtained when the noise level is averaged over a period of fifteen (15) minutes without inclusion of noise from isolated identifiable sources, at the location and time of day near that at which a comparison is to be made. Land uses exceeding these standards for long periods of time are considered to be significant. In addition, UCC §6054, Construction of Buildings and Projects, states that it shall be unlawful for any person within a residential zone, or within a radius of five hundred feet (500’) therefrom, to operate equipment or perform any outside construction or repair work on buildings, structures or projects or to operate any pile driver, power shovel, pneumatic hammer, derrick, power hoist or any other construction type device (between the hours of 7:00 p.m. of one day and 7:00 a.m. of the next day) in such a manner that a reasonable person of normal sensitiveness residing in the area is caused discomfort or annoyance unless beforehand a permit therefor has been duly obtained from the Director of Public works. Table 2. City of Ukiah Ambient Base Noise Levels Zoning Districts Time Period Noise Level Standards (dBA) R1 and R2 10:00 PM - 7:00 AM 7:00 PM - 10:00 PM 7:00 AM-7:00 PM 40 45 50 R3 10:00 PM - 7:00 AM 7:00 AM - 10:00 PM 45 50 Commercial 10:00 PM - 7:00 AM 7:00 AM - 10:00 PM 60 65 Industrial & Manufacturing Any time 70 Source: Ukiah City Code §6048 Discussion: (a) Less than significant impact. The Project does not propose residential construction; though it encourages and supports housing development. Construction activities are generally temporary, resulting in periodic increases in the ambient noise environment. Construction noise impacts generally occur when construction activities occur in areas immediately adjoining noise-sensitive land uses, during noise-sensitive times of the day, or when construction activity occurs at the same precise location over an extended period of time (e.g., pile driving in one location for 8-10 hours in a day, or over a duration of several successive days). Certain land uses, including schools, hospitals, rest homes, long-term medical and mental care facilities, and parks and recreation areas are particularly sensitive to noise. Residential areas are also considered noise sensitive, especially during the nighttime hours. However, all future construction would be considered temporary and required to adhere to noise regulations. Additionally, noise sources associated with typical residential land uses (e.g., mechanical equipment, dogs/pets, landscaping activities, cars parking, etc.) are typically intermittent and short in duration, and would be comparable to existing sources of noise experienced at surrounding commercial and residential uses. Therefore, noise impacts would be less than significant. Page 139 of 800 27 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah (b) Less than significant impact. Residential construction can generate varying degrees of ground borne vibration, depending on the construction procedure and the construction equipment used. Operation of construction equipment generates vibrations that spread through the ground and diminish in amplitude with distance from the source. The results from vibration can range from no perceptible effects at the lowest vibration levels, to low rumbling sounds and perceptible vibration at moderate levels, to slight damage at the highest levels. However, future residential construction is anticipated to use typical construction equipment for temporary periods of time that would not be considered excessive. Therefore, impacts would be less than significant. (c) Less than significant impact. Ukiah Municipal Airport is contained within the Project Area. All future development must be consistent with the 2020 Ukiah Municipal Airport Land Use Compatibility Plan (UKIALUCP), adopted by the Mendocino County Airport Land Use Commission on May 20, 2021. The UKIALUCP establishes criteria that reduce the potential exposure of people to excessive aircraft-related noise by limiting residential densities (dwelling units per acre), establishing interior noise level limits, and restricting other noise-sensitive land uses in locations exposed to noise levels in excess of 60 dB CNEL. Based on this information, the Project would not expose people residing or working in the Project area to excessive noise levels associated with aircraft. Impacts would be less than significant. 14. Population and Housing POPULATION AND HOUSING. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Induce substantial unplanned population growth in an area, either directly (for example, by proposing new homes and businesses) or indirectly (for example, through extension of roads or other infrastructure)? b) Displace substantial numbers of existing people or housing, necessitating the construction of replacement housing elsewhere? Significance Criteria: The proposed Project would result in significant impacts to the local population or housing stock if it directly or indirectly induced substantial unplanned population growth or displaced a substantial number of people or housing such that the construction of replacement housing would be required. Environmental Setting: The City of Ukiah comprises of approximately 4.72 square miles within Mendocino County. According to the California Department of Finance, the population in the County of Mendocino was 59,985 in 2018 and 16,226 in the City of Ukiah. The City’s annual growth rate between 1990 and 2018 averaged approximately 0.3%. Between 2000 and 2010, the City added 545 residents, or 3.7%, to its population. Overall, the City of Ukiah’s population has increased moderately over the past nearly 30 years, with a more accelerated increase in the last four years. Projections from the California State University Chico Center for Economic Development- Mendocino County Economic/Demographic Profile show this trend continuing. As described in the City’s 2019-2027 Housing Element (2019), under California law, every city and county has a legal obligation to respond to its fair share of the projected future housing needs Page 140 of 800 28 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah in the region in which it is located. For Ukiah and other Mendocino County jurisdictions, the regional housing need allocation (RHNA) is determined by the Mendocino Council of Governments (MCOG), based upon an overall regional need number established by the State. The fair share numbers establish goals to guide local planning and development decision making. MCOG identified the City’s RHNA as accommodating 239 additional units within the 2019-2027 Planning Cycle. Specifically, the City of Ukiah is responsible for identifying adequate sites, with appropriate zoning, to support 86 very low-income housing units and 72 low-income housing units, for a total of 158 lower income housing units, and 49 moderate-income and 32 above moderate-income housing units, for a total of 81 moderate and above moderate housing units. Discussion: (a & b) Less than significant impact. The proposed housing-related Zoning Code amendments are regulatory in nature, they do not propose any new development, construction, or physical change to the environment that would result in unplanned population growth. Although no development is proposed at this time, for this analysis it is assumed that future development would result in construction and development of residential uses throughout the Project Area. The Project will result in a Zoning Code that is consistent with the Ukiah General Plan Housing Element. Future housing development must comply with the Zoning Code, resulting in planned development, including accessing existing utility infrastructure. Extension of utilities would be limited to new connections to the existing infrastructure, and would not directly induce substantial unplanned development and population growth in the area. Increasing the density of Medium Density Residential areas could result in additional development; however, this development would be located within the City limits and would be serviced by existing infrastructure. The potential future development would enable the City to meet its RHNA requirements for the 2019- 2027 housing cycle. Displacement of existing people and/or housing is not part of the Project. For the aforementioned reasons, the Proposed Project would not induce substantial unplanned population growth in an area, either directly or indirectly. Impacts would be less than significant. 15. Public Services PUBLIC SERVICES. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Result in substantial adverse physical impacts associated with the provision of new or physically altered governmental facilities, need for new or physically altered governmental facilities, the construction of which could cause significant environmental impacts, in order to maintain acceptable service ratios, response times or other performance objectives for any of the public services: Fire protection? Police protection? Schools? Parks? Other public facilities? Page 141 of 800 29 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Significance Criteria: The Project would result in a significant impact to public services if it resulted in a requirement for increased or expanded public service facilities or staffing, including fire or police protection, schools and parks. Environmental Setting: Police protection services for the entire City limits is provided by the Ukiah Police Department, while the Mendocino County Sherriff’s Department provides police services for areas outside of the City limits. Fire protection services in the Ukiah Valley are provided by the Ukiah Valley Fire Authority and California Department of Forestry and Fire Protection (CalFire). Educational facilities in the Ukiah Valley area are provided by the Ukiah Unified School District (UUSD), County Office of Education, and the Mendocino-Lake Community College District. There are also several private and charter schools serving residents within the City of Ukiah, as well as the unincorporated portions of Mendocino County. As mentioned below in Section 16, Recreation, of this Initial Study, there are 13 City parks, a municipal golf course, and a skate park managed by the City of Ukiah, as well as other recreational facilities in the area. Discussion: (a) Less than significant impact. Although no development is proposed at this time, it is assumed that future development would result in construction and development of residential uses throughout the Project Area. New residential uses would be served by the City’s Police Department and the Ukiah Valley Fire authority. This minimal increase in service area would not be considered significant, as the majority or the parcels within the City are currently developed and served by police and fire services. Similarly, it is not anticipated that the additional residential units, currently already being served by existing school districts, would result in a significant impact to school services. As such, the Project would have a less than significant impact on public services. 16. Recreation RECREATION. Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Would the project increase the use of existing neighborhood and regional parks or other recreational facilities such that substantial physical deterioration of the facility would occur or be accelerated? b) Does the project include recreational facilities or require the construction or expansion of recreational facilities which might have an adverse physical effect on the environment? Significance Criteria: Impacts to recreation would be significant if the Project resulted in increased use of existing parks or recreational facilities to the extent that substantial deterioration was accelerated or if the Project involved the development or expansion of recreational facilities that would have an adverse effect on the physical environment. Environmental Setting: The Ukiah Valley offers a wide variety of recreational opportunities. These include more than 13 City parks, a municipal golf course, and a skate park managed by Page 142 of 800 30 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah the City of Ukiah; two regional parks managed by the County; Cow Mountain Recreation Area managed by the Bureau of Land Management; and Lake Mendocino managed by the US Army Corps of Engineers. In addition, there are approximately 30 miles of trails located throughout the Ukiah Valley. Discussion: (a-b) Less than significant impact. The Project does not propose any recreational facilities at this time. However, the Housing-related Zoning Code Amendments support and encourage housing development. The increase in population would not be considered significant. As such, impacts would be less than significant on park facilities. 17. Transportation TRANSPORTATION. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Conflict with a program, plan, ordinance or policy addressing the circulation system, including transit, roadway, bicycle and pedestrian facilities? b) Conflict or be inconsistent with CEQA Guidelines § 15064.3, subdivision (b), Criteria for Analyzing Traffic Impacts? c) Substantially increase hazards due to a geometric design feature (e.g., sharp curves or dangerous intersections) or incompatible uses (e.g., farm equipment)? d) Result in inadequate emergency access? Significance Criteria: Impacts to transportation and traffic would be significant if the Project conflicted with a local plan, ordinance or policy addressing transit, roadway, bicycle and pedestrian facilities; conflicted with CEQA Guidelines Sec. 15064.3(b), which contains criteria for analyzing transportation impacts; substantially increased hazards due to geometric design features; or resulted in inadequate emergency access. Traditionally, transportation impacts had been evaluated by using Level of Service (LOS) analysis to measure the level of congestion on local roadways. However, on September 27, 2013, Governor Jerry Brown signed Senate Bill (SB) 743 into law, initiating an update to the CEQA Guidelines to change how lead agencies evaluate transportation impacts under CEQA, with the goal to better measure the actual transportation-related environmental impacts of a given project. Starting July 1, 2020, lead agencies are required to analyze the transportation impacts of new projects using vehicle miles traveled (VMT), instead of LOS. VMT measures the amount of additional miles produced by the project. If the project increases car travel onto the roads excessively, the project may cause a significant transportation impact. VMT analysis is intended to promote the state’s goals of reducing greenhouse gas emissions and traffic-related air pollution, promoting the development of a multimodal transportation system, and providing clean, efficient access to destinations. In 2018, the Office of Planning and Research (OPR) published a Technical Advisory on Evaluating Transportation Impacts in CEQA (2018) which is intended to provide advice and recommendations for evaluating VMT, which agencies and other entities may use at their discretion. As discussed further below, the Technical Advisory offers that screening thresholds Page 143 of 800 31 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah may be used to identify when land use projects, such as small scale residential projects, should be expected to cause a less-than-significant impact without conducting a detailed traffic study. On behalf of the Mendocino Council of Governments (MCOG), Fehr & Peers, prepared a Senate Bill 743 Vehicle Miles Traveled Regional Baseline Study (Baseline Study; May, 2020) to provide an overview of SB 743, summarize VMT data available for Mendocino County, discuss alternatives for and recommend VMT measurement methods and thresholds for lead agencies in Mendocino County, and recommend transportation demand management (TDM) strategies for reducing VMT on projects in Mendocino County. The following local plans have historically address transportation within the City of Ukiah: 2017 Ukiah Bicycle and Pedestrian Master Plan, City of Ukiah Safe Routes to School Plan (2014), Mendocino County Rail Trail Plan (2012), Ukiah Downtown Streetscape Improvement Plan (2009), and the City of Ukiah General Plan (Circulation and Transportation Element amended in 2004). MCOG’s Regional Transportation Plan (2017) and Section 5, Circulation and Transportation, of the Ukiah Valley Area Plan (2011) addresses transportation within the larger Ukiah Valley. The Baseline Study incorporated applicable goals and policies from each of these documents into the methodology and analysis when formulating its screening tools. As noted in the Baseline Study, per CEQA Guidelines Section 15064.3, vehicle miles traveled for land use projects exceeding an applicable threshold of significance may indicate a significant impact. Generally, projects within one-half mile of either an existing major transit stop or a stop along an existing high quality transit corridor should be presumed to cause a less than significant transportation impact. In addition, projects that decrease vehicle miles traveled in the project area compared to existing conditions should be presumed to have a less than significant transportation impact. If existing models or methods are not available to estimate the vehicle miles traveled for the particular project being considered, a lead agency may analyze the project’s vehicle miles traveled qualitatively. Such a qualitative analysis would evaluate factors such as the availability of transit, proximity to other destinations, etc. For many projects, a qualitative analysis of construction traffic may be appropriate. A lead agency has discretion to choose the most appropriate methodology to evaluate a project’s vehicle miles traveled, including whether to express the change in absolute terms, per capita, per household or in any other measure. A lead agency may use models to estimate a project’s vehicle miles traveled, and may revise those estimates to reflect professional judgment based on substantial evidence. Any assumptions used to estimate vehicle miles traveled and any revisions to model outputs should be documented and explained in the environmental document prepared for the project. Environmental Setting: The City of Ukiah generally lies west of U.S. 101 between the U.S. 101/North State Street interchange, and the U.S. 101 / South State Street interchange. Three major interchanges along U.S. 101, Talmage Road, Gobbi Street, and Perkins Street (from south to north), provide access to southern and central Ukiah. The City of Ukiah is developed in a typical grid pattern with streets generally oriented north to south and east to west. Bicycle lanes are located throughout the City and public transit is provided by the Mendocino Transit Authority (MTA). Page 144 of 800 32 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Discussion: (a-b) Less than significant impact. While the Proposed Project is intended to facilitate housing development within the City of Ukiah, it does not include specific development designs or proposals, nor does it grant any entitlements for development. Development could also result in impacts to the City’s transportation system depending on location, intensity, and other siting factors. However, the location, intensity, siting, and timing of such development is unknown. Therefore, a high level qualitative analysis is provided below. The OPR Technical Advisory on Evaluating Transportation Impacts Under CEQA suggests that a home based trip approach is one of the best methods for assessing VMT from residential projects. As noted in the Technical Advisory, many agencies use “screening thresholds” to quickly identify when a project should be expected or assumed to cause a less-than-significant impact without conducting a detailed study. As noted in the Fehr & Peers Baseline Study, the specific VMT estimate relies on the vehicle trip generation rate contained in the OPR Technical Advisory for small project screening and average vehicle trip lengths for Mendocino County based on the 2012 California Household Travel Survey (CHTS). Converting this value to an equivalent number of residential households would indicate that residential projects up to 22 units in Mendocino County could be screened out of analysis. It is expected that construction of the Project would result in a temporary increase in traffic to and from the site, as construction workers arrive and leave each work day. However, once construction is complete, workers would no longer be traveling to the site, and the source of VMT would result from permanent residents. Future projects would reviewed by the Department of Public Works and the MTA (as applicable) for potential impacts to the transportation system; additional review and analyses may be required for larger residential projects exceeding 22 units. Impacts would be less than significant. (c-d) Less than significant impact. All road improvements would be developed in accordance with Fire and Building codes related to emergency access and safety. Therefore, future residential projects would not increase traffic hazards, nor would they result in inadequate emergency access. Impacts would be less than significant. 18. Tribal Cultural Resources TRIBAL CULTURAL RESOURCES. Would the project cause a substantial adverse change in the significance of a tribal cultural resource, defined in Public Resources Code section 21074 as either a site, feature, place, cultural landscape that is geographically defined in terms of the size and scope of the landscape, sacred place, or object with cultural value to a California Native American tribe, and that is: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Listed or eligible for listing in the California Register of Historical Resources, or in a local register of historical resources as defined in Public Resources Code section 5020.1(k), or b) A resource determined by the lead agency, in its discretion and supported by substantial evidence, to be significant pursuant to criteria set forth in subdivision (c) of Public Resources Code Section 5024.1. In applying the criteria set forth in subdivision (c) of Public Resource Code Section 5024.1, the lead agency shall consider the significance of the resource to a California Native American tribe. Page 145 of 800 33 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Significance Criteria: An impact to tribal cultural resources would be significant if the Project were to substantially reduce the significance of a tribal cultural resource, a listed or eligible historic resource, or a resource considered significant by a California Native American tribe. Tribal cultural resources include “sites, features, places, cultural landscapes, sacred places, and objects with cultural value to a California Native American Tribe” that are eligible for inclusion in the California Register of Historical Resources (California Register) or included in a local register of historical resources. Lead agencies are required to “begin consultation with a California Native American tribe that is traditionally and culturally affiliated with the geographic area of the Proposed Project.” The consultation process must be completed before a CEQA document can be certified. Environmental Setting: As discussed in Section 5, Cultural Resources, areas that are most typically culturally sensitive include those adjacent to streams, springs, and mid-slope benches above watercourses because Native Americans and settlers favored easy access to potable water. Tribes known to be present within the Ukiah area include (but are not limited to) the following: • Coyote Valley Band of Pomo Indians • Guidiville Indian Rancheria of Pomo Indians • Hopland Band of Pomo Indians • Pinoleville Pomo Nation • Potter Valley Rancheria • Redwood Valley Little River Band of Pomo Indians • Scotts Valley Band of Pomo Indians • Yokayo Tribe, not federally recognized An Historical and Architectural Survey Update was last prepared for the City by P.S. Preservation Services in 1999. The survey identified 23 properties with historic importance within the City limits. City Ordinance No. 838 was passed by the City in 1983, requiring that prior to the demolition of any building over 50 years old, the approval of the City must be obtained. The ordinance is a positive preservation tool, allowing some review and public input opportunity regarding the potential loss of historically significant buildings. Discussion: (a-b) Less than significant impact. As described in Section 5, Cultural Resources, of this Initial Study, because most of the parcels within the City Limits that are residential and commercial zoned are currently developed, it is unlikely that cultural resources would be impacted by future residential development. Although parcels along City creeks have a higher potential for containing cultural resources all future development is subject to CEQA Guidelines Section 15064.5 (e-f) which specifically addresses what to do in the event that human remains or archeological resources are accidentally discovered, and City Ordinance No. 838, protecting historic buildings; future development would be analyzed on a project level basis and subject to environmental review of their individual impacts, as applicable. The proposed Zoning Code amendments also require amendment to the City of Ukiah’s General Plan to increase allowable building density. While the proposed changes include policy changes to facilitate housing development, no development or physical changes to the environment are proposed. However, in accordance with SB 18, tribal notifications offering the opportunity to request formal consultation and an opportunity to review the proposed Zoning Code amendments were sent to California Native American Tribes identified on the list maintained by the Native Heritage Commission (NAHC) on April 22, 2021. The tribes have 90 days to request consultation; no requests for consultation have been received to date. The list of tribes contacted are included in Attachment D. Page 146 of 800 34 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah For the reasons discussed above, impacts to Tribal Cultural Resources from the Proposed Project would be less than significant. 19. Utilities and Service Systems UTILITIES AND SERVICE SYSTEMS. Would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Require or result in the relocation or construction of new or expanded water, wastewater treatment or storm water drainage, electric power, natural gas, or telecommunications facilities, the construction or relocation of which could cause significant environmental effects? b) Have sufficient water supplies available to serve the project and reasonably foreseeable future development during normal, dry and multiple dry years? c) Result in a determination by the wastewater treatment provider, which serves or may serve the project that it has adequate capacity to serve the project’s projected demand in addition to the provider’s existing commitments? d) Generate solid waste in excess of state or local standards, or in excess of the capacity of local infrastructure, or otherwise impair the attainment of solid waste reduction goals? e) Comply with federal, state, and local management and reduction statutes and regulations related to solid waste? Significance Criteria: Impacts to utility and service systems would be significant if the Project resulted in the construction or expansion of utilities that could cause significant environmental effects; have insufficient water supplies available to the Project during normal to extremely dry years; resulted in inadequate capacity of the wastewater treatment plant; generated solid waste exceeding the capacity of local infrastructure or impairing the achievement of solid waste reduction goals; or failed to comply with any management and reduction statutes or regulations related to solid waste. Environmental Setting: The majority of City properties are served by City water, sewer, electricity and trash collection. However, some properties within the western hills do not currently have access to City utilities. Water and electric utility services are provided by the City of Ukiah to parcels within the City limits. The Ukiah Valley Sanitation District (UVSD) and the City of Ukiah provide public sewer services to customers within their boundaries under the purview of the State Water Quality Control Board. The City’s sewage treatment plant and Waste Water Treatment Plant (WWTP), operational since 1958, serves the City of Ukiah and the Ukiah Valley Sanitation District. It has a current treatment capacity of 2.8 million gallons per day (MGD) of dry weather flow and 20 MGD of peak wet weather flow. Primary treatment removes floating material, oils and greases, sand and silt and organic solids heavy enough to settle in water. Secondary treatment biologically removes most of the suspended and dissolved organic material. The Ukiah landfill, outside City limits on Vichy Springs Road, stopped receiving municipal solid waste in 2001 and the City is working on capping the landfill. No new waste generated will be processed through the landfill. Solid waste collected from future development would be delivered to the Ukiah Page 147 of 800 35 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah Transfer Station, which is owned by the City of Ukiah and operated by Solid Wastes Systems, Inc. Discussion: (a-e) Less than significant impact The Project does not include extension of utilities. Future housing development would connect to the existing infrastructure. All development would be required to comply with all regulations pertaining to wastewater, solid waste, and other service systems. Impacts would be less than significant. 20. Wildfire WILDFIRE. If located in or near state responsibility areas or lands classified as very high fire hazard severity zones, would the project: Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Substantially impair an adopted emergency response plan or emergency evacuation plan? b) Due to slope, prevailing winds, and other factors, exacerbate wildfire risks, and thereby expose project occupants to pollutant concentrations from a wildfire or the uncontrolled spread of a wildfire? c) Require the installation or maintenance of associated infrastructure (such as roads, fuel breaks, emergency water sources, power lines or other utilities) that may exacerbate fire risk or that may result in temporary or ongoing impacts to the environment? d) Expose people or structures to significant risks, including downslope or downstream flooding or landslides, as a result of runoff, post-fire slope instability, or drainage changes? Significance Criteria: Impacts to wildfire would be significant if the Project were located in or near a State Responsibility Area (SRA) or lands classified as very high fire hazard severity zones and substantially impaired an emergency response plan; exposed Project occupants to wildfire pollutants or uncontrolled spread of wildfire due to site conditions such as slope and prevailing winds; require the installation or maintenance of infrastructure that could exacerbate fire risk; or expose people or structures to significant risks as a result of post-fire runoff, slope instability or drainage changes. Environmental Setting: All of the City of Ukiah is located within the Ukiah Valley Fire Authority’s jurisdiction. None of the lands within the City of Ukiah are located within a California Department of Forestry (CalFire) State Responsibility Area (SRA). However, County lands immediately west of the City are located within the SRA and are classified as having a “Very High” fire hazard severity. A shaded fuel break was constructed (North to South) along the base of the western hills along the entire length of the City to reduce fuel loads and protect the community from wildfire risk in 2003. Maintenance was performed on the 100-ft wide, 2.6-mile fuel break in late 2018 and early 2019. As discussed in Section 9, Hazards and Hazardous Materials, the County’s EOP plan and MJHMP address emergency operations, natural disasters (including wildfire), as well as mitigation strategies to reduce potential risks. The City of Ukiah adopted its “jurisdictional annex” chapter of the MJHMP on November 18, 2020. Hazards identified for the City of Ukiah include Page 148 of 800 36 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah earthquakes, wildfire, dam failure, flood and pandemic. Table 1-13 of the City’s jurisdictional annex lists each hazard and mitigation action for City of Ukiah. Discussion: (a-d) Less than Significant. . The Project does not propose housing. Future housing would be constructed within the Ukiah Valley Fire District service area and all future development would be reviewed by the Fire Marshall and required to comply with current Fire Code regulations. Impacts would be less than significant. 21. Mandatory Findings of Significance MANDATORY FINDINGS OF SIGNIFICANCE. Potentially Significant Impact Less Than Significant with Mitigation Less Than Significant Impact No Impact a) Does the project have the potential to degrade the quality of the environment, substantially reduce the habitat of a fish or wildlife species, cause a fish or wildlife population to drop below self-sustaining levels, threaten to eliminate a plant or animal community, substantially reduce the number or restrict the range of a rare or endangered plant or animal or eliminate important examples of the major periods of California history or prehistory? Page 149 of 800 37 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah b) Does the project have impacts that are individually limited, but cumulatively considerable? ("Cumulatively considerable" means that the incremental effects of a project are considerable when viewed in connection with the effects of past projects, the effects of other current projects, and the effects of probable future projects)? c) Does the project have environmental effects which will cause substantial adverse effects on human beings, either directly or indirectly? Discussion: (a-c) Less than significant impact. While the Proposed Project is intended to facilitate housing development within the City of Ukiah, it does not include specific development designs or proposals, nor does it grant any entitlements for development. All future development associated with the proposed Zoning Code amendments would be in residential or commercial zoning districts where housing development is already generally allowed by right, or with an approved use permit and site development permit by the City’s Zoning Code and General Plan. There are many possible scenarios and outcomes of the proposed Zoning Code amendments. Future development could result in impacts to the physical environment depending on location, intensity, and other siting factors. However, the exact intensity, location, size and timing of future development is unknown. However, all future development would be analyzed on a project level basis for consistency with land use policies and development standards, and would be subject to Building Permits for consistency with building and safety codes; additional environmental and discretionary review may also be required. Based on the findings and conclusions contained in the Initial Study, the Proposed Project does not have the potential to impact any environmental resources. All impacts were found to have no impact or result in a less than significant impact as a result of the Project. Cumulative impacts are generally considered in analyses of air quality, biological resources, cultural resources, noise, and traffic. As discussed throughout the Initial Study, the Proposed Project would have less than significant impacts on these resources. Housing development that may result from implementation of the Zoning Code amendments could result in impacts to environmental resources that may be considered cumulatively considerable. However, at this time, location, intensity and timing of specific housing development is not known. All future housing development would be analyzed on a project level basis. Based on the findings and conclusions contained in the Initial Study, cumulative impacts related to the Proposed Project would be less than significant. Based on the aforementioned, impacts to the environment, human beings, and cumulative impacts would be less than significant. Page 150 of 800 38 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah VI. REFERENCES 1. CalFire State Responsibility Area Viewer http://www.fire.ca.gov/firepreventionfee/sraviewer_launch 2. CalFire, California Fire Hazard Severity Zone Map Web Viewer. http://egis.fire.ca.gov/FHSZ/ 3. California Department of Conservation. California Geological Survey. Earthquake Fault Map, Ukiah. Zones of Required Investigation. http://gmw.conservation.ca.gov/SHP/EZRIM/Maps/UKIAH.PDF . 4. California Department of Conservation. California Geological Survey. U.S. Landslide Inventory Web Application. https://usgs.maps.arcgis.com/apps/webappviewer/index.html?id=ae120962f459434b8c9 04b456c82669d 5. California Department of Conservation. Farmland Mapping & Monitoring Program, California Important Farmland Finder. https://maps.conservation.ca.gov/DLRP/CIFF/ 6. California Department of Finance. American Community Survey. http://www.dof.ca.gov/Reports/Demographic_Reports/American_Community_Survey 7. California Department of Toxic Substance Control. EnviroStor database https://www.envirostor.dtsc.ca.gov/ 8. California Department of Transportation California State Scenic Highway System map. https://www.arcgis.com/apps/webappviewer/index.html?id=2e921695c43643b1aaf7000d fcc19983 9. California Governor’s Office of Planning and Research. Discussion Draft Technical Advisory: AB 52 and Tribal Cultural Resources in CEQA, May 2015. 10. City of Ukiah General Plan. Last amended 2019. 11. City of Ukiah Bicycle and Pedestrian Master Plan. Prepared by Alta Planning + Design, W-Trans and Walk Bike Mendocino. August 2015. 12. City of Ukiah Code. Last amended 2021. https://www.codepublishing.com/CA/Ukiah 13. City of Ukiah. Housing Element Update 2019-2027. Adopted October 23, 2019 and Certified by HCD December 5, 2019.http://www.cityofukiah.com/projects/housing- element-update/ 14. City of Ukiah. Housing Element Update 2029-2027. Final Initial Study and Negative Declaration. Adopted by City Council on October 23, 2019. http://www.cityofukiah.com/NewWeb/wp-content/uploads/2019/10/2019-2027-Ukiah-HE- ISND-FINAL-Adopted-10232019.pdf 15. City of Ukiah. Ukiah Western Hills Open Land & Limited Development Agreement Draft Initial Study and Mitigated Negative Declaration. April 16, 2021. http://www.cityofukiah.com/ceqa-review/ Page 151 of 800 39 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 16. Federal Highway Administration. 2006. Roadway Construction Noise Model (FHWA- HEP-05-054). 17. Federal Transit Administration, 2018. Transit Noise and Vibration Impact Assessment Manual. FTA Report No. 0123. Prepared by John A. Volpe National Transportation Systems Center. September, 2018. https://www.transit.dot.gov/sites/fta.dot.gov/files/docs/research- innovation/118131/transit-noise-and-vibration-impact-assessment-manual-fta-report-no- 0123_0.pdf 18. Fehr & Peers, on behalf of the Mendocino Council of Governments (MCOG), Senate Bill 743 Vehicle Miles Traveled Regional Baseline Study. May 20, 2020. https://www.mendocinocog.org/vehicle-miles-traveled-vmt-regional-baseline-study- completed 19. Landslide Inventory (Beta). California Department of Conservation. California Geological Survey. https://maps.conservation.ca.gov/cgs/lsi/ 20. Mendocino Council of Governments (MCOG). 2017 Mendocino County Regional Transportation Plan. Prepared by Davey Bates Consulting. Adopted February 5, 2018. https://www.mendocinocog.org/files/742330750/2017+RTP+As+Adopted%28web+forma t%29.pdf 21. Mendocino County Air Quality Management District of the California North Coast Air Basin. Particulate Matter Attainment Plan. January 2005. https://www.co.mendocino.ca.us/aqmd/pm-attainment.html 22. Mendocino County Air Quality Management District website. http://www.co.mendocino.ca.us/aqmd/diesel-engine-information.html. 23. Mendocino County Airport Land Use Commission. Ukiah Airport Land Use Compatibility Plan. Adopted May 20, 2021. 24. Mendocino County Fire Hazard Severity Map. November 7, 2007. 25. Mendocino County Important Farmland Map, undated. 26. Mendocino County Multi-Jurisdictional Hazard Mitigation Plan (MJHMP). Adopted December, 2020. Vol 2, Chapter 1, City of Ukiah Jurisdictional Annex, adopted by the City of Ukiah November 18, 2020. 27. Mendocino County Office of Education. Schools & Districts. https://www.mcoe.us/schools-districts/ 28. Mendocino County Property Search (eTRAKiT). http://etrackit.co.mendocino.ca.usetrakit3/Search/parcel.aspx 29. Mendocino County Water Agency. Water Supply Assessment for the Ukiah Valley Area Plan. October 20, 2010. https://www.mendocinocounty.org/home/showpublisheddocument?id=5486 30. Mendocino County Wildland-Urban Interface (WUI) Zones Map, undated. https://www.mendocinocounty.org/home/showdocument?id=18425 31. Mendocino County General Plan, adopted in 2009 and last revised 2015. https://www.mendocinocounty.org/government/planning-building- services/plans/mendocino-county-general-plan Page 152 of 800 40 Housing-related Zoning Code Amendments Draft Initial Study and Negative Declaration City of Ukiah 32. Mendocino County 2019-2027 Housing Element (6th Cycle). August, 2020. https://www.mendocinocounty.org/government/planning-building- services/plans/housingelement 33. Mendocino County Public GIS Portal https://gis.mendocinocounty.org/portal/home/ 34. Mendocino County Inland Zoning Code https://www.mendocinocounty.org/government/planning-building- services/regulations/zoning-code 35. P.M.C. Background Report for the County of Mendocino General Plan Update. Prepared January 2003. 36. State Water Resources Control Board. GeoTracker. https://geotracker.waterboards.ca.gov. 37. Office of Planning and Research (OPR) Technical Advisory on Evaluating Transportation Impacts In CEQA. December 2018. https://www.opr.ca.gov/docs/20190122- 743_Technical_Advisory.pdf 38. U.S. Department of Agriculture - Soil Conservation Service. Web Soil Survey. https://websoilsurvey.sc.egov.usda.gov/App/HomePage.htm 39. U.S. Department of Fish and Wildlife. Environmental Conservation Online System. https://ecos.fws.gov/ecp0/reports/species-listed-by-state-report?state=CA&status=listed 40. Ukiah Valley Area Plan, adopted August 2, 2011. https://www.mendocinocounty.org/government/planning-building-services/plans/ukiah- valley-area-plan Page 153 of 800 300 Seminary Avenue • Ukiah • CA • 95482-5400 Phone: (707)463-6200 · Fax: (707)463-6204 ·www.cityofukiah.com 1 GENERAL PLAN TEXT AMENDMENT NO. 21-01 On August 18, 2021, the City Council adopted Resolution No. 2021-38, approving General Plan Amendment No. 21-01, approving the following amendments to the 1995 General Plan Land Use Element, shown below. Approved changes are shown in strikeout (for deleted text) and italics (for added text). Medium Density Residential Maximum density: One to fourteen fifteen dwelling units per one acre of gross land area. with public water and public sewer; one dwelling unit per 12,000 2,904 square feet of gross land area with public water or public sewer; one dwelling unit per one acre of gross land area with well and septic. Commercial Designation: Maximum building intensity: With the exception of the Downtown Master Plan area when off-site parking is provided through a parking district, the maximum lot coverage for commercial development shall be forty percent of the gross land area. For residential development, the maximum lot coverage shall be no more than sixty percent of the gross land area, where indicated by the zoning district. Exhibit B Page 154 of 800 Page 1 of 1 Agenda Item No: 7.e. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2019-237 AGENDA SUMMARY REPORT SUBJECT: Adoption of Resolution Approving Records Destruction for City Manager's Office. DEPARTMENT: City Clerk PREPARED BY: Kristine Lawler, City Clerk PRESENTER: Consent Calendar ATTACHMENTS: 1. Resolution with Exhibit A - Records Destruction Notice Summary: The City Manager's Office, along with the City Attorney and City Clerk, have reviewed records that have been identified as being ready for destruction. Council is being asked to approve their destruction. Background: The City Manager's Office, along with the City Attorney and City Clerk, have reviewed the Records Destruction Notices for 28 boxes and have approved them for shredding. Discussion: The estimated cost for shredding the 28 boxes is $196. The City Clerk budget includes funds for annual records destruction and no budget amendment is necessary at this time. Staff recommends that Council adopt the resolution (Attachment 1), authorizing the destruction of 28 boxes of outdated documents, listed in full and attached as Exhibit A to the resolution. Recommended Action: Adopt resolution authorizing the destruction of outdated documents for the City Manager's Office. BUDGET AMENDMENT REQUIRED: No CURRENT BUDGET AMOUNT: $1,500 PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: 20012500.52100; City Clerk Contracted Services PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 155 of 800 ATTACHMENT 1 RESOLUTION NO. 2021- RESOLUTION OF THE CITY COUNCIL OF THE CITY OF UKIAH AUTHORIZING THE DESTRUCTION OF CERTAIN RECORDS WHEREAS, the City Manager’s Office, along with the City Attorney and City Clerk have reviewed and approved the list of records that are attached as Exhibit A, and determined that said records are no longer necessary and may at this time be destroyed. NOW, THEREFORE, BE IT RESOLVED, that the Ukiah City Council hereby approves the destruction of certain records, contained in Exhibit A of this Resolution, and authorizes the City Clerk to destroy the records. PASSED AND ADOPTED this 15th day of September, 2021, by the following roll call vote: AYES: NOES: ABSTAIN: ABSENT: ____________________________ Juan V. Orozco, Mayor ATTEST: ______________________________ Kristine Lawler, City Clerk Page 156 of 800 CITY OF UKIAH RECORDS DESTRUCTION NOTICE Date: 9/15/21 Department: City Manager’s Office Current retention schedules show that the attached records listed are now ready for review for records destruction. Instructions: 1. Review the attached listing (if needed, you may obtain a copy of the retention guidelines from City Clerk) 2. If only a portion of the box is to be kept, remove it and start a new box with a new transfer notice; Follow normal retention box submission instructions, which can be obtained from City Clerk if needed. 3. If the entire box is to be kept, change the date/year to consider destruction on the attached list, and give back to the City Clerk. 4. For boxes that are okay to proceed with destruction, obtain Department Head's signature and return this notice, along with the attached list to City Clerk. NOTE: Please keep in mind that we only have a set number of box storage locations. Only keep records past their retention deadline if it is necessary. Thank you for your cooperation in keeping our records management system working smoothly. Kristine Lawler, City Clerk DATE SIGNATURE Department Head City Clerk City Attorney City Council Destroyed Shannon Riley (Sep 7, 2021 15:50 PDT) Sep 7, 2021 Kristine Lawler (Sep 7, 2021 16:09 PDT) KristineLawlerSep7, 2021 Sep 9, 2021 Page 157 of 800 Page 158 of 800 Page 159 of 800 Page 160 of 800 Page 161 of 800 Page 162 of 800 Page 163 of 800 Page 164 of 800 Page 165 of 800 Page 166 of 800 Page 167 of 800 Page 168 of 800 Page 169 of 800 Page 170 of 800 Page 171 of 800 Page 172 of 800 Page 173 of 800 Page 174 of 800 Page 175 of 800 Page 176 of 800 Page 177 of 800 Page 178 of 800 Page 179 of 800 Page 180 of 800 Page 181 of 800 Page 182 of 800 Page 183 of 800 Page 184 of 800 Page 185 of 800 Page 186 of 800 Page 187 of 800 Page 188 of 800 Page 189 of 800 Page 190 of 800 2021-09-15 Records Destruction Notice Final Audit Report 2021-09-09 Created:2021-09-09 By:Kristine Lawler (klawler@cityofukiah.com) Status:Signed Transaction ID:CBJCHBCAABAAwDua61Va3pxfmrIMf_jIm8P2tgfodm8C 2021-09-15 Records Destruction Notice" History Document created by Kristine Lawler (klawler@cityofukiah.com) 2021-09-09 - 8:18:04 PM GMT- IP address: 12.12.163.2 Document emailed to David Rapport (drapport@cityofukiah.com) for signature 2021-09-09 - 8:18:30 PM GMT Email viewed by David Rapport (drapport@cityofukiah.com) 2021-09-09 - 8:25:44 PM GMT- IP address: 73.223.12.193 Document e-signed by David Rapport (drapport@cityofukiah.com) Signature Date: 2021-09-09 - 8:25:55 PM GMT - Time Source: server- IP address: 73.223.12.193 Agreement completed. 2021-09-09 - 8:25:55 PM GMT Page 191 of 800 Page 1 of 1 Agenda Item No: 7.f. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1051 AGENDA SUMMARY REPORT SUBJECT: Approval of Budget Amendment in the Amount of $10,000 for Colantuono, Highsmith & Whatley PC for Specialized Legal Services Related to LAFCo Matters. DEPARTMENT: Finance PREPARED BY: Brenda Stacy, Associate Accountant PRESENTER: Consent Calendar ATTACHMENTS: None Summary: The Council will consider approving a budget amendment in the amount of $10,000 for legal services under contract no. 1415-099 with Colantuono, Highsmith & Whatley PC. Background: In 2014, City Council approved the retaining of consultant services with Colantuono, Highsmith & Whatley PC, in association with the detachment of that portion of the Ukiah Valley Sanitation District ("District") which is located within the Ukiah city limits. Since that time, this firm continues to provide the necessary expertise and experience to perform these services. Discussion: Staff acknowledges the continued need for the services of Colantuono, Highsmith & Whatley PC. During the preparation and planning of the fiscal year 2021-2022 budget, funding specific for LAFCo services related to the City's sewer system was overlooked and staff is requesting $10,000 to cover anticipated expenses. Recommended Action: Approve budget amendment in the amount of $10,000 for Colantuono, Highsmith & Whatley PC, for legal services under contract no. 1415-099. BUDGET AMENDMENT REQUIRED: YES CURRENT BUDGET AMOUNT: 84427222.52100.15068: $0 PROPOSED BUDGET AMOUNT: 84427222.52100.15068: $10,000 FINANCING SOURCE: Sewer Fund PREVIOUS CONTRACT/PURCHASE ORDER NO.: COU No. 1415-099 COORDINATED WITH: Mary Horger, Financial Services Manager; Daniel Buffalo, Finance Director Page 192 of 800 Page 1 of 2 Agenda Item No: 7.g. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1052 AGENDA SUMMARY REPORT SUBJECT: Authorize City Manager to Execute an Memorandum of Understanding (MOU) to Partner with Ukiah Unified School District to Expand the After School Education and Safety Program. DEPARTMENT: Community Services PREPARED BY: Jake Burgess, Community Services Supervisor PRESENTER: Jake Burgess, Recreation Supervisor ATTACHMENTS: 1. ASES MOU with UUSD Summary: The City Council will consider Authorizing the City Manager to execute a Memorandum of Understanding between the City of Ukiah and Ukiah Unified School District to partner to expand the After School Education and Safety program. Background: The COVID-19 pandemic has damaged our entire community in incalculable ways, but school age children are inarguably one of the most adversely affected. Access to exercise, socialization, and educational support are extremely important in the development of young people. The Ukiah Unified School District and the City of Ukiah have been working together to provide the support and access to these vital elements for the past year in the form of a distance learning support program and a Summer School partnership. The City of Ukiah has been operating Summer Safari Day Camp for over 30 years and has many staff members experienced in providing safe, fun activities in a child care setting. The Recreation Department has experience with recruiting, hiring, training and supervising large numbers of young staff members so they were targeted as an ideal partner agency by the School District. Discussion: The Afterschool Education and Safety (ASES) program begins at each school site as soon as school is dismissed for the day and runs until 6:00pm or when the child is picked up. The program provides a bridge between the regular school day and when a child goes home. A regular ASES day consists of homework support, snacks, as well as indoor and outdoor activities. UUSD currently has the capacity to serve approximately 100 children at each of their Elementary School sites and there are extensive Wait Lists for the program. With the partnership with the City, capacity will be increased to 200 per school site, serving a far greater portion of the youth and families who are in need of access to this program. Staffing support is planned at Frank Zeek, Yokayo, Nokomis, Calpella and Oak Manor Elementary Schools. The City will be reimbursed for this staffing support at a rate of $8,500 per site per week or a daily rate of $1,700 for partial weeks. The ASES program partnership is in addition to regular Recreation programming and events scheduled during the school year including recreation classes, youth sports, adult sports, PumpkinFest, Ukiah On Ice, Haunted House, and other activities. The details of this arrangement are laid out in Attachment 1 - ASES MOU with UUSD. Recommended Action: Authorize the City Manager to execute a Memorandum of Understanding between the City of Ukiah and Ukiah Unified School District to partner to expand the Afterschool Education and Safety program. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A Page 193 of 800 Page 2 of 2 PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 194 of 800 1 MEMORANDUM OF UNDERSTANDING BETWEEN CITY OF UKIAH AND UKIAH UNIFIED SCHOOL DISTRICT AFTER SCHOOL EDUCATION & SAFETY PROGRAM STAFFING This Memorandum of Understanding (“MOU” or “Agreement”), is made by and between the Ukiah Unified School District, a public local educational agency (“LEA”), hereinafter referred to as “District,” and the City of Ukiah (“City”), a public entity. RECITALS: 1. In response to the COVID-19 pandemic’s deleterious effects on school age youth in the form of lost instruction and needed supports for social and emotional well-being, among other needs, federal and state agencies have provided one-time funding to LEAs, including the District, to address learning recovery by providing programs to expand instructional learning, provide after school programs, or conduct other activities in accord with the respective funding rules. 2. The District will receive a grant from the California Department of Education for Expanded Learning Opportunities in accord with Education Code section 45320 et seq. As a condition of that grant, the District must offer at least nine hours of combined instruction and in-person before or afterschool learning opportunities each school day and for at least 30 non-schooldays during intersession periods. The District must offer these expanded learning programs to all unduplicated pupils and provide services to at least 50 percent of unduplicated pupils in grades 1-6 in the 2021-2022 school year. 3. The District and City intend to partner to provide Expanded Learning Opportunities to student participants (“Participants”) in the District’s current After School Education & Safety (“ASES”) Program at Frank Zeek Elementary, Nokomis Elementary, and Yokayo Elementary (“Elementary Schools”). AGREEMENT: 1. Description of Program. The ASES Programs at the Elementary Schools begin at the end of each school sites’ school dismissal time and run until 6:00p.m. Monday through Friday. Start times for the ASES Programs vary by site and by day based on the Elementary Schools’ bell schedules, attached as Exhibit A. The purpose of the Expanded Learning Opportunities Program is to extend teaching and learning beyond the school day and beyond the classroom doors and walls. Students participate in a balance of individual activities, small and large group activities, indoor and outdoor activities, and quiet as well as active play. 2. Description of Partnership. Each ASES Program current serves approximately one hundred (100) students, and will increase to serving approximately two hundred (200) students during the 2021-2022 school year. In order to effectuate this increase, the City agrees to provide City employees to staff the ASES Programs at the Elementary Schools. Combined ASES and City staff will operate academic and recreational stations during the afterschool programs’ hours. Page 195 of 800 2 3. Term. The term of this Agreement shall be from August 19, 2021, to June 9, 2022. 4. District Obligations/Fees. In exchange for City staffing of ASES Programs at Elementary Schools, the District will pay the City $8,500.00 per week, per site. The weekly amount will be prorated to a daily rate of $1,700.00 per day for any partial weeks. The maximum amount that could be paid to City under this Agreement is $1,530,000.00. The District will provide a meal (“supper”) to all Participants. 5. City Obligations. The City will provide approximately six to eight staff per Elementary School site to supervise Participants during academic support and/or recreation. District and City staff will work together to determine final staffing needs at each Elementary School site. City staff, while on the campuses of the Elementary Schools, will work with and under the direction of District staff. City staff will be available to work from school dismissal to 6:00p.m., unless released early by District staff. 6. Additional School Sites. The District would like to increase the student capacity in the ASES Program at Calpella Elementary and Oak Manor Elementary, and will pay for City staffing of those ASES Programs as per Paragraph 5 of this Agreement at the same rates as per Paragraph 4 of this Agreement. In the event the City is able to hire and train additional staff to staff one or both of these schools, the City should notify the District in writing. The City and the District will then choose and agree to, in writing, a start date for City staffing at Calpella Elementary and/or Oak Manor Elementary. 7. Fingerprinting. The District has determined that Education Code section 45125.1(d) applies to City staff working in the ASES Programs under this Agreement. Section 45125.1 requires that employees of entities providing specific schoolsite services to school districts must be fingerprinted by the California Department of Justice for a criminal records check, unless the District determines that the entity and the entity’s employees will have limited contact with pupils. In making this determination, the District considered the totality of the circumstances, including factors such as the length of time the City and the City’s employees will be on school grounds, whether pupils will be in proximity with the site where the City’s employees will be working, and whether the City’s employees will be alone or with others. The District further reserves the right to determine, on a case-by-case basis, to require any entity providing school site services to comply with the requirements of this paragraph. The City expressly acknowledges that: (1) The City and all of the City’s employees working on the school site must submit or have submitted fingerprints in a manner authorized by the Department of Justice, together with the requisite fee as set forth in Education Code section 45125.1; (2) The City shall not permit any employee to come in contact with students until the Department of Justice has ascertained that the employee has not been convicted of a serious or violent felony; (3) The City shall certify in writing to the Governing Board of the District that none of its employees who may come in contacts with students have been convicted of a serious or violent felony; and (4) The City shall provide to the Governing Board of the District a list of names of its employees who may come in contact with students. The City is required to fulfill these requirements at its own expense. The City must notify the District within two (2) business days of a subsequent arrest notification from the DOJ of any City employees who were working or had worked at an Elementary School pursuant Page 196 of 800 3 to this Agreement. If the City receives notice from any entity that a minor employed by the City and working in an ASES Program has been arrested for any reason, the City must notify the District within two (2) business days of receipt of notice. If an employee is disqualified from working at the District pursuant to the requirements of the California Education Code, the City agrees to provide a replacement employee within fifteen (15) days of receiving notification that the previous employee has been disqualified. All City employees working at District Elementary Schools must be fingerprinted by September 1, 2021. 8. COVID-19 Provisions. Pursuant to the August 11, 2021, State of California Public Health Order, vaccine verification is required for all workers in school. The City should ensure that its employees staffing the ASES Programs are in compliance with the August 11, 2021, State of California Public Health Order. (Exhibit B) The City and City employees are expected to follow all other relevant COVID-19 requirements and guidelines from the California Department of Public Health (CDPH), the Division of Occupational Safety and Health (Cal/OSHA), and the Mendocino County Public Health Department. 9. Confidential Records and Data. Each Party shall not disclose confidential records received from the other party, including student records pursuant to FERPA, 20 U.S.C. § 1232g, et seq., and California Education Code § 49060, et seq. 10. Payment. The City will invoice the District for services provided under this Agreement every month. The District will pay the invoice within thirty (30) days of receipt of properly submitted invoices. 11. Insurance. The insurance provisions in the Agreement for Joint Use of Facilities between the District and the City, dated October 30, 2014, shall apply to this Agreement. 12. Indemnification. The City shall indemnify, defend with counsel acceptable to District, and hold harmless to the full extent permitted by law, District and its Board of Trustees, officers, agents, employees and volunteers from and against any and all liability, loss, damage, claims, expenses and costs (including, without limitation, attorney fees and costs and fees of litigation) (collectively, “Liability”) of every nature arising out of or in connection with the City’s performance this Agreement or its failure to comply with any of its obligations contained in these contract documents, except such Liability cause by the active negligence, sole negligence or willful misconduct of the District. This indemnification obligation is not limited in any way by any limitation on the amount or type of damages or compensation payable to or for City or its agents under workers’ compensation acts, disability benefit acts, or other employee benefit acts. The City shall be liable to District for any loss or damage to District property arising from or in connection with the City’s performance hereunder. 13. Termination. Failure to comply with any provision of this Agreement within a period of ten (10) days following receipt of a written notice of noncompliance from either party shall constitute a material breach of the Agreement and furnish grounds for termination of this Agreement. Page 197 of 800 4 14. General Provisions. A. Independent Contractor. City shall be acting as an independent contractor in carrying out its duties under this Agreement. Neither party is to be considered an agent or employee of other, nor are employees of one agency entitled to participate in any pension plan, insurance, bonus, or similar benefits the party provides to its employees. B. Non-Discrimination. Neither the District nor the City, nor their respective employees, shall discriminate on the basis of race, religion, color, ancestry, sex, gender identity, sexual orientation, disability, national origin, or any other prohibited grounds against any person seeking employment or services. C. Notices. Except as otherwise expressly provided herein, any written notice required by this Agreement shall be deemed given and received when personally served or 48 hours after being placed in the United States mail, with proper first- class postage prepaid, and addressed as follows: For District: Attention: Steve Barekman, Chief Business Officer Ukiah Unified School District 511 S. Orchard Ave Ukiah, CA 95482 For City: Attention: Sage Sangiacomo, City Manager City of Ukiah Civic Center 300 Seminary Avenue Ukiah, CA 95482. Any party hereto may give notice of an address change under the provisions of this paragraph and thereafter all notices shall be given to that address. D. Paragraph Headings. Paragraph headings are included for the convenience of the parties and are not intended to define or limit the scope of this Agreement. E. Duplicate Originals. This Agreement may be executed in one or more duplicate originals bearing the original signature of both parties and when so executed any such duplicate original shall be admissible as proof of the existence and terms of this Agreement. F. Applicable Law/Venue. This Agreement shall be governed by and construed in accordance with the laws of the State of California. If any action is instituted to enforce or interpret this Agreement, venue shall only be in the appropriate state or federal court having venue over matters arising in Mendocino County, California, provided that nothing in this Agreement shall constitute a waiver of immunity to suit by the District. Page 198 of 800 5 G. Attorneys’ Fees. In any legal action to enforce any of the terms of this Agreement, each party shall bear its own attorney’s fees and costs, and neither party shall be liable for any such fees and costs incurred by the other party. H. Assignment. This Agreement is made by and between the District and the City, and any attempted assignment by them, their successors, or assigns, shall be void unless approved in writing by the Parties. I. Amendments. The terms of this Agreement shall not be amended in any manner except by written agreement signed by the Parties. J. Approval/Ratification by Board of Education. This Agreement shall be subject to approval/ratification by the District’s Board of Education. Page 199 of 800 6 This Agreement is effective upon the date that both parties have executed this Agreement. City of Ukiah Ukiah Unified School District ______________________________ ______________________________ Sage Sangiacomo, City Manager Steve Barekman, Chief Business Officer Date: _________________________ Date: _________________________ Page 200 of 800 7 EXHIBIT A Page 201 of 800 August 11, 2021 TO: SUBJECT: TOMÁS J. ARAGÓN, M.D., Dr.P.H. State Public Health Oicer & Director GAVIN NEWSOM Governor State of California—Health and Human Services Agency California Department of Public Health All Californians Vaccine Verification for Workers in Schools Related Materials: Vaccine Verification for Workers in Schools - Q&A State Public Health Oicer Order of August 11, 2021  The COVID-19 pandemic remains a significant challenge in California. COVID-19 vaccines are eective in reducing infection, serious disease, hospitalization, and death. At present, 63% of Californians 12 years of age and older are fully vaccinated with an additional 10% partially vaccinated. Children under the age of 12 are not currently eligible for any authorized vaccines. California is currently experiencing the fastest increase in COVID-19 cases during the entire pandemic with 22.7 new cases per 100,000 people per day, with case rates increasing tenfold since early June. The Delta variant, which is two times more contagious than the original virus, is currently the most common variant causing new infections in California. Unvaccinated persons are more likely to get infected and spread the virus, which is transmitted through the air. Most current hospitalizations and deaths are among unvaccinated adults. Almost all K-6th graders are unvaccinated and will not be eligible for vaccines at the outset of the 2021-22 school year. Additionally, although some 7-12th grade students will be fully vaccinated by the start of the school year, many will not. As of August 10, 2021, less than 41% of Californians 12 to 17 years old were fully vaccinated. California is committed to safe, full, in-person learning for all in K-12 schools, following strong public health science. For example, California has implemented a universal masking requirement in all K-12 schools, as well as recommendations around testing strategies for K-12 schools, to support the successful return to full in-person instruction at the outset of the school year, as well as minimizing missed school days.  Vaccination against COVID-19 is the most eective means of preventing infection with the COVID-19 virus, and subsequent transmission and outbreaks. Current CDPH K-12 guidance strongly recommends vaccination for all eligible individuals, thereby reducing COVID-19 rates throughout the community, including in schools, and creating a wrap-around safety layer for unvaccinated students. This Order, consistent with this recommendation, Exhibit B Page 202 of 800 requires verification of vaccination status among eligible K-12 school workers, and establishes diagnostic screening testing of unvaccinated workers to minimize the risk that they will transmit while on K-12 school campuses, where a majority of students are not vaccinated and younger students are not yet eligible for vaccines. Schools may use funds received from multiple sources to address costs associated with employee vaccination verification and COVID-19 diagnostic screening testing, including Elementary and Secondary School Emergency Relief Fund (ESSER) I, II, and III; Governor's Emergency Education Relief Fund (GEER) I and II; and In-Person Instruction Grants (AB 86). Additionally, the California Department of Public Health provides access to subsidized COVID-19 testing for schools through specified partners. For these reasons, in order to prevent the further spread of COVID19 in K-12 schools, the following temporary and limited public health measures are necessary at this time. I, as State Public Health Oicer of the State of California, order: I. This Order applies to the following facilities: public and private schools serving students in transitional kindergarten through grade 12, inclusive, except that it does not apply to home schools. Further, it does not apply to child care or to higher education. II. All schools identified in this Order must verify vaccine status of all workers. A. Pursuant to the CDPH Guidance for Vaccine Records Guidelines & Standards, only the following modes may be used as proof of vaccination: 1. COVID-19 Vaccination Record Card (issued by the Department of Health and Human Services Centers for Disease Control & Prevention or WHO Yellow Card) which includes name of person vaccinated, type of vaccine provided and date last dose administered); OR 2. a photo of a Vaccination Record Card as a separate document; OR 3. a photo of the client's Vaccination Record Card stored on a phone or electronic device; OR 4. documentation of COVID-19 vaccination from a health care provider; OR 5. digital record that includes a QR code that when scanned by a SMART Health Card reader displays to the reader client name, date of birth, vaccine dates and vaccine type; OR 6. documentation of vaccination from other contracted employers who follow these vaccination records guidelines and standards. In the absence of knowledge to the contrary, a school may accept the documentation presented as valid. B. Schools must have a plan in place for tracking verified worker vaccination status. Records of vaccination verification must be made available, upon request, to the local health jurisdiction for purposes of case investigation. C. Workers who are not fully vaccinated, or for whom vaccine status is unknown or documentation is not provided, must be considered unvaccinated. Page 203 of 800 III. Testing requirements: A. Asymptomatic unvaccinated or incompletely vaccinated workers are required to undergo diagnostic screening testing. B. Workers may be tested with either antigen or molecular tests to satisfy this requirement, but unvaccinated or incompletely vaccinated workers must be tested at least once weekly with either PCR testing or antigen testing. Any PCR (molecular) or antigen test used must either have Emergency Use Authorization by the U.S. Food and Drug Administration or be operating per the Laboratory Developed Test requirements by the U.S. Centers for Medicare and Medicaid Services. C. Unvaccinated or incompletely vaccinated workers must also observe all other infection control requirements, and are not exempted from the testing requirement even if they have a medical contraindication to vaccination, since they are still potentially able to spread the illness. Previous histor y of COVID-19 from which the individual recovered more than 90 days earlier, or a previous positive antibody test for COVID-19, do not waive this requirement for testing. D. Schools with workers required to undergo workplace diagnostic screening testing should have a plan in place for tracking test results and conducting workplace contact tracing, and must report results to local public health departments. There are IT platforms available that can facilitate these processes for schools. IV. Definitions:  For purposes of this Order, the following definitions apply: Page 204 of 800 A. "Fully Vaccinated" means individuals who are considered fully vaccinated for COVID-19: two weeks or more aer they have received the second dose in a 2-dose series (Pfizer- BioNTech or Moderna or vaccine authorized by the World Health Organization), or two weeks or more aer they have received a single-dose vaccine (Johnson and Johnson [J&J]/Janssen). COVID-19 vaccines that are currently authorized for emergency use: 1. By the US Food and Drug Administration (FDA) , are listed at the FDA COVID-19 Vaccines webpage  2. By the World Health Organization (WHO), are listed at WHO COVID-19 Vaccines webpage  B. "Incompletely vaccinated" means persons who have received at least one dose of COVID- 19 vaccine but do not meet the definition of fully vaccinated. C. "Transitional Kindergarten" means the first year of a two-year kindergarten program that uses a modified kindergarten curriculum that is age and developmentally appropriate. D. "Unvaccinated" means persons who have not received any doses of COVID-19 vaccine or whose status is unknown. E. "WHO Yellow Card" refers to the original World Health Organization International Certificate of Vaccination or Prophylaxis issued to the individual following administration of the COVID-19 vaccine in a foreign country. F. "Worker" refers to all paid and unpaid adults serving in the school settings described in Section I. Workers include, but are not limited to, certificated and classified sta, analogous sta working in private school settings, and volunteers who are on-site at a school campus supporting school functions. V. The Terms of this Order supersede any conflicting terms in any other CDPH orders, directives, or guidance. VI. Except to the extent this Order provides otherwise, all other terms in my Order of June 11, 2021 remain in eect and shall continue to apply statewide. VII. This Order shall take eect on August 12, 2021, at 12:01 am. Facilities must be in full compliance with the Order by October 15, 2021. VIII. This Order is issued pursuant to Health and Safety Code sections 120125, 120140, 120175,120195 and 131080 and other applicable law. Tomás J. Aragón, MD, DrPH Director and State Public Health Oicer Page 205 of 800 California Department of Public Health California Department of Public Health PO Box, 997377, MS 0500, Sacramento, CA 95899-7377 Department Website (cdph.ca.gov) Page 206 of 800 Page 1 of 1 Agenda Item No: 7.h. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2019-84 AGENDA SUMMARY REPORT SUBJECT: Review Landfill Closure Financial Plan Update. DEPARTMENT: Finance PREPARED BY: Dan Buffalo, Finance Director PRESENTER: Consent Calendar ATTACHMENTS: 1. CC Reso-Establishing Funding Closure-Ukiah Solid Waste Disposal 2. 2021 Inflation Form Factor (ASR) Summary: The City Council will receive an update on the Financial Plan of 2016 to finance closure, post-closure, and a corrective action plan of the Ukiah Landfill. Background: The City Council, at its regularly scheduled meeting of January 6, 2016, considered a strategy to provide funding for the ultimate closure, post closure, and Corrective Action Plan (CAP) reserve of the Ukiah Landfill. The strategy was memorialized in the City Council Resolution No. 2016-03 (Attachment 1). The Resolution directs the Finance Director to present to Council for consideration annually the condition of the financial plan, with any recommended adjustments. Discussion: Costs to conduct closure, post-closure, and prepare a corrective action plan have been adjusted by an inflationary index provided by CalRecycle. For 2021 the estimated cost with an assumed inflationary adjustment of 1.2 percent from 2020 is $19,730,970. The change in cost is due to the annual inflation factor provided by CalRecycle. The Finance Department, in coordination with Public Works and the City Manager's Office, is preparing a revised financing strategy to meet this obligation in full, using a combination of reserves, cash inflows from surcharges collected at the transfer station, and potential new debt financing. The plan is anticipated to be ready for consideration by the Council in early November. Detail of the calculation and the breakdown by the various categories of closure are included in Attachment 2. Recommended Action: Receive and file update to the Landfill Closure Financial Plan. BUDGET AMENDMENT REQUIRED: No CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Tim Eriksen, Public Works Director/City Engineer Page 207 of 800 1 1 1 RESOLUTION NO. 2016-03 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF UKIAH ESTABLISHING FINANCIAL MECHANISM FOR FUNDING CLOSURE, POST - CLOSURE MAINTENANCE, AND CORRECTIVE ACTION PLAN FOR CITY OF UKIAH SOLID WASTE DISPOSAL SITE WHEREAS: 1. The City of Ukiah solid waste disposal site ( "Landfill ") located at 3100 Vichy Springs Road, Mendocino County Assessor Parcel No. 178- 130 -01), consisting of a landfill footprint of approximately 40 acres, ceased operations and accepting solid waste in September 2001; and 2. Since September 2001, the City has maintained the Landfill, including monitoring wells surrounding the perimeter of the property and a leachate collection system that captures and disposes of leachate through the City's sewer system; and 3. Under applicable provisions of the California Public Resources Code and in Title 27 of the California Code of Regulations ( "CCR "), the City is required to adopt a plan for the closure, post - closure maintenance, and corrective actions required for the Landfill; and 4. Pursuant to 27 CCR 21180(a), the City must provide post - closure maintenance and a corrective action plan reserve ( "CAP ") for a thirty -year period after closure; and 5. The cash collected by the City to provide for Closure, Post - Closure Maintenance, and the CAP reserve are reflected in the City's financial statements as a net position of the disposal site proprietary fund; and 6. The City is scheduled to complete the closure of the landfill ( "Closure ") in accordance with its approved closure plan in 2016; and 7. Recently, new and more costly regulatory requirements relating to Closure have been imposed by the California state agencies with jurisdiction over the Closure. These additional requirements, including installation of a methane gas collection system, would have been imposed, even if the Closure had occurred prior to the imposition of these new requirements; and 8. The most recent engineer's estimates for Closure, including the gas collection system and other additional requirements, indicate that the net proprietary fund for the Landfill is not sufficient to cover all of the costs of Closure, Post - Closure Maintenance, and to establish a CAP reserve; and 9. The City must provide the funding for Closure, Post - Closure Maintenance, and the CAP reserve; and 10. On January 1, 2017, pursuant to the Amended and Restated Transfer Station Agreement Transfer Station Agreement ") between the City of Ukiah and Solid Waste Systems, Inc. SWS "), dated December 12, 2011, the City is entitled to acquire legal title to the Transfer Station (Transfer Station) located at 3151 Taylor Drive, Ukiah, California, and the City and SWS are obligated to enter a lease under which SWS will continue to operate the transfer station and pay rent ( "Transfer Station Rent ") to the City for the use of the Transfer Station; and 1 Page 208 of 800 10. Dedicating Transfer Station Rent to fund Closure, Post - Closure Maintenance, and the Cap Reserve as further provided herein will provide a source of revenue to fund those obligations which exceed the disposal site proprietary fund; and 11. Commencing on January 1, 2012, the City adopted a City Surcharge on the Gate Fee at the Transfer Station ( "Surcharge ") to provide a source of revenue in the Landfill /Solid Waste Enterprise Fund for Closure and Post - Closure Maintenance, and the CAP reserve. The Surcharge is currently $2.00 per ton of Solid Waste received at the Transfer Station. The Surcharge is collected by SWS and remitted to the City, where it is recorded as revenue in the Landfill /Solid Waste Enterprise Fund as Closure and Post - Closure Reserve; and 12. Committing the Surcharge at its current level or any future level approved by the City Council will stabilize the Landfill /Solid Waste Enterprise Fund, provide a dedicated source of revenue to comply with the City's Closure and Post - Closure Maintenance costs, and the establishment and replenishment of the Cap Reserve; and 13. The combination of the disposal site proprietary fund, Transfer Station Rent, and the Surcharge will provide adequate funding for City's Closure and Post - Closure Maintenance costs, and the establishment and replenishment of the Cap Reserve, provided however, that an increase in the Surcharge may be necessary once the final Closure costs and the method of financing the City's obligations is determined; NOW, THEREFORE, BE IT RESOLVED, by the City Council of the City of Ukiah as follows: 1. Transfer Station Rent is hereby committed to any unfunded Closure costs, Post - Closure Maintenance costs, and the establishment and replenishment of the CAP reserve. 2. There is hereby established a Transfer Station Rents Special Revenue Fund (Special Revenue Fund) for all Transfer Station Rent revenue which fund is established and dedicated to pay for any Closure costs, Post - Closure Maintenance costs, and the establishment and replenishment of the CAP reserve. 3. Revenue recorded in the Special Reserve Fund shall be given first preference over other revenue sources, other than grants, in funding Closure and Post - Closure Maintenance expenses and CAP reserve requirements that are not funded by the disposal site proprietary fund. 4. Any Closure and Post - Closure Maintenance expenses and CAP reserve requirements not funded by grants, the disposal site proprietary fund, and the Special Revenue Fund shall be funded by the Surcharge. 5. The City Finance Director is hereby directed to prepare for City Council the approval a Financial Plan (Plan) to extinguish in fifteen years the estimated unfunded Closure and thirty - year Post - Closure Maintenance costs, and the CAP reserve requirements, and present the Surcharge to be applied to the Transfer Station Gate Fee commencing on January 1, 2017. The revised Surcharge shall be submitted to the City Council for approval no later than October 2016. Thereafter, in September of each year, the City Finance Director shall prepare an update of the Plan to fund Closure, Post - Closure Maintenance, and CAP requirements. Any recommended increase or decrease in the Surcharge resulting from the annual update of the Plan shall be presented to the City Council for approval in October, and if approved, will be applied to the Transfer Station Gate Fee immediately following January 1st. 2 1 1 1 Page 209 of 800 1 1 1 PASSED AND ADOPTED this 6th day of January 2016, by the following roll call vote: AYES: Councilmember Crane, Mulheren, Doble, Brown, and Scalmanini. NOES: None ABSTAIN: None ABSENT: None ATTEST: Kristine Lawler, City Clerk Stephen G. Scalmanini, Mayor Page 210 of 800 California Environmental Protection Agency Gavin Newsom California Governor Department of Resources Recycling and Recovery Jared Blumenfeld Secretary for Environmental Protection Rachel Machi Wagoner CalRecycle Director April 1, 2021 TO ALL OPERATORS/OWNERS OF SOLID WASTE LANDFILLS Title 27, California Code of Regulations (27 CCR), Division 2, Subdivision 1, Chapter 6, Subchapter 3, Article 1, section 22236, requires you to submit a report annually to the California Department of Resources Recycling and Recovery (CalRecycle). The report calculates the inflationary increase in the closure, postclosure maintenance, and/or corrective action cost estimates for the previous calendar year. Based on information obtained from the U.S. Department of Commerce, Bureau of Economic Analysis, Table 4, dated March 25, 2021 the inflation factor for 2020 is 1.012 (1.2%). Please complete the 2020 Annual Inflation Factor Report for each landfill you own and/or operate, and send it to the Financial Assurances Unit at the following email address by June 1, 2021: FAU@CALRECYCLE.CA.GOV If you would prefer to mail it, please send it to: CalRecycle, Financial Assurances Unit, MS 10A-15, P.O. Box 4025, Sacramento, CA 95812-4025 Previous years’ Inflation Factor Reports can be found at: https://www.calrecycle.ca.gov/SWFacilities/Financial/Bulletins Following are previous years’ inflation factors: 1989 - 1.041 1990 - 1.054 1992 - 1.033 1993 - 1.026 1994 - 1.020 1996 - 1.020 1997 - 1.020 1998 - 1.010 2000 - 1.021 2001 - 1.022 2002 - 1.011 2004 - 1.021 2005 - 1.028 2006 - 1.029 2008 - 1.022 2009 - 1.012 2010 - 1.010 2012 - 1.018 2013 - 1.015 2014 - 1.015 1991 - 1.036 1995 - 1.024 1999 - 1.015 2003 - 1.017 2007 - 1.027 2011 - 1.021 2015 - 1.010 2019 - 1.018 2016 - 1.013 2017 - 1.018 2018 - 1.022 If you have not made the previous years’ adjustments, please do so before calculating the 2021 adjusted total cost estimates. Apply subsequent inflation factors to the previous year’s total cost estimate, beginning with the inflation factor that corresponds with the year the plan was prepared. For example, if the plan was prepared in 1989, apply the 1989 inflation factor to your 1989 initial certified total closure and postclosure maintenance cost estimates and so forth until the current inflation factor is applied. 1001 I Street, Sacramento, CA 95814  P.O. Box 4025, Sacramento, CA 95812 www.CalRecycle.ca.gov  (916) 322-4027 Attachment 2 Page 211 of 800 2 TO ALL OPERATORS/OWNERS OF SOLID WASTE LANDFILLS Do not disregard this notice, if you recently revised your estimates due to changes in your closure, postclosure maintenance and/or corrective action plans, and the revised estimates reflect 2021 dollars. Please report your updated 2021 cost estimates. Information regarding the total and remaining permitted capacity at your landfill(s) should be submitted under a separate mailing. For public operators utilizing a Pledge of Revenue Agreement, the operator is required by 27 CCR section 22233(b)(4)(B) to submit the CalRecycle 114 for m to demonstrate the pledged revenue continues to be available when needed and will cover the postclosure maintenance and/or corrective action cost estimate(s) identified in the updated 2020 Annual Inflation Factor Report required by 27 CCR section 22236. The operator is required to submit annual certifications of the CalRecycle 114 form with the 2020 Annual Inflation Factor Report (copies of the resolution and agreement are not required annually, unless amended). If you have any questions regarding this report, please contact staff of the Financial Assurances Unit identified for your county through the following link: https://www2.calrecycle.ca.gov/SolidWaste/LEA/CalRecycleContacts/ Thank you for your cooperation. Attachment 2 Page 212 of 800 California Environmental Protection Agency Gavin Newsom California Governor Department of Resources Recycling and Recovery Jared Blumenfeld Secretary for Environmental Protection Rachel Machi Wagoner CalRecycle Director ANNUAL INFLATION FACTOR REPORT 2020 FACILITY NAME: FACILITY NO.: 1.) Identify the highest approved or subsequently submitted cost estimate on record and the date of the plan: $ Highest Closure Cost Estimate Approved or Subsequently Submitted Date of Plan $ Highest Postclosure Maintenance Cost Estimate Approved or Subsequently Submitted Date of Plan $ Highest Corrective Action Cost Estimate Approved or Subsequently Submitted Date of Plan 2.) Multiply each cost estimate by the inflation factor to determine the new adjusted cost estimates as illustrated below: The ABC Landfill’s cost estimate for CLOSURE in 2020 was $2,000,000. Using the 2020 inflation factor of 1.012, they recalculated their ADJUSTED CLOSURE COST for 2021 to $2,024,000. Their POSTCLOSURE MAINTENANCE (PCM) COST with a Multiplier of 30 in 2020 was $1,500,000. Using the 2020 inflation factor of 1.012, their ADJUSTED PCM COST for 2021 is $1,518,000. Their cost estimate for CORRECTIVE ACTION in 2020 was $1,000,000. Using the 2020 inflation factor of 1.012, they recalculated their ADJUSTED CORRECTIVE ACTION COST for 2021 to $1,012,000. NOTE: If the cost estimates identified above were prepared in 2021 dollars, do not inflate below. 1001 I Street, Sacramento, CA 95814  P.O. Box 4025, Sacramento, CA 95812 www.CalRecycle.ca.gov  (916) 322-4027 City of Ukiah SW-23-AA-0019 8,748,697 March 2016 5,258,102 March 2016 654,116 March 2016 Attachment 2 Page 213 of 800 Mailing Address Title of Person Signing Phone Number Email Date of Report 300 Seminary Ave, Ukiah, CA 95482 Director of Public Works/City Engineer 707-563-6280 teriksen@cityofukiah.com 9/7/2021 Printed Name of Person Signing Tim Eriksen x 1.012 = $ Estimate in 2021 Dollars $ Closure Costs (2020 Dollars) $ x 1.012 = Annual PCM Costs x PCM Multiplier of 30 or other approved PCM Multiplier (2020 Dollars) $ Estimate in 2021 Dollars x 1.012 = $ Estimate in 2021 Dollars $ Corrective Action Costs (2020 Dollars) Choose Either: Water or Non-Water 11,185,637 7,321,385 989,983 11,319,865 7,409,242 1,001,863 X Attachment 2 Page 214 of 800 Page 1 of 2 Agenda Item No: 7.i. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1056 AGENDA SUMMARY REPORT SUBJECT: Approve Budget Amendment in the Amount of $565,727 for Contract No. 2021-204 with CWS Construction Group for the Electric Service Center Site Work, and Approve the Reset of Staff's 10% Change Order Authority Based on the Revised Contract Amount of $2,963,326.85. DEPARTMENT: Electric Utility PREPARED BY: Cindy Sauers, Electric Utility Director PRESENTER: Consent Calendar ATTACHMENTS: 1. CWS Construction Group - Electric Utility Operation Center Site Work 2021-204 - Signed Contract 2. Spec 16-07 - CCO 1 - Grading at Dump Site_Signed 3. Spec 16-07 - CCO 2 - Water Line, Trellis, Patio, Concrete + Roofing_Signed 4. Spec 16-07 - CCO 3 - AC_AB, Switchgear, Roof Curbs.docx Summary: Council will consider approving a budget amendment in the amount of $565,727 for Contract No. 2021-204 with CWS Construction Group for the Electric Service Center Site Work, and approving the reset of staff's 10% change order authority based on the revised contract amount of $2,963,326.85. Background: On May 5, 2021, the City Council approved the award of contract (Attachment 1) for the Electric Service Center Site Improvements at 1350 Hastings Road for $2,693,933. The project consists of grading and finish improvements, bioswale and retention pond, fencing and roofing for the 2.8 acre property. Phase 2 of the project will include the addition of public solar generation facilities and continued renovation of the existing 15,800 square foot building which will centralize utility operations, construction, engineering and technical services for the Utility. Two change orders that total $52,953 (Change Order 1 - Attachment 2, Change Order 2 - Attachment 3) have been issued for the relocation of a water main, reinforced concrete and additional minor items. Change Order 3 (Attachment 4), still in the process of being fully-executed, increases the site asphalt to a higher traffic index to accommodate the anticipated truck loading and relocation of the electrical switchgear to avoid conflicts during phase 2 of the project. These changes plus dry rot repair on the roof amount to a total for this change order of $179,884.11. The total amount of all three change orders is $232,837.11. Discussion: In the Electric Utility's Capital Improvement Plan for FY 20/21, staff budgeted for the contract amount ($2,693,933.50) plus 10% ($269,393.35) for change orders. However, when the contract was entered into the financial software, the funds to cover change orders were not encumbered and therefore not carried forward to FY 21/22. As a result, staff is requesting a budget amendment in the amount of $269,393.35 for FY 2022 to cover for these change orders. Since the 10% change order threshold amount of the original contract is about to be fully utilized, staff is requesting the reset of staff's 10% change order authority based on the revised contract amount of $2,963,326.85 due to the issuance of Change Orders 1-3. This would then necessitate an additional budget amendment in the amount of $296,333. As a result, the total budget amendment amount requested is Page 215 of 800 Page 2 of 2 $565,727. Recommended Action: Approve budget amendment in the amount of $565,727 for Contract No. 2021-204 with CWS Construction Group for the Electric Service Center Site Work, and approve the reset of staff's 10% change order authority based on the revised contract amount of $2,963,326.85. BUDGET AMENDMENT REQUIRED: Yes CURRENT BUDGET AMOUNT: 80126100.80220.17023; $350,000 PROPOSED BUDGET AMOUNT: 80126100.80220.17023; $915,727 FINANCING SOURCE: 800 Fund PREVIOUS CONTRACT/PURCHASE ORDER NO.: COORDINATED WITH: Mel Grandi, Electric Utility Director; Mary Horger, Financial Services Manager Page 216 of 800 Page 217 of 800 Page 218 of 800 Page 219 of 800 Page 220 of 800 Page 221 of 800 Page 222 of 800 Page 223 of 800 Page 224 of 800 Page 225 of 800 Page 1 of 2 Agenda Item No: 7.j. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1059 AGENDA SUMMARY REPORT SUBJECT: Adoption of Resolution Approving the Application to the CA State Parks Outdoor Equity Grant Program. DEPARTMENT: Community Services PREPARED BY: Neil Davis, Community Services Director PRESENTER: Consent Calendar ATTACHMENTS: 1. Proposed Resolution Summary: Council will consider the adoption of a resolution for approving an application to the CA State Parks Outdoor Equity Grant Program. Background: In 2019, the Outdoor Equity Grants Program (OEP) was enacted when Governor Gavin Newsom signed Assembly Bill 209 (AB 209). On July 1, 2020, the California Legislature authorized funding for OEP. OEP will increase the ability of residents in underserved communities, with an emphasis on students eligible for free or reduced-price meals, foster youth, and students of limited English proficiency, to participate in outdoor experiences at state parks and other public lands. OEP’s focus is on providing funding for transportation, logistics, program operations, and capacity costs associated with reaching historically underserved urban and rural communities throughout California. OEP grants will improve the health and wellness of Californians through new educational and recreational activities, service learning, career pathways, and leadership opportunities that strengthen a connection to the natural world. Discussion: Staff have met with Ukiah Vecinos en Accion and the Equity and Diversity Committee seeking input on the potential benefit of this grant program and guidance on project development. Both entities affirmed the potential benefit of obtaining this funding. The grant application is due on October 8th and requires staff to seek community input on program structure and content. Staff has begun developing the grant application outreach programs. Although the exact details are still in development, if funding is obtained, the program will likely involve hiring a full-time staff member for a period of approximately three years. This employee would report to the Director of Community Services or designee and would be responsible for developing educational content and leading classes, activities, and outings. Staff anticipates all program costs to be covered by the grant funds. Adoption of this Authorizing Resolution (Attachment 1) will allow staff to move forward in developing a proposal and applying for these funds. Recommended Action: Adopt Resolution approving an application to the CA State Parks Outdoor Equity Grant Program. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A Page 226 of 800 Page 2 of 2 COORDINATED WITH: N/A Page 227 of 800 RESOLUTION NO. 2021-XXXX RESOLUTION OF THE CITY COUNCIL OF THE CITY OF UKIAH APPROVING THE APPLICATION FOR OUTDOOR EQUITY GRANTS PROGRAM GRANT FUNDS WHEREAS, the State Department of Parks and Recreation has been delegated the responsibility by the Legislature of the State of California for the administration of the Outdoor Equity Grants Program, setting up necessary procedures governing the application; and WHEREAS, said procedures established by the State Department of Parks and Recreation require the Applicant to certify by resolution the approval of the application before submission of said application to the State; and WHEREAS, successful Applicants will enter into a contract with the State of California to complete the Grant Scope program. NOW, THEREFORE BE IT RESOLVED, that the (Applicant’s Governing Body) hereby: APPROVES THE FILING OF AN APPLICATION FOR THE (NAME OF PROPOSAL); AND 1.Certifies that said Applicant has or will have available, prior to commencement of any work on the program(s) included in this application, the sufficient funds to complete the program(s); and 2.Certifies that if the grant is awarded, the Applicant has or will have sufficient funds to operate the program(s) as described in the Grant Selection Criterion response, and 3.Certifies that the Applicant has reviewed, understands, and agrees to the General Provisions contained in the contract shown in the Grant Administration Guide; and 4.Delegates the authority to City Manager to conduct all negotiations, sign and submit all documents, including, but not limited to applications, agreements, amendments, and payment requests, which may be necessary for the completion of the Grant Scope; and 5.Agrees to comply with all applicable federal, state and local laws, ordinances, rules, regulations and guidelines. 6.Will consider promoting inclusion per Public Resources Code §80001(b)(8 A-G). APPROVED and ADOPTED the 15th day of September, 2021. I, the undersigned, hereby certify that the foregoing Resolution Number was duly adopted by the (Applicant’s Governing Body) following a roll call vote: AYES: NOES: ABSENT: ABSTAIN: _______________________________ Juan V. Orozco, Mayor ATTEST: _______________________________ Kristine Lawler, City Clerk ATTACHMENT 1 Page 228 of 800 Page 1 of 2 Agenda Item No: 7.k. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1060 AGENDA SUMMARY REPORT SUBJECT: Consideration and Action Regarding Recommendation to Reject All Bids Received for Specification No. E38915 Percolation Ponds 1-3 Scarification for the Waste Water Treatment Plant. DEPARTMENT: Finance PREPARED BY: Mary Williamson, Buyer II PRESENTER: Consent Calendar ATTACHMENTS: 1. Percolation Ponds 1-3 Scarafication-ASR 2. Ghilotti Construction Quote Summary: City Council will consider Staff's recommendation to reject all bids received for Specification No. E38915 Percolation Ponds 1-3 Scarification. Background: A Request for Bid was released on August 18, 2021, for Specification No. E38915 Percolation Ponds 1-3 Scarification for the City of Ukiah Waste Water Treatment Plant. Please refer to Attachment 1 for a copy of the Bid documents. Bids were due on September 7, 2021, with only one bidder responding. Please refer to Attachment 2 for a copy of the bid. Discussion: Staff is recommending the City Council reject this bid at this time. The rejection is based on the fact that only one bid was received and it was nearly double what this project cost was less than a year ago. The previous price paid for all three ponds was $34,270; therefore, Staff is not convinced that the City received a competitive price with only the one bid received. In the bid documents, page 3, VIII Terms states, "The City reserves the right to reject any or all bids." Staff will issue a notice to the bidder of it's intention to recommend Council reject all bids. It is Staff’s recommendation to reject all bids, and instruct Staff to rebid the work. Staff will review the existing specifications for revisions to provide additional clarifications if necessary, and rebid as soon as possible. Recommended Action: Consideration and Action Regarding Recommendation to Reject All Bids Received for Specification No. E38915 Percolation Ponds 1-3 Scarification. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: 84027225.52100: $220,622 PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Mary Horger, Financial Services Manager; Alan Hodge, WWTP/Recycled Water Supervisor Page 229 of 800 Page 2 of 2 Page 230 of 800 DATE:8/18/2021 Bids may be emailed, faxed, or hand delivered, to the contact information listed REQ. NO.E38915 herein, and by the specified deadline, or the bid will be rejected. BIDS WILL BE RECEIVED UNTIL Submitted by:2:00 p.m., September 7,2021 (Company Name AT THE OFFICE OF THE BUYER II & Address)1320 AIRPORT ROAD, CITY of UKIAH BY:Mary Williamson Email: mwilliamson@cityofukiah.com BIDS ARE REQUESTED FOR THE FOLLOWING ITEMS: QUANTITY DESCRIPTION UNIT PRICE EXTENDED PRICE All labor, materials and equipment including any incidentals for the deep ripping - and cross ripping - of all 3 Percolation Ponds at the Wastewater Treatment Plant as per details from Specification #E38915. 1-Lump Sum Pond #1 - Middle Pond 1-Lump Sum Pond #3 - North Pond 1-Lump Sum Pond #2 - South Pond - To be done last - when pond has drained Payment Terms:N30 1. LOCAL PREFERENCE: Local Vendors shall be given an allowance of five percent (5%), up to a maximum allowance of $2,500, on any bid for supplies, equipment and/or materials per Ukiah City Code Section 1522.D.4. A Local Vendor is defined as one which, 1) conducts business in an office or other business premises with a physical location in Mendocino County, 2) holds a valid business license issued by Mendocino County or one of the cities in Mendocino County for that business location, and 3) has conducted business in compliance with 1) and 2) for not less than six (6) months prior to requesting the preference. The City shall receive satisfactory proof that a business qualifies as a local vendor before it may receive the local preference. In the event that there is a tie bid, where one bidder is local, the other is not, and the bid is equal in price and quality, the award shall go to the Local Vendor. 2. Right is reserved to reject any and all bids. 3. Right is reserved to accept separate items unless specifically denied by bidder. 4. Right is reserved to reject a bid from any bidder who has previously failed to perform adequately for the City of Ukiah. 5. In CASE OF DEFAULT, the City of Ukiah may procure the items quoted on from other sources and hold the original bidder liable for any increased costs. 6. The price, terms, delivery point, and delivery date may individually or collectively be the basis of the awarding of the bid. 7. In submitting the bid, bidder agrees that the bid shall remain open and may not be revoked or withdrawn for 60 days from the bid due date, unless a different time period is specified in RFB. 8. Bidder agrees to perform according to its bid, if the City's acceptance is communicated to the bidder within the time specified in number 7 above. DATE: PHONE: LEAD TIME ARO : EMAIL: SIGNATURE: PRINT NAME: TERMS: REQUEST FOR BID UKIAH, CALIFORNIA 95482 P: (707) 467-5777, 1320 AIRPORT ROAD PAGE 1 OF 1 ALL BIDS SHALL BE F.O.B. UKIAH, CA. Attachment 1 Page 231 of 800 REQUEST FOR BID City of Ukiah SPECIFICATION #E38915 Percolation Ponds 1-3 Scarification August 19, 2021 Bid Due Date 2:00 PM, SEPTEMBER 7, 2021 Page 232 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 2 I. Introduction City of Ukiah is seeking bids from qualified Contractors for deep ripping scarification of the three percolation ponds at the Wastewater Treatment Plant, located at 300 Plant Road, Ukiah, California 95482. II.Bid Procedure PLEASE TAKE NOTICE: This Request for Bid (RFB) is issued as an open market purchase under Section 1522 of the Ukiah City Code. This is not a formal or informal bid under the provisions of state law governing RFB’s for Public Projects. The procedures governing open market purchases are at the discretion of the Purchasing Officer and may vary from bid to bid, depending on the City’s needs. The City Code encourages the Purchasing Officer to use modern communications, including the telephone, e-mail and the internet, to obtain the lowest possible price, consistent with the City’s needs. The Purchasing Officer does use City bidder’s lists when soliciting bids. You may contact the Purchasing Officer if you would like to be placed on the City’s bidder’s list. III.Contact Person The City has designated Mary Williamson, Buyer II, as the contact person for questions related to the work requested. Questions are to be submitted in writing, and can be done so by e-mail at mwilliamson@cityofukiah.com. IV.Examination of the Site The Contractor should familiarize himself with the local conditions of the project sites, and shall be responsible for having acquired full knowledge of the job and all problems affecting it. Failure to do so will in no way relieve him/her of the responsibility for performing any of the work or operations required as part of this contract. V. Bid Submittal Instructions Bids can be submitted in hardcopy, fax, or by email. Bids are due on or before 2:00 PM, September 7, 2021 to: City of Ukiah Purchasing Department Attn: Mary Williamson 1320 Airport Road Phone: (707) 467-5777 Email: mwilliamson@cityofukiah.com It will be the sole responsibility of the bidders to have their bids delivered to the City before the closing hour and date. Late bids will not be considered and will be returned unopened to the sender. The City will not be responsible for any cost incurred by the Contractor in preparation of their bid response. VI.Scope of Work The City of Ukiah is soliciting bids to deep scarify (rip) - and cross scarify - three percolation ponds at the Wastewater Treatment Plant. The Contractor will be responsible for providing all labor, materials and equipment, including any an all incidentals, necessary for the completion of the work. Pond #1 (Middle Pond) and Pond #3 (North Pond) would be completed first. With Pond #2 (South Pond) to be completed at a later date, when dry. Page 233 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 3 Bids will be for all 3 ponds but will be separate line items. •See Attachment A for pond locations. Size of each Pond us approximately 1850 feet long by 352.5 feet wide (dimensions average, as each pond isn’t exactly rectangular) The Contractor shall utilize ripping tip extensions, on their equipment, that are specifically designed for the deep penetration scarifying of the percolation ponds. In order to ensure effective percolation, the deep scarification shall penetrate the bottom soils of the pond at a range no less than 40 inches below the top surface of the subject soils. Each pass needs to overlap one-half the width of the previous pass. Cross scarifying to be at approximately 90 degrees to the long previous passes. The Contractor is to conduct the work in such a way to keep the dust to a minimum and shall take any measures required by the local Air Quality Management authorities to control fugitive dust. On a daily basis, the Contractor shall keep the site of work and adjacent premises safe and as free from material, debris, and rubbish as practical. Contractor shall confine equipment operation to the pond bottom, access the ponds only at designated point(s), and avoid damage to levee slopes. VII.Pricing Lump sum pricing is requested for each pond separately, and shall include all operational costs, materials, fees (such as move-in, move-out fees), and any incidentals necessary for the completion of the work as described in this bid request. VIII.Terms The City asks that vendors specify their desired payment preferences in their bid response. The actual payment terms of the contract will be open for negotiation during the contract phase. If no special payments are requested prior to issuing the work, the City will assume net 30 terms. The City reserves the right to award to the lowest, responsible bidder. The City also reserves the right to waive any irregularities and technicalities and request rebids should it be deemed in its best interests to do so. The price, terms, delivery point, and delivery date may individually or collectively be the basis of the awarding of the bid. In addition, the City reserves the right to make the selection of specific parts of a bid, or multiple proposals that will best meet the needs of the City as defined in this RFB. In addition, the City reserves the right to reject any or all bids. The awarded contractor will enter a “Short Form Construction Contract”, Attachment B. IX.Addenda If it becomes necessary to revise any part of this Request for Bid (RFB) after it has been issued, the City will issue an addendum to the RFB containing the revision. All addenda will be posted on the City’s website at www.cityofukiah.com/purchasing with the rest of the RFB documents. Anyone who intends to submit a bid in response to the RFB must check the website frequently for any posted addenda. Anyone submitting a bid will be deemed to have seen and agreed to be bound by the posted addenda. Page 234 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 4 X. Warranty Unless otherwise indicated, the Contractor must provide a 1 year workmanship warranty from the date of final acceptance. The Contractor shall replace promptly and at his own expense any materials and/or workmanship which fail during this warranty period. XI.Bidder Qualifications The City will satisfy itself that the potential contractors are reputable firms with a proven track record and a proven product. Contractors are asked to provide the information requested under Work Performance History Capability. References are to be those who you have performed similar scope of work as asked for in this RFB. References are to include the contact name and phone number. A minimum of three references are requested. XII.Insurance Requirements Bidder’s attention is directed to the insurance requirements – see Attachment C. Contractors shall furnish to the City, upon award of contract, certificates of insurance covering full liability under Worker’s Compensation laws of the State of California, Comprehensive General Liability and Business Auto Insurance with policy limits of not less than $1,000,000 naming the City as an additional insured party. It is highly recommended that contractors confer with their respective insurance carriers or brokers to determine in advance of bid submission the availability of insurance certificates and endorsements as prescribed and provided herein. If an apparent awarded contractor fails to comply with the insurance requirements, that contractor may be disqualified from award of the contract. If you have questions regarding the City’s requirements, please contact the City’s Risk Manager at 707-463-6287. XIII.License and Additional Requirements 1)Compliance with Laws and Regulations: All materials, parts and equipment furnished pursuant to these specifications shall be in compliance with the laws and regulations of the State of California and OSHA. The contractor shall, if requested by the City, supply certification and evidence of such compliance. 2)Legal Requirements and Permits: The contractor agrees to fully comply with all local, City, State and Federal laws, regulations and ordinances governing performance of contractual services required, and it will be the responsibility of the contractor to obtain any and all necessary licenses, permits or clearances, including the actual cost of licenses. 3) License Requirements: Bidder/Contractor must possess a current State of California contractor’s license and a City of Ukiah business license. (For information business license, please contact Kathy Norris, City of Ukiah Finance Department at 707-463-6202.) a) The Contractor shall possess a valid State of California Class A or Class C12 license. Bidder shall provide proof of possession of the proper licenses and certificates of registration necessary to perform the work. Employees actually performing the tasks shall provide proof of proper certificates of registration for same. b) The bidder shall keep in force a City of Ukiah business license for the extent of the project. c)Where subcontractors/jobbers are used, bidder shall provide the City with proof of proper licenses, certificates and proof of insurance for work performed. 4)Notice to Bidders – Contractor Registration and Prevailing Wages –No contractor or subcontractor may be listed on a bid proposal for a public works project unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)]. No contractor or subcontractor may be awarded a contract for public work on a public works project unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5. The prime contractor shall be responsible for posting job site notices as prescribed by Page 235 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 5 regulation. This project is subject to compliance monitoring and enforcement by the Department of Industrial Relations. Public Works Small Project Exemption: Small project exemption means that contractors who work exclusively on small projects are not required to register as public works contractors or file electronic certified payroll reports for those projects. However, prevailing wages must still be paid on projects with small project exemption. Contractors are still required to maintain certified payroll records on a continuous basis, and provide those records to the Labor Commissioner’s Office upon request. Small project exemption is applied based on the amount of the entire project, not a contractors subcontracted amount of the project. Small project exemption applies for all public works projects that do not exceed: $25,000 for new construction, alteration, installation, demolition or repair; and $15,000 for maintenance. Each laborer or mechanic of Contractor or any subcontractor engaged in work on the project under this contract shall be paid, pursuant to provisions of Section 1770, including amendments thereof, of the Labor Code of the State of California, the Director of the Department of Industrial Relations, State of California, has ascertained the general prevailing rate of wages for straight time, overtime Saturdays, Sundays and Holidays including employer payment for health and welfare, vacation, pension and similar purposes, copies of the General Prevailing Wage Determination (applicable to the work), for the locality in which the work is to be done can be reviewed at Website: www.dir.ca.gov/dlsr/pwd/northern.html . The Labor Commissioner through the Division of Labor Standards Enforcement (DLSE) may at any time require contractor and subcontractors to furnish electronic certified payroll r ecords directly to DLSE. For projects that do not meet the “Public Works Small Project Exemption”, contractors and subcontractors must furnish electronic certified payroll records directly to the DLSE. Page 236 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 6 INDEMNIFY AND HOLD HARMLESS AGREEMENT Contractor agrees to accept all responsibility for loss or damage to any person or entity, and to defend, indemnity, hold harmless and release the City, its officers, agents and employees, from and against any and all actions, claims, damages, disabilities, or costs of litigation that may be asserted by any person or entity, arising out of or in connection with the negligent or willful misconduct in the performance by contractor hereunder, whether or not there is concurrent, passive or active negligence on the part of the City, but excluding liability due to the sole active negligence or willful misconduct of the City. This indemnification obligation is not limited in any way by any limitation on the amount or type of damages or compensation payable to or for Contractor or its agents under Workmen's Compensation acts, disability benefits acts or other employee's benefits acts. Contractor shall be liable to the City for any loss or damage to City property arising from or in connection with Contractor performance hereunder. The undersigned acknowledges that this document, together with the resulting purchase order issued by the City, the executed Short Form Construction Contract, the insurance requirements for contractors, and the Contractor Statement Regarding insurance coverage comprise a written agreement between the Contractor and the City binding on both parties. The undersigned declares they are familiar with the items specified and have carefully read the RFB specification/requirements, checked all of the figures stated on the specifications and accepts full responsibility for any error or omission in the preparation of this bid. This bid is submitted by, (check one) ____ Individual Owner ____ Partnership ____ Corporation _____ Other Legal Name of Bidder ___________________________________________________________ Address of Bidder ______________________________________________________________ Tax ID# ______________________________________________________________________ Phone Number______________________________ Fax Number ________________________ California State Contractor’s License #: Expiration Date: DIR Public Works Contractor Registration #: By: ______________________________________________ Date _____________________ Signature Print or Type Name: ____________________________________________________________ Title Page 237 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 7 WORK PERFORMANCE DATA HISTORY AND CAPABILITY: Provide the name, locations and a narrative statement on the work performed. WORK PERFORMED 1. COMPANY NAME: ______________________________________ CONTACT:____________________________________________ _______________________________________ ADDRESS:____________________________________________ _______________________________________ PHONE________________________________________________ ________________________________________ 2. COMPANY NAME: _____________________________________________________________________________ CONTACT____________________________________________________________________________________ ADDRESS____________________________________________________________________________________ PHONE:________________________________________________ _______________________________________ 3. COMPANY NAME: _____________________________________ _______________________________________ CONTACT:____________________________________________ _______________________________________ ADDRESS____________________________________________ _______________________________________ PHONE:______________________________________________ _______________________________________ 4. COMPANY NAME: ____________________________________ _______________________________________ CONTACT:___________________________________________ _______________________________________ ADDRESS:___________________________________________ _______________________________________ PHONE:_____________________________________________ _______________________________________ 5.COMPANY NAME: ____________________________________ _______________________________________ CONTACT:___________________________________________ _______________________________________ ADDRESS:___________________________________________ _______________________________________ PHONE:_____________________________________________ _______________________________________ Page 238 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 8 LIST OF PROPOSED SUBCONTRACTORS In compliance with the provisions of Sections 4100-4108 of the California Public Contract Code and any amendments thereof, each bidder shall set forth (a) the name and location of the place of business of each subcontractor who will perform work or labor or render service in or about the construction site or a subcontractor licensed by the State of California who, under subcontract to the prime contractor, specially fabricates and installs a portion of the work or improvement according to detailed drawings contained in the plans and specifications in an amount in excess of one-half of 1 percent of the total bid and (b) the California Contractor License Number for each subcontractor, and (c) the portion of the work to be done by each subcontractor.(See General Conditions Section 1-09.) Include with the name of each sub- contractor their Department of Industrial Relations Public Works Contractor Registration Number . SUBCONTRACTOR NAME SUBCONTRACTOR LICENSE NUMBER SUBCONTRACTOR DIR REGISTRATION NUMBER SUBCONTRACTOR BUSINESS ADDRESS DESCRIPTION OF WORK Page 239 of 800 City of Ukiah SPEC #E38915, Percolation Ponds Scarification-RFB 9 BIDDER/CONTRACTOR STATEMENT REGARDING INSURANCE COVERAGE (Submit with Bid) PROPOSER/CONTRACTOR HEREBY CERTIFIES that he/she has reviewed and understands the insurance coverage requirements specified in the Request for Bid for: __________________SPEC #E38915, Percolation Ponds Scarification__________________ Should we/I be awarded the contract, we/I certify that we/I can meet the specified requirements for insurance, including insurance coverage of the subcontractors, and agree to name the City of Ukiah as Additional Insured for the work specified. And we/I will comply with the provisions of Section 3700 of the Labor Code, which require every employer to be insured against liability for worker’s compensation or to undertake self-insurance in accordance with the provisions of that code, before commencing the performance of the work specified. Please Print (Person, Firm, or Corporation) Signature of Authorized Representative Please Print (Name & Title of Authorized Representative) Date Phone Number Page 240 of 800 Page 241 of 800 Page 242 of 800 S:u\agrtms06\short form construction contract August 19, 2021 1 SHORT FORM CONSTRUCTION CONTRACT Attachment B This Agreement is made and entered on _______, in Ukiah, California, by and between __________, a CA General Partnership [corporation, partnership, sole properietor] ("Contractor") and the City of Ukiah ("City"), a general law municipal corporation. RECITALS: 1. The plans and specifications for this work ("the Work") are contained in Exhibit A – Bid Specification, which is attached hereto and incorporated herein by this reference. 2. Contractor is properly licensed and qualified to perform the work. 3.Whenever this Agreement calls for City approval or notification, the approval or notification must be signed by the City Manager or his or her designee. AGREEMENT: Wherefore, in consideration of the foregoing facts and the terms and conditions as further stated herein, the parties hereby agree as follows. 1. PERFORMANCE OF THE WORK Contractor will perform the Work as further provided herein. 1.1 Time of Performance. Contractor shall commence the Work when receiving a formal Notice to Proceed, and shall complete the Work by no later than _____________________. 1.1.1.  [check if applicable] It is agreed by the parties to the contract that time is of the essence and that, in case all the work is not completed before or upon the expiration of the time limit as set forth, damage, other than those cost items identified in section 1.1.2, will be sustained by the City and that it is and will be impracticable to determine the actual amount of damage by reason of such delay; and it is therefore agreed that, subject to Sections 1.13-1.14, below, the Contractor will pay to the City the sum of five hundred dollars Page 243 of 800 S:u\agrtms06\short form construction contract August 19, 2021 2 ($500.00) per day for each and every calendar day's delay beyond the time prescribed. 1.1.2  [check if applicable] In case the work called for under this contract is not completed within the time limit stipulated herein, the City shall have the right as provided hereinabove, to extend the time of completion thereof. If the time limit be so extended, the City shall have the right to charge to the Contractor and to deduct from the final payment for the work the actual cost to the City of engineering, inspection, superintendence and other overhead expenses which are directly chargeable to the contract and which accrue during the period of such extension, except that the cost of final unavoidable delays shall not be included in such charges. 1.2 Construction of Contract Documents. Contractor will perform the Work in compliance with the plans and specifications set forth in the attached Exhibit A. If there is any inconsistency or conflict between the plans and the specifications, the specifications will prevail. If there is any inconsistency between the plans and the specifications and this agreement, the terms of this Agreement shall prevail, unless expressly stated otherwise in a particular specification. 1.3 Contractor furnished items. Contractor will furnish all necessary labor, materials, tools, equipment, and transportation necessary to perform the Work. 1.4 New SB 854 requirements 1.4.1 No contractor or subcontractor may be listed on a bid proposal for a public works project (submitted on or after March 1, 2015) unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5 [with limited exceptions from this requirement for bid purposes only under Labor Code section 1771.1(a)]. 1.4.2 No contractor or subcontractor may be awarded a contract for public work on a public works project (awarded on or after April 1, 2015) unless registered with the Department of Industrial Relations pursuant to Labor Code section 1725.5. 1.4.3 This project is subject to compliance monitoring and enforcement by the Department of Industrial Relations. 1.4.4 The Labor Commissioner through the Division of Labor Standards Enforcement (DLSE) may at any time require Page 244 of 800 S:u\agrtms06\short form construction contract August 19, 2021 3 contractors and subcontractors to furnish electronic certified payroll records directly to DLSE. Commencing with contracts awarded or after April 1, 2015, all contractors and subcontractors must furnish electronic certified payroll records directly to the DLSE. 1.4.5 The Prime Contractor is required to post job notices at the job site as prescribed by regulations (currently, 8 CCR §16451(d).) 1.5 Use of Employees. 1.5.1. Contractor and any subcontractors shall pay all mechanics and laborers employed by them to work upon the site of the work unconditionally and without subsequent deductions or rebate on any account the full amounts due at the time of payment at wage rates not less than those contained in the applicable prevailing wage determination, regardless of any contractual relationship which may be alleged to exist between the Contractor and subcontractors and such laborers and mechanics. 1.5.2. Contractor shall comply with the California Labor Code Section 1775. In accordance with said Section 1775, Contractor shall forfeit as a penalty to the City, $50.00 for each calendar day or portion thereof, for each workman paid less than the stipulated prevailing rates for such work or craft in which such workman is employed for any work done under the Contract by him or her or by any subcontractor under him or her in violation of the provisions of the Labor Code and in particular, Labor Code Sections 1770 to 1780, inclusive. In addition to said penalty and pursuant to Section 1775, the difference between such stipulated prevailing wage rates and the amount paid to each workman for each calendar day or portion thereof for which each workman was paid less than the stipulated prevailing wage rate shall be paid to each workman by the Contractor. 1.5.3. Pursuant to the provision of Section 1770 of the Labor Code of the State of California, City has ascertained the general prevailing rate of wages (which rate includes employer payments for health and welfare, vacation, pension and similar purposes) applicable to the work to be done, for straight time work. The holiday wage rate listed shall be applicable to all holidays recognized in the collective bargaining agreement of the particular craft, classification, or type of workers concerned. Copies of the General Prevailing Wage Determination are on file in Page 245 of 800 S:u\agrtms06\short form construction contract August 19, 2021 4 the office of the City Engineer and are available to the Contractor on request. The Contractor shall post the wage determination at the site of work in a prominent place where the workers can easily see it. 1.5.4. City will not recognize any claim for additional compensation because the Contractor has paid any rate in excess of the prevailing wage rate obtained from the City Engineer. The possibility of wage increases is one of the elements to be considered by the Contractor in determining his or her bid and will not in any circumstances be considered as the basis for a claim against the City. 1.5.5. Travel and Subsistence Payments. Contractor shall make travel and subsistence payments to each worker needed to execute the work in accordance with the requirements in Section 1773.8 of the Labor Code (Chapter 880, Statutes of 1968). 1.5.6. Apprentices. Attention is directed to the provisions in Sections 1777.5 (Chapter 1411, Statutes of 1968) and 1777.6 of the California Labor Code concerning the employment of apprentices by the Contractor or any subcontractor under him. Contractor and any subcontractor under him or her shall comply with the requirements of said sections in the employment of apprentices. Information relative to apprenticeship standards, wage schedules and other requirements may be obtained from the Director of Industrial Relations, ex officio the Administrator of Apprenticeship, San Francisco, California, or from the Division of Apprenticeship Standards and its branch offices. Copies of Labor Code Sections 1771 (requiring prevailing wages), 1775 (imposing penalties, including a $50 per day, per worker forfeiture, for failure to pay prevailing wages), 1776 (requiring contractor to maintain available for inspection certified payroll records), 1777.5 (requiring certain apprenticeship programs), 1813 (imposing penalties for failure to make records available for inspection) and 1815 (requiring time and ½ for overtime) are available at the Department of Industrial Relations website at http://www.dir.ca.gov/ Page 246 of 800 S:u\agrtms06\short form construction contract August 19, 2021 5 1.6 CITY Inspector. CITY may designate an architect, engineer, other design professional or other inspector ("Inspector") to supervise and/or inspect Contractor's performance of the Work. The Inspector shall have no authority to change the Work, the compensation for performing the Work or the time for completing the Work without City's prior written approval. City shall notify the Contractor in writing, if it designates an Inspector. 1.7 Site Conditions. Contractor acknowledges that it has inspected the work site and any improvements involving the Work and satisfied itself as to the conditions which can affect the Work or its cost. Contractor has not relied on any representation by CITY or its officers or employees as to the condition of the site or the houses or any condition that might affect the cost of performing this Agreement. 1.8 New Products Required. All equipment, materials or fixtures furnished by Contractor under this Agreement shall be new and of the most suitable grade for the intended purpose, unless otherwise specifically provided. 1.9 Compliance with Laws. The Contractor shall give all notices and comply with all applicable laws, ordinances, codes, rules and regulations. The Contractor shall secure and pay for all permits, fees, and licenses necessary for the proper execution and completion of the work. 1.10 Protection of Site and Improvements. The Contractor shall preserve and protect the site, grounds and any involved improvements and shall not alter or damage any portion thereof, except as is absolutely necessary in order to perform the Work. The Contractor shall repair or replace, as directed by CITY, any property that it damages, looses or destroys in violation of this paragraph. Contractor shall assume full responsibility for maintaining the safety of the worksite in compliance with all applicable state and federal worker safety and protection laws and shall maintain the worksite in compliance with all such laws. 1.11 Inspection of Work. The Contractor shall ensure that the Work is available for inspection by CITY or its Inspector at all reasonable times and that no work is covered up or rendered incapable of inspection without prior notice to CITY or its Page 247 of 800 S:u\agrtms06\short form construction contract August 19, 2021 6 Inspector and a reasonable opportunity for inspection. The presence or absence of an CITY inspector or the conduct of an inspection by CITY or its Inspector shall not relieve the Contractor from any contract requirement or compliance with Exhibit A. 1.12 Title. The Contractor warrants that it conveys full and complete title, free of all liens and encumbrances, to all materials, supplies, fixtures and equipment furnished to CITY under this Agreement and agrees to fully defend and indemnify CITY, its officers and employees, and the houses and homebuyers included in the Work from and against any claim, lien, charge, debt, cost, expense or liability arising from a breach of said warranty. 1.13 Warranties. In addition to any other warranties in this contract, the Contractor warrants that the Work conforms to the contract requirements and is free of any defect in equipment, material or workmanship for a period of one year from the date of final acceptance of the Work by CITY. If CITY accepts any part of the Work before final acceptance of the entire Work, the warranty shall continue for the period of one year from the date of such partial acceptance. The Contractor shall remedy, at the Contractor's expense, any failure to conform, or any defect. [Initial if following sentence applies /_/ /_/] CITY shall retain __% of the Contract Amount to secure the Contractor's warranty and shall remit the unused portion of that amount at the end of the warranty period. The time limit of this warranty shall not apply to any latent defects, or gross negligence or fraud on the part of the Contractor. 1.14. Extension of Time. Should any delays occur which the City may consider unavoidable, as herein defined, the Contractor shall, pursuant to his or her application, be allowed an extension of time proportional to said delay or delays, beyond the time herein set forth, in which to complete this contract; and liquidated damages for delay shall not be charged against the Contractor by the City during an extension of time granted because of unavoidable delay or delays. Any claim by Contractor for a time extension based on unavoidable delays shall be based on written notice delivered to the City within 15 days of the occurrence of the event giving rise to the claim. Failure to file said written notice within the time specified shall constitute a waiver of said claim. Notice of the full extent of the claim and all supporting data must be delivered to the City within 45 days of the occurrence unless the City specifies in writing a Page 248 of 800 S:u\agrtms06\short form construction contract August 19, 2021 7 longer period. All claims for a time extension must be approved by the City and incorporated into a written change order. 1.15. Unfavorable Weather and Other Conditions. During unfavorable weather and other conditions, the Contractor shall pursue only such portions of the work as shall not be damaged thereby. No portions of the work whose satisfactory quality or efficiency will be affected by any unfavorable conditions shall be constructed while these conditions remain, unless, by special means or precautions approved by the City, the Contractor shall be able to overcome them. The Contractor shall be granted a time extension of one day for each unfavorable weather day that prevents him or her from placing concrete forms or placing and finishing concrete or asphalt concrete. Such unfavorable weather day is defined as a rain day where precipitation prevents the contractor from performing the work more than four (4) continuous hours within the authorized work period or a temperature day where the ambient temperature is below that specified for the placement of materials associated with the controlling work item for more than four (4) continuous work hours of the authorized work period. 1.16. Saturday, Sunday, Holiday and Night Work. No work shall be done between the hours of 6 p.m. and 7 a.m., nor on Saturdays, Sundays or legal holidays except such work as is necessary for the proper care and protection of work already performed, or except in cases of absolute necessity and in any case only with the permission of the City. It is understood, however, that night work may be established as a regular procedure by the Contractor if he or she first obtains the written permission of the City and that such permission may be revoked at any time by the City if the Contractor fails to maintain at night adequate force and equipment for reasonable prosecution and to justify inspection of the work. 1.17. Hours of Labor. Eight (8) hours of labor shall constitute a legal day's work and the Contractor or any subcontractor shall not require or permit more than eight hours of labor in a day from any person employed by him or her in the performance of the work under this contract, unless paying compensation for all hours worked in excess of eight (8) hours per day at not less than 1 ½ times the basic rate of pay. Page 249 of 800 S:u\agrtms06\short form construction contract August 19, 2021 8 The Contractor shall forfeit to the City, as a penalty, the sum of twenty-five dollars ($25.00) for each workman employed in the execution of the contract by him or her or by any subcontractor, for each calendar day during which such laborer, workman, or mechanic is required or permitted to labor more than eight hours in violation of the provisions of Section 1810 to 1816, inclusive, (Article 3, Chapter 1, Part 7, Division 2) of the Labor Code of the State of California and any acts amendatory thereof. 2. CONTRACT PRICE CITY shall pay the Contractor for performance of this Agreement time and materials with a total not to exceed amount of _______. 3. PAYMENT OF CONTRACT PRICE 3.1 City shall pay any invoice for completed work, and approved by the City, within thirty (30) days of its receipt by City. All payments under this contract shall be made upon the presentation of certificates in writing from the City and shall show that the work covered by the payments has been done and the payments thereof are due in accordance with this contract. 4. INDEMNIFICATION AND INSURANCE. 4.1 Indemnification. The Contractor shall do all of the work and furnish all labor, materials, tools and appliances, except as otherwise herein expressly stipulated, necessary or proper for performing and completing the work herein required in the manner and within the time herein specified. The mention of any specific duty or liability imposed upon the Contractor shall not be construed as a limitation or restriction of any general liability or duty imposed upon the Contractor by this contract, said reference to any specific duty or liability being made herein merely for the purpose of explanation. The right of general supervision by the City shall not make the Contractor an agent of the City and the liability of the Contractor for all damages to persons or to public or private property, arising from the Contractor's execution of the work, shall not be lessened because of such general supervision. Until the completion and final acceptance by the City of all the work under and implied by this contract, the work shall be under Page 250 of 800 S:u\agrtms06\short form construction contract August 19, 2021 9 the Contractor's responsible care and charge. The Contractor shall rebuild, repair, restore and make good all injuries, damages, re- erections and repairs, occasioned or rendered necessary by causes of any nature whatsoever, excepting only acts of God and none other, to all or any portions of the work, except as otherwise stipulated. To the fullest extent permitted by law, Contractor shall indemnify and hold harmless the City and its officers, directors, agents, and employees from and against all claims, damages, losses and expenses including but not limited to attorneys' fees, costs of suit, expert witness fees and expenses and fees and costs of any necessary private investigators arising out of or resulting from the performance of the work, provided that any such claim, damage, loss or expense (1) is attributable to bodily injury, sickness, disease or death, or to injury to or destruction of tangible property, other than the work itself, including the loss of use resulting therefrom and (2) is caused in whole or in part by any act or omission of the Contractor, any subcontractor, or anyone directly or indirectly employed by any of them, or anyone for whose acts any of them may be liable, regardless of whether or not it is caused in part by a party indemnified hereunder, or by the negligence or omission of a party indemnified herein. In any and all claims against the City or any of its agents or employees by any employee of the Contractor, any subcontractor, anyone directly or indirectly employed by any of them, or anyone for whose acts any of them may be liable, the indemnification obligation shall not be limited in any way by any limitation on the amount or type of damages, compensation or benefits payable by or for the Contractor or any subcontractor under workers' or workmen's compensation acts, disability benefit acts, or other employee benefit acts. The obligation to indemnify shall extend to and include acts of the indemnified party which may be negligent or omissions which may cause negligence. The City shall have the right to estimate the amount of such damage and to cause the City to pay the same and the amount so paid for such damage shall be deducted from the money due the Contractor under this contract; or the whole or so much of the money due or to become due the Contractor under this contract as may be considered necessary by the City, shall be retained by the City until such suits or claims for damages shall have been settled or otherwise disposed of and satisfactory evidence to that effect furnished to the City. Page 251 of 800 S:u\agrtms06\short form construction contract August 19, 2021 10 . 4.2 Insurance. Contractor shall procure and maintain for the duration of the contract insurance against claims for injuries to persons or damages to property which may arise from or in connection with the performance of the work hereunder by the Contractor, his or her agents, representatives, employees or subcontractors. 4.2.1. Minimum Scope of Insurance Coverage shall be at least as broad as: 1.Insurance Services Office Commercial Liability Coverage (occurrence form CG 0001). 2.Insurance Services Office form number CA 0001 (Ed. 1/87) covering Automobile Liability, code 1 (any auto). 3.Worker's Compensation insurance as required by the State of California and Employer's Liability Insurance. 4.2.2. Minimum Limits of Insurance Contractor shall maintain limits no less than: 1.General Liability: $1,000,000 per occurrence for bodily injury, personal injury, and property damage. If Commercial General Liability Insurance or other form with a general aggregate limit is used, either the general aggregate limit shall apply separately to this project/location or the general aggregate limit shall be twice the required occurrence limit. 2.Automobile Liability: $1,000,000 per accident for bodily injury and property damage. 3.Employer's Liability:$1,000,000 per accident for bodily injury and property damage. 4.2.3. Deductibles and Self-insured Retentions Any deductibles or self-insured retentions must be declared to and approved by the City. At the option of the City, either: the insurer shall reduce or eliminate such deductibles or self-insured retentions as respects the City, its officers, officials, employees and volunteers; or the Contractor shall provide a financial Page 252 of 800 S:u\agrtms06\short form construction contract August 19, 2021 11 guarantee satisfactory to the City guaranteeing payment of losses and related investigations, claim administration and defense expenses. 4.2.4. Other Insurance Provisions The general liability and automobile liability policies are to contain, or be endorsed to contain, the following provisions: 1.The City, its officers, officials, employees, and volunteers are to be covered as insureds with respect to liability arising out of automobiles owned, leased, hired or borrowed by or on behalf of the contractor; and with respect to liability arising out of work or operations performed by or on behalf of the Contractor including materials, parts or equipment furnished in connection with such work or operations. General liability coverage can be provided in the form of an endorsement to the Contractor's insurance, or as a separate owner's policy. 2.For any claims related to this project, the Contractor's insurance coverage shall be primary insurance as respects the City, its officers, officials, employees, volunteers. Any insurance or self-insurance maintained by the City, its officers, officials, employees, or volunteers, shall be excess of the Contractor's insurance and shall not contribute with it. 3.Each insurance policy required by this clause shall be endorsed to state that coverage shall not be canceled by either party, except after thirty (30) days' prior written notice by certified mail, return receipt requested, has been given to the City. 4.2.5. Acceptability of Insurers Insurance is to be placed with admitted California insurers with an A.M. Best's rating of no less than A- for financial strength, aa for long-term credit rating and AMB-1 for short-term credit rating. 4.2.6. Verification of Coverage Contractor shall furnish the City with original certificates and amendatory endorsements effecting coverage required by this clause. The endorsements shall Page 253 of 800 S:u\agrtms06\short form construction contract August 19, 2021 12 be on forms provided by the City or on other than the City's forms, provided those endorsements or policies conform to the requirements. All certificates and endorsements are to be received within 15 days from written notice of contract award, and the work shall not commence until the certificates and endorsements have been approved by the City. The City reserves the right to require complete certified copies of all required insurance policies, including endorsements effecting the coverage required by these Special Provisions at any time. 4.2.7. Subcontractors Contractor shall include all subcontractors as insureds under its policies or shall furnish separate certificates and endorsements for each subcontractor. All coverages for subcontractors shall be subject to all of the requirements stated herein. 5. TERMINATION. This Agreement may only be terminated by City: 1) for breach of the agreement; 2) because funds are no longer available to pay Contractor for services provided under this Agreement; or 3) City has abandoned and does not wish to complete the project for which Contractor was retained. City shall notify Contractor of any alleged breach of the agreement and of the action required to cure the breach. If Contractor fails to cure the breach within the time specified in the notice, the contract shall be terminated as of that time. If terminated for lack of funds or abandonment of the project, the contract shall terminate on the date notice of termination is given to Contractor. City shall pay the Contractor only for services performed and expenses incurred as of the effective termination date, unless terminated because the Contractor has failed to satisfactorily cure a breach after notice in which event City shall: a. retain any amounts earned under the Contract but not yet paid by City; b. take possession of all material and fixtures on the job site; c. have the right to complete the Work and recover from Contractor any increased cost to complete the Work above the amounts Page 254 of 800 S:u\agrtms06\short form construction contract August 19, 2021 13 that would have been paid to Contractor hereunder, together with any other damages suffered by City as a result of said breach. 6.MODIFICATION OF AGREEMENT. City may, from time to time, request changes in the Work, the time to complete the work or the compensation to be paid for the Work. Such changes must be incorporated in written amendments to this Agreement. To be effective, all such changes as referred to in this section must be agreed upon in writing by both parties to this agreement. 7. ASSIGNMENT. The Contractor shall not assign any interest in this Agreement, and shall not transfer any interest in the same (whether by assignment or novation), without the prior written consent of City. 8.APPLICATION OF LAWS. The parties hereby agree that all applicable Federal, State and local rules, regulations and guidelines not written into this Agreement shall hereby prevail during the period of this Agreement. 9.INDEPENDENT CONTRACTOR. It is the express intention of the parties hereto that Con- tractor is an independent contractor and not an employee, joint venturer, or partner of City for any purpose whatsoever. City shall have no right to, and shall not control the manner or prescribe the method of accomplishing those services contracted to and performed by Contractor under this Agreement, and the general public and all governmental agencies regulating such activity shall be so informed. Those provisions of this Agreement that reserve ultimate authority in City have been inserted solely to achieve compliance with federal and state laws, rules, regulations, and interpretations thereof. No such provisions and no other provisions of this Agreement shall be interpreted or construed as creating or establishing the relationship of employer and employee between Contractor and City. Page 255 of 800 S:u\agrtms06\short form construction contract August 19, 2021 14 Contractor shall pay all estimated and actual federal and state income and self-employment taxes that are due the state and federal government and shall furnish and pay worker's compensation insurance, unemployment insurance and any other benefits required by law for himself and his employees, if any. Contractor agrees to indemnify and hold City and its officers, agents and employees harmless from and against any claims or demands by federal, state or local government agencies for any such taxes or benefits due but not paid by Contractor, including the legal costs associated with defending against any audit, claim, demand or law suit. Contractor warrants and represents that it is a properly licensed for the work performed under this Agreement with a sub- stantial investment in its business and that it maintains its own offices and staff which it will use in performing under this Agreement. 10.GOVERNING LAW. This Agreement shall be governed by and construed in accordance with the laws of the State of California and any legal action concerning the agreement must be filed and litigated in the proper court in Mendocino County, each party consenting to jurisdiction and venue of California state courts in Mendocino County. 11. SEVERABILITY. If any provision of the Agreement is held by a court of com- petent jurisdiction to be invalid, void, or unenforceable, the remaining provisions shall nevertheless continue in full force and effect without being impaired or invalidated in any way. 12. INTEGRATION. This Agreement, including the exhibits attached hereto, contains the entire agreement among the parties and supersedes all prior and contemporaneous oral and written agreements, understandings, and representations among the parties. No amendments to this Agreement shall be binding unless executed in writing by all of the parties. 13. WAIVER. No waiver of any of the provisions of this Agreement shall be Page 256 of 800 S:u\agrtms06\short form construction contract August 19, 2021 15 deemed, or shall constitute a waiver of any other provision, nor shall any waiver constitute a continuing waiver. No waiver shall be binding unless executed in writing by the party making the waiver. 14. NOTICES. Whenever notice, payment or other communication is required or permitted under this Agreement, it shall be deemed to have been given when personally delivered, emailed, telefaxed or deposited in the United States mail with proper first class postage affixed thereto and addressed as follows: CONTRACTOR CITY _____________ City of Ukiah _____________ 300 Seminary Ave. _____________ Ukiah, CA. 95482 Email: Email: FAX: FAX: Service by telefax shall bear a notation of the date and place of transmission and the facsimile telephone number to which transmitted. Either party may change the address to which notices must be sent by providing notice of that change as provided in this paragraph. 15.PARAGRAPH HEADINGS. The paragraph headings contained herein are for convenience and reference only and are not intended to define or limit the scope of this agreement. 16.EXECUTION OF AGREEMENT. This Agreement may be executed in duplicate originals, each bearing the original signature of the parties. Alternatively, this Agreement may be executed and delivered by facsimile or other electronic transmission, and in more than one counterpart, each of which shall be deemed an original, and all of which together shall constitute one and the same instrument. When executed using either alternative, the executed agreement shall be deemed an original Page 257 of 800 S:u\agrtms06\short form construction contract August 19, 2021 16 admissible as evidence in any administrative or judicial proceeding to prove the terms and content of this Agreement. WHEREFORE, the parties have entered this Agreement on the date first written above. CONTRACTOR CITY OF UKIAH By:___________________________ By:___________________________ Sage Sangiacomo City Manager California Contractor's License Number __________ [Number or N/A] Page 258 of 800 Rev: 11/20/08 Page 1 of 2 ATTACHMENT CINSURANCE REQUIREMENTS FOR CONTRACTORS Contractor shall procure and maintain for the duration of the contract insurance against claims for injuries to persons or damages to property which may arise from or in connection with the performance of the work hereunder by the Contractor, his agents, representatives, employees or subcontractors. I. Minimum Scope of Insurance Coverage shall be at least as broad as: A. Insurance Services Office Commercial General Liability coverage (Form No. CG 20 10 10 01 and Commercial General Liability – Completed Operations Form No. CG 20 37 10 01). B. Insurance Services Office form number CA 0001 (Ed. 1/87) covering Automobile Liability, code 1 (any auto). C. Worker’s Compensation insurance as required by the State of California and Employer’s Liability Insurance. II.Minimum Limits of Insurance Contractor shall maintain limits no less than: A. General Liability: $1,000,000 per occurrence for bodily injury, personal injury and property damage including operations, products and completed operations. If Commercial General Liability Insurance or other form with a general aggregate limit is used, either the general aggregate limit shall apply separately to this project/location or the general aggregate limit shall be twice the required occurrence limit. Insurance must be written on an occurrence basis. B. Automobile Liability: $1,000,000 per accident for bodily injury and property damage. Insurance must be written on an occurrence basis. C. Worker’s Compensation Employer’s Liability: $1,000,000 per accident for bodily injury or disease. III.Deductibles and Self-Insured Retentions Any deductibles or self-insured retentions must be declared to and approved by the City. The City may require the insurer to reduce or eliminate such deductibles or self-insured retentions with respect to the City, its officers, officials, employees and volunteers; or the Contractor to provide a financial guarantee satisfactory to the City guaranteeing payment of losses and related investigations, claim administration and defense expenses; or to approve the deductible without a guarantee. IV.REQUIRED Insurance Provisions Proof of general liability and automobile liability policies are to contain, or be endorsed to contain, the following provisions: A. The City, its officers, officials, employees, and volunteers are to be covered as ADDITIONAL INSURED with respect to liability arising out of automobiles owned, leased, hired or borrowed by or on behalf of the contractor; and with respect to liability arising out of work or operations performed by or on behalf of the Contractor including materials, parts or equipment, furnished in connection with such work or operations. General liability coverage can be provided in the form of an endorsement to the Contractor’s insurance, or as a separate owner’s policy. B. The workers’ compensation policy is to be endorsed with a waiver of subrogation. The insurance company, in its endorsement, agrees to waive all rights of subrogation against the City, its officers, officials, employees and volunteers for losses paid under the terms of this policy which arises from the work performed by the named insured for the City. NOTE: You cannot be added as an additional insured on a workers’ compensation policy. C. For any claims related to this project, the Contractor’s insurance coverage shall be primary insurance with respect to the City, its officers, officials, employees, and volunteers. Any insurance or self-insurance maintained by the City, its officers, officials, employees, or volunteers shall be in excess of the Contractor’s insurance and shall not contribute with it. Page 259 of 800 Rev: 11/20/08 Page 2 of 2 D. Each insurance policy required by this clause shall be endorsed to state that coverage shall not be canceled by either party, except after thirty (30) days’ prior written notice by certified mail, return receipt requested, has been given to the City. E. Note: (This protects the Contractor) -Coverage shall not extend to any indemnity coverage for the active negligence of the additional insured in any case where an agreement to indemnify the additional insured would be invalid under Subdivision (b) of Section 2782 of Civil Code. V. RATING - Acceptability of Insurers Insurance is to be placed with admitted California insurers with a current A.M. Best’s rating of no less than A- for financial strength, AA for long-term credit rating and AMB-1 for short-term credit rating. VI.Verification of Coverage Contractor shall furnish the City with original certificates and amendatory endorsements affecting coverage required by this clause. The endorsements should be on forms provided by the City. If endorsements are on forms other than the City’s forms, those endorsements or policies must provide coverage that is equivalent to or better than the forms requested by the City. All certificates and endorsements are to be received and approved by the City before work commences. The City reserves the right to require complete, certified copies of all required insurance policies, including endorsements affecting the coverage required by these specifications at any time. VII.Subcontractors Contractor shall include all subcontractors as insured under its policies or shall furnish separate certificates and endorsements for each subcontractor. All coverage for subcontractors shall be subject to all of the requirements stated herein. If you have questions regarding our insurance requirements contact: Risk Manager (707) 463-6287 FAX (707) 463-6204 Page 260 of 800 Attachment 2 Page 261 of 800 Page 262 of 800 Page 263 of 800 Page 264 of 800 Page 265 of 800 Page 266 of 800 Page 267 of 800 Page 268 of 800 Page 269 of 800 Page 270 of 800 Page 271 of 800 Page 272 of 800 Page 273 of 800 Page 274 of 800 Page 275 of 800 Page 1 of 4 Agenda Item No: 11.a. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1046 AGENDA SUMMARY REPORT SUBJECT: Consideration of the Planning Commission's Recommendation to 1) Adopt an Initial Study and Mitigated Negative Declaration (SCH No.2021040428); 2) Conditionally Approve the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project; and 3) Introduce by Title Only an Ordinance to Prezone the Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1- H” Single Family Residential-Hillside Overlay District. File No.: 20-5915. DEPARTMENT: Community Development PREPARED BY: Michelle Irace, Planning Manager, Maya Simerson, Project & Grant Administrator PRESENTER: Craig Schlatter, Community Development Director; Michelle Irace, Planning Manager; and Maya Simerson, Project Administrator ATTACHMENTS: 1. Figures & Maps for Western Hills Open Land Acquisition & Limited DA 2. 2021-08-25 PC Hearing Staff Report_Western Hills Open Land Acquisition & Limited DA 3. 2021-08-25 PC Minutes Draft 4. Draft Conditions of Approval_Western Hills Open Land Acquisition Limited DA 5. Draft Findings_Western Hills Open Land Acquisition Limited DA 6. Draft Ordinance for Prezoning_Western Hills Open Land Acquisition & Limited DA 7. Final Draft ISMND 081621_Western Hills Open Land Acquisition & Limited DA 8. 11a Correspondence Received - Margo Frank 9. 11a Correspondence Received - Vishnu 10. 11a Correspondence Received - Daphne Macneil 11. 11a Correspondence Received - Jeanne Chinn 12. 11a Correspondence Received - Bonnie Tillotson 13. 11a Correspondence Received - Eileen Mitro 14. 11a Correspondence Received - Sharon Kiichli 15. 11a Correspondence Received - Sharron Thomas 16. 11a Correspondence Received - Ulla Brunnberg Rand 17. 11a Correspondence Received - Katherine McElwee 18. 11a Correspondence Received - Catherin Lair 19. 11a Presentation Given at Meeting Summary: City Council will conduct a public hearing and consider the Planning Commission's recommendation to 1) Adopt an Initial Study and Mitigated Negative Declaration; 2) Conditionally approve the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project; and 3) Introduce by Title only the Ordinance to prezone the Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1-H” Single Family Residential-Hillside Overlay District. Background: The City has a vision, through the City Council's Strategic Plan, and is working towards a goal of promoting the protection of Ukiah’s western urban interface to restore and conserve forest and stream ecosystems, provide large-scale wildfire mitigation and to protect the Upper Russian River Watershed to benefit fish, wildlife and the greater Ukiah community. Towards achievement of this goal, the City proposes to acquire and annex approximately 707 acres in the Western Hills, if available, for open space preservation Page 276 of 800 Page 2 of 4 while allowing the potential for future low-density residential development on the approximately 54 easternmost acres, consistent with existing development in the Hillside District of the Western Hills within the City of Ukiah limits. Parcels to be annexed may include: the “Hull Properties” (APNs 001-040-83, 157-070-01, 157-070-02, 003-190-01, 157-050-09, 157-060-02, 157-050-02, 157-050-04, 157-050-01, 157-030-02, 157- 030-03, 157-050-11 & 157-050-12); “Noguera Properties” (APNs 003-190-09 & 003-110-90); and the City- owned “Donation Parcel” (APNs 157-050-03,157-060-003). Please refer to Attachment 1 for the project figures and maps, including a location map. Under the County of Mendocino’s jurisdiction, portions of the Project sites, specifically the proposed Development Parcels, have been under consideration for development for the past several years, as Mr. Hull intended to develop portions with residential development at some point in the future. These improvements were not completed in relation to the Proposed Project, or in coordination with the City of Ukiah. The City’s involvement with the property included efforts to secure grant funding in the Fall of 2018 (California Dept. of Fish and Wildlife grant application for $8,219,323) and the Fall of 2019 (California Dept. of Fish and Wildlife grant application for $4,592,350) for acquisition of the entire project site, but these efforts were unsuccessful. In the meantime, the property owner held the property for the possible grant acquisition but also continued property improvements during that time. After the City's most recent unsuccessful grant application and as the City had begun to review other solutions to acquiring the property, the City was approached by Mr. Hull. The project evolved into the project description included in the Initial Study and Mitigated Negative Declaration (ISMND) under consideration. To complete the acquisition, the City would need to enter into a Property Exchange and Development Agreement (“Development Agreement”) with the current owner of the Hull Properties subject to the annexation application. At this time the proposed development agreement and road access agreement are still under active negotiations and have not been finalized. This Project is a multi-faceted project that includes several steps and approvals. In order to submit the application for annexation to the County of Mendocino Local Agency Formation Commission (LAFCo), the City must obtain Council approval of the overall Project, and complete the negotiations and agreements in addition to the Project environmental review. As such, Staff recommends the approval and adoption of the ISMND, ordinance for prezoning and approval of the overall Proposed Project as the first step in this process. Next, if and when the negotiations for the agreements are completed, they will be presented to Council for consideration. If approved, the Project may move forward and the City may submit its application for annexation to LAFCo at that time. At their August 25, 2021 regular meeting, the Planning Commission considered the ISMND, the ordinance to establish prezoning, and the overall Proposed Project and made a recommendation of approval for these actions to the City Council. The Planning Commission Staff Report, dated August 16, 2021, is included as Attachment 2. For brevity, the attachments to the Planning Commission Staff Report have been omitted but can be found online at https://ukiahca.civicclerk.com/Web/Player.aspx?id=1113&key=-1&mod=-1&mk=- 1&nov=0 which is accessed through the City’s City Council and Planning Commission agenda and minutes page at: http://www.cityofukiah.com/meetings/. Draft Minutes of the August 25, 2021, Planning Commission hearing are included as Attachment 3. Correspondence received for the Planning Commission hearing can also be found at the aforementioned link. Discussion: The Ukiah City Code (UCC) places the authority for adoption of the Initial Study and Mitigated Negative Declaration (ISMND), adoption of an ordinance for prezoning, as well as approval of the overall Proposed Project, including acquisition and annexation, prezoning, Lot Line Adjustments, Development Agreement, and associated site improvements with the City Council. With the exception of the ISMND, the Development Agreement, and the Road Access and Maintenance Agreement, each of the Project components requires further approval by other entities. Specifically, the annexation and prezoning require LAFCo approval and the Lot Line Adjustments for parcels within the City’s jurisdiction require approval by the City Engineer. Similarly, construction of future single-family homes on all Development Parcels requires approval of Building Permits, and under the Development Agreement, construction of homes within Development Parcels 4-7 requires approval of a Use Permit by the Planning Commission. Page 277 of 800 Page 3 of 4 The “Proposed Project” includes the following: 1) Acquisition and annexation of the parcels; 2) Prezoning the parcels to “PF” Public Facilities, and “R1-H” Single-family Residential-Hillside Overlay (and associated Zoning Map and General Plan Map Amendments upon approval of the annexation application); 3) Sequential Lot Line Adjustments to reconfigure the existing parcels into seven lots (“Development Parcels”) for future potential development; 4) Development Agreement between Hull Properties and the City allowing up to one single- family home and one accessory dwelling unit on each Development Parcel (up to 14 units total); and 5) site improvements including extension of utilities, road improvements, and construction of the water storage tank(s). Each of the Project components are discussed in detail in the Planning Commission Staff Report (see Attachment 2 and the link provided above). Project Figures and Maps, including a location map (Figure 1), the existing parcel configuration (Figure 2), the proposed resulting parcel configuration and prezoning (Figure 3), existing zoning designations (Figure 4), and existing General Plan land use designations (Figure 5) as well as existing site photographs (Figures 6, 7, and 8) are included in Attachment 1 to this report. In accordance with the California Environmental Quality Act (CEQA), the Planning Division of the City of Ukiah Community Development Department prepared a draft Initial Study and Mitigated Negative Declaration (ISMND) for the Proposed Project. The Draft ISMND (State Clearinghouse No. 2021040428) was circulated for public review from April 16, 2021 through May 20, 2021. The Draft ISMND (dated April 16, 2021) can be found online at: https://www.cityofukiah.com/ceqa-review/. Public comments received during the CEQA review period and City responses to comments are included in Attachment D of the Final Draft ISMND (dated August 16, 2021) which is included as the final attachment to this report. The ISMND found that Project components including the acquisition, annexation, and prezoning of parcels (and associated Zoning Map and General Plan Map Amendments), in addition to the Lot Line Adjustments, would not directly result in impacts to the physical environment. However, under the Development Agreement, infrastructure improvements and the potential construction of up to seven single-family homes and associated ADUs, could result in a total of 14 units within the easternmost 54 acres of the Project area. Specifically, construction and ground disturbing activities associated with these components could result in direct significant impacts to Air Quality, Biological Resources, Cultural/Tribal Cultural Resources, Geology and Soils, Hazards and Hazardous Materials, Hydrology and Water Quality, Noise, Utilities and Service Systems, and Wildfire. However, mitigation measures identified within the aforementioned sections would reduce all impacts to less than significant. A Mitigation Monitoring and Reporting Program is provided in Section VII of the ISMND, as well as in Attachment A of the Conditions of Approval (Attachment 4 to this report). Draft Findings for approval of the ISMND are included in Attachment 5. The Notice of Intent to adopt the ISMND and conduct a public hearing was provided in the following manner, in accordance with Ukiah City Code (UCC) §9267 and California Environmental Quality Act (CEQA) Guidelines Section 15073: Provided to property owners within 300 feet of the project parcels, as well as agencies and departments with jurisdiction or interest over the project on April 16, 2021, June 1, 2021 and August 13, 2021;Provided to members of the public, agencies, and interested parties who submitted written comments on the Draft ISMND during the public review period on August 13, 2021;Published in the Ukiah Daily Journal on April 24, 2021, June 5, 2021 and August 14, 2021; Posted on the Project site on May 3, 2021, June 1, 2021, and August 11;Posted at the Civic Center (glass case) 72 hours prior to each public hearing; Noticed for continuance at the May 26, 2021 Planning Commission hearing to a date certain of June 9, 2021; and Notice for continuance at the June 9, 2021 Planning Commission to a date uncertain. In addition, based on the amount of interest in the Project and to receive as much public input as possible, additional public noticing was conducted in the following manner: Posted on the City of Ukiah website on April 16, 2021 and August 16, 2021;Emailed to Planning Commissioners and City Councilmembers on April 16, 2021 and August 13, 2021; and Hand-delivered to all residences (in addition to and beyond the 300-foot requirement) on Redwood Avenue on May 13, 2021 and mailed to all residences on Redwood Avenue on August 11, 2021. Page 278 of 800 Page 4 of 4 Staff recommends that Council introduce by title only the ordinance that will prezone the conservation and development parcels (Attachment 6), and adopt and approve the recommended actions, including the adoption of the Final Draft of the ISMND which is included as attachment 7 to this report. Staff recommends Council 1) Adopt an Initial Study and Mitigated Negative Declaration; 2) Conditionally approve the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project; and 3) Introduce by Title only the Ordinance to prezone the Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1-H” Single Family Residential-Hillside Overlay District. Recommended Action: 1) Adopt the Initial Study and Mitigated Negative Declaration; and 2) Conditionally Approve the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project; and 3) Introduce by title only the Ordinance in Attachment 6 to prezone the Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1-H” Single Family Residential-Hillside Overlay District. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Craig Schlatter, Community Development Director; David Rapport, City Attorney Page 279 of 800 APN:00104083 APN:00319001 APN:15707002 APN:15707001 APN:15705009 APN:15705011 APN:15705012 APN:15705002 APN:15706003 & 157050003  APN:157030003 APN:15703002 APN:15705001 APN:15705004 APN:15706002 Sphere of Influence   APNs:003-190-09 & 003-110-90 Ukiah Western Hills Open Land Acquisition & Limited Development Project Annexation Parcels (+/-707ac) Parcel Donation to City Development Parcels (+/-54ac) Proposed Water Tanks Sphere of Influence City Limits Existing Access Road This map is a guide. Every reasonable effort has been made to ensure accuracy of the map and data provided. Parcel lines are not intended to represent surveyed data.Document Path: S:\Public Works\Stricklin, Andrew\GIS\Projects\Planning\Western Hills Project Figure 1 ATTACHMENT 1 Location Map Page 280 of 800 :k,E E ;I . f i tH N - SE ; r $; i T s: t q .. E B €E '. ,6E !9o fEq\ $oR IIEo*)EqI\0 'i i*)h 'l x.xr{II -- - - - - - - - - - - - - - - - - t IIIIIIIIIIIIIIIIIII *t * r. Y E fi b i o-\ fNs €f{dq :B r d$ E 't $ o :* Bet r .t ) $ tN se $ b "E S 8 fr E& t s $ tB t^ . b I r. S a- oB s so{qo0bEob u= $ H n ii $ - * 5 a' " . € * \ RS N rt f , $t i $ n fc $ * N $ Es S R Figure 2 Existing Parcel Configuraton Page 281 of 800 Proposed Parcel Configuration & Prezoning for Western Hills (Hull Properties) Open Land Acquisition & Limited Development Agreement Project Sphere of Influence Conservation Parcels” (640ac) with Public Facilities (PF) Prezoning “Development Parcels (54ac) with Single-Family Residential- Hillside Overlay District (R1-H) Prezoning Last revised June 2, 2021 Figure 3 Proposed Parcel Configuration & PrezoningPage 282 of 800 ECHO W A Y OAKKNOLL ROAD DOOLANCANYONDRIVE MYSZKA PLACE CALVERTCOURT GIORNOAVENUE M I L L CO U RT WALNUT AVENUE WEST CLAY STREET WEST PERKINS STREET PA R K B O U L E V A R D HIGHL A N D AVEN U E PF R1 R1H RL RL UR 40 UR 40 RR5 RL RR10 RR5 CASE: OWNER: APN: APLCT: AGENT: ADDRESS: µANX 2021-0001 HULL, David Various City of Ukiah City of Ukiah Western Hills 1:18,000 0 1,400700 Feet 0 0.250.125 Miles ME N D O C I N O C O U N T Y P L A N N I N G D E P A R T M E N T - 2 / 4 / 2 0 2 1 City Limits Zoning Districts Public Roads Existing Zoning Designation Map Figure 4 Page 283 of 800 ECHO W A Y OAKKNOLL ROAD DOOLANCANYONDRIVE MYSZKA PLACE CALVERTCOURT GIORNOAVENUE M I L L CO U RT WALNUT AVENUE WEST CLAY STREET WEST PERKINS STREET PA R K B O U L E V A R D HIGHL A N D AVEN U E WEST ST A N D L E Y STREET RMR 20 RMR 40 RL 160 RL 160 RL 160 RMR 40 RMR 40 RR 10 RR 5 RR 5CASE: OWNER: APN: APLCT: AGENT: ADDRESS: µANX 2021-0001 HULL, David Various City of Ukiah City of Ukiah Western Hills 1:18,000 0 1,400700 Feet 0 0.250.125 Miles ME N D O C I N O C O U N T Y P L A N N I N G D E P A R T M E N T - 2 / 4 / 2 0 2 1 City Limits General Plan Classes Public Roads LDR Figure 5 Existing General Plan Land Use Designation MapPage 284 of 800 Existing Site Photographs Existing access road Figure 6 Page 285 of 800 Existing water tank site Figure 7 Page 286 of 800 Existing "house site" on one of the proposed Development Parcels Figure 8 Page 287 of 800 AGENDA ITEM NO. 12a Department of Community Development Planning Division 300 Seminary Ave. Ukiah, CA 95482 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 1 DATE: August 16, 2021 TO: Planning Commission FROM: Michelle Irace, Planning Manager SUBJECT: Recommendation to the City Council for approval of an Initial Study & Mitigated Negative Declaration and approval of the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project. File No.: 20-5915. S UMMARY OWNER: D&J Investments, LLC; David Hull; Adonis Noguera; and City of Ukiah APPLICANT: City of Ukiah LOCATION: Several parcels located within unincorporated Mendocino County within the Ukiah Western Hills referred to as the “Hull Properties” (APNs 001-040-83, 157-070-01, 157-070-02, 003-190-01, 157-050-09, 157-060-02, 157-050-02, 157-050- 04, 157-050-01, 157-030-02, 157-030-03, 157-050-11 & 157- 050-12); “Noguera Properties” (APNs 003-190-09 & 003-110- 90); and the City-owned “Donation Parcel” (APNs 157-050- 03,157-060-003) TOTAL ACREAGE: ±707 acres GENERAL PLAN: Mendocino County General Plan (Ukiah Valley Area Plan), Remote Residential, 40 Acre Minimum (“RMR40”) ZONING DISTRICT: Upland Residential, 40 acre minimum (“UR:40”) AIRPORT COMPATIBILITY: ENVIRONMENTAL DETERMINATION: Parcels are located in the Other Airport Environs (“OAE”) area of the Ukiah Municipal Airport Land Use Compatibility Plan With the incorporation of the Mitigation Measures identified in the Initial Study & Mitigated Negative Declaration (ISMND), all impacts would be reduced to less than significant ATTACHMENT 2 Page 288 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 2 RECOMMENDATION: Make a recommendation to the City Council for adoption of the ISMND and Conditional Approval of the Project (see Draft Findings in Attachment 1 and Draft Conditions of Approval in Attachment 2). See Recommendation section below for more information. BACKGROUND The City has a vision, and is working towards a goal, of promoting the protection of Ukiah’s western urban interface to restore and conserve forest and stream ecosystems, provide large- scale wildfire mitigation and to protect the Upper Russian River Watershed to benefit fish, wildlife and the greater Ukiah community. Towards achievement of this goal, the City proposes to acquire and annex approximately 707 acres in the Western Hills for open space preservation while allowing the potential for future low-density residential development on the approximately 54 easternmost acres, consistent with existing development in the Hillside District of the Western Hills within the City of Ukiah limits. The Project site(s) consists of undeveloped parcels with fuel breaks and private access roads. The parcels have been subject to vegetation management and grading practices throughout 2017-2020, including clearing areas for potential water tank pad sites and house sites (proposed “Development Parcels”), over the last several years through the County’s permitting process. In 2003, an approximately 100-foot wide, 2.6-mile-long shaded fuel break was constructed (North to South) by Cal Fire along the base of the Western Hills along the entire length of the City to reduce fuel loads and protect the community from wildfire risk. The parcels are currently accessed through existing dirt and gravel roads that traverse the Noguera Properties and connect to Redwood Avenue (nearest address is 680 Redwood Ave.). The existing road was installed in the 1960’s, and road improvements were completed throughout 2015-2017; in 2018 the road was extended further west. The road ranges in width, from 18 ft to 35 ft, with the majority of it being a minimum of 20 ft wide. The sections that are 18 ft wide are approximately 100 ft long and have wider turn-outs immediately before or after them. PROJECT DESCRIPTION The “Proposed Project” includes the following: 1) Acquisition and annexation of the parcels; 2) Prezoning the parcels to “PF” Public Facilities, and “R1-H” Single-family Residential-Hillside Overlay (and associated Zoning Map and General Plan Map Amendments upon approval of the annexation application); 3) Sequential Lot Line Adjustments to reconfigure the existing parcels into seven lots (“Development Parcels”) for future potential development; 4) Development Agreement between Hull Properties and the City allowing up to one single-family home and one accessory dwelling unit on each Development Parcel (up to 14 units total); and 5) site improvements including extension of utilities, road improvements, and construction of the water storage tank(s). Each of these components are described further in detail below. Project Figures and Maps, including a location map (Figure 1), the existing parcel configuration (Figure 2), the proposed resulting parcel configuration and prezoning (Figure 3), existing zoning designations (Figure 4), and existing General Plan land use designations (Figure 5) as well as existing site photographs (Figures 6, 7, and 8) are included in Attachment 3. Page 289 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 3 Acquisition and Annexation The Project proposes to annex the parcels listed below in Table 1, totaling approximately 707 acres (“Annexation Parcels”) within the County of Mendocino’s jurisdiction, into the City of Ukiah. One approximately 188-acre parcel (APNs 157-050-03 & 157-060-003) was donated to the City in December, 2020. The City is currently pursuing the purchase and acquisition of the remaining parcels (“Hull Properties”), with the exception of the “Noguera Properties” (APNs 003-190-09 & 003-110-90), which will be utilized for access only and remain under private ownership. In order to complete the acquisition, the City will enter into a Property Exchange and Development Agreement (“Development Agreement”) with the current owner of the Hull Properties, subject to the annexation application. Under the Development Agreement, the current owner will convey the Annexation Parcels to the City in exchange for real property owned by the City and a payment from the City of an amount to make up the difference between the fair market value of the exchanged properties. The proposed parcels for annexation would be contiguous to existing city limits, in accordance with LAFCo policies and the Government Code. Also in accordance with LAFCo-adopted procedures 1, and as required under the Development Agreement, the City will submit its annexation application to the Mendocino County Local Agency Formation Commission (LAFCo), after the City acquires title to the Annexation Parcels and upon City Council approval of the Proposed Project. Prezone Government Code Section 65859 allows the City to adopt a zoning district for land outside of the city limits in anticipation of annexation and development (i.e., prezone). Under the provisions of the Government Code, the zoning district adopted by the City does not become effective unless and until the land is annexed into the City. With the exception of Development Parcels 1-3, which Hull Properties is choosing to retain the right to sell and develop prior to annexation (see Development Agreement and Assumptions section below for more information), once the parcels are annexed into the City, the Development Parcels would not be developed until the Lot Line Adjustments are recorded, and an applicant submits a project-specific site plan with a Use Permit application and receives Planning Commission approval for development of their home, in accordance with the Hillside Overlay Zoning District regulations 2 (see Staff Analysis section below for more information). Until the property is annexed, it is subject to existing zoning under Mendocino County’s Zoning Ordinance. Prezoning of the parcels will require a Zoning Map and General Plan Map Amendment upon approval of the annexation application. The City proposes to annex approximately 640 acres total, collectively referred to as the “Conservation Parcels”, for open space and conservation. Although the City does not currently have a standalone Open Space zoning designation, the City’s existing Public Facilities (PF) zoning designation is intended for public or quasi-public uses, including, but not limited to, natural resource conservation areas and parks and recreation. Accordingly, the Conservation Parcels are proposed to be prezoned “PF” (with a “Public” General Plan land use designation). See Figure 3, Proposed Parcel Configuration & Prezoning, contained within Attachment 3. The proposed Development Parcels (totaling approximately 54 acres) will be prezoned to Single- Family Residential-Hillside Overlay District (R1-H) with a General Plan Designation of Low 1 https://www.mendolafco.org/files/151e0a09b/FINAL+Adopted+Mendo+LAFCo+PP+Manual+2018+upd+5-5-21.pdf 2 The Hillside Overlay District Regulations can be found online at: https://www.codepublishing.com/CA/Ukiah/#!/Ukiah09/Ukiah0902-1100.html#art11 Page 290 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 4 Density Residential (LDR), consistent with adjacent City zoning and development patterns in the Western Hills. In addition, the Noguera Properties (APNs 003-190-09 & 003-110-90) will be prezoned R1-H for consistency with surrounding zoning and land uses, but are not included as Development Parcels in the Development Agreement, as they will continue to be utilized for access only. The Hillside (–H) Overlay District is intended to support planning, design, and development activities that are in harmony with natural physical features and minimize potential safety, water runoff and soil erosion concerns associated with the natural terrain. This approach will allow the City to preserve and protect the Conservation Parcels (640 acres total), while permitting limited, orderly, clustered low-density single-family housing development within the Development Parcels (54 acres). Lot Line Adjustment To achieve the resulting proposed parcel configuration of up to seven Development Parcels, the Project also includes sequential Lot Line Adjustments in both the City and County jurisdictions, in accordance with the Subdivision Map Act.3 Hull Properties recently recorded sequential Lot Line Adjustments through the County’s ministerial procedures and will submit sequential Lot Line Adjustments through the City’s procedures to achieve configuration of the Development Parcels. Hull Properties intends to sell the Development Parcels (ranging in sizes from 5 to 10 acres each, in accordance with the R1-H regulations) for individual development. Although Development Parcels 1-3 may be developed prior to annexation, they will be developed in accordance with R1- H regulations through Declaration of Covenants, Conditions, and Restrictions (CC&Rs). Review of the Lot Line Adjustments will be conducted by the City Engineer prior to recordation of the final maps to ensure that all development standards contained within the R1-H zoning district are met. Table 1 identifies the existing parcels to be reconfigured and Figure 1, Project Location Map, identifies the Development Parcel area in yellow. Figure 2 shows the existing parcel configuration and Figure 3 shows the preliminary resulting parcel configuration and proposed prezoning. Although the final configuration of the Development Parcels may vary slightly, the footprint of the resulting configuration for the Development Parcels (54 acres) and number of parcels will remain the same. Table 1. Annexation Parcels, Proposed Lot Line Adjustments and Prezoning Assessor’s Parcel Number (APN) Existing Size (+/acres) Proposed Size (+/- acres) through Lot Line Adjustments 4 Resulting Parcel Configuration, Intended Use and Proposed Prezoning 001-040-83 77.6 9.8 Parcel 1 will become a Development Parcel intended for single family housing and prezoned R1-H. 157-070 01, 157-070-02, 003-190-01 & 157-050-09 148.2 5.1 Parcel 2 on Existing Conditions Tentative Map, contains several APNs but is one legal parcel (149 acres total). This parcel will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-11 40.0 9.9 Parcel 3 will become a Development Parcel intended for single-family housing and prezoned R1-H. 3 The Subdivision Map Act excludes from its requirements lot line adjustments “between four or fewer existing adjoining parcels” if there is no resulting increase in the number of parcels. Government Code § 66412(d) 4 Resulting parcel configuration is subject to change but the Development Parcel area footprint and number of resulting parcels will remain the same. Page 291 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 5 157-050-02 40.5 9.0 Parcel 4 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-01 40.3 5.0 Parcel 5 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-030-02 20.0 9.7 Parcel 6 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-12 40.0 5.0 Parcel 7 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-04 & 157-060-02 38.7 391.5 Parcel 8 will become a Conservation Parcel and be prezoned PF. The proposed water tanks will be placed on this parcel within the existing water tank pad site (on existing Parcel 2). 157-030-03 60.0 60.0 Parcel 9 is an Outsidewill become a Conservation Parcel and will not be prezoned PF. 157-030-03 & 157-060-03 188.5 188.5 Parcel 10 (City-owned “Donation Parcel”) will become a Conservation Parcel and will be prezoned PF. “Noguera Properties” 003-190-09 & 003-110-90 10.20 4.14 10.20 4.14 These parcels contain the existing access road that will be improved but remain under private ownership. It will be included in the annexation proposal and prezoned R1-H, consistent with surrounding zoning and land uses, but no development is proposed; this parcel is not included in the Lot Line Adjustment. TOTAL +/- 707 acres Development Agreement and Assumptions The proposed Development Agreement between Hull Properties and the City limits development to one single-family dwelling and one accessory dwelling unit (ADU) per parcel (14 units total). Hull Properties is choosing to retain the right to sell and develop Development Parcels 1-3 prior to annexation. The Development Parcels are located within the County of Mendocino’s jurisdiction within the Upland Residential, 40-acre minimum (UR:40) zoning district. Construction of single- family homes within the County’s jurisdiction would be by-right and not require discretionary approval, environmental review, nor the development standards contained within the City’s R1-H zoning district. However, Hull Properties is choosing to require the single-family homes to be constructed to R1-H standards by including them in the Declaration of Covenants, Conditions, and Restrictions (CC&Rs) for Development Parcels 1-3. In addition, although not required, the mitigation measures contained within the ISMND for residential development will also be included in the CC&Rs. Although Hull Properties is retaining the right to develop Development Parcels 1- 3 prior to annexation, they will still be included in the application for annexation and prezoned to R1-H. After the Annexation Parcels are successfully annexed into the City, the remaining Development Parcels (4-7) would not be developed until an applicant submits a project site plan for development, subject to discretionary review and received Planning Commission approval, as required by the City’s Hillside Overlay Zoning District. However, no purchasers have been identified, and the timing of the sale and development of the properties is unknown. The Noguera Properties that will be annexed and utilized for access are not included in the Hull Properties Development Agreement, nor the development assumptions. See Staff Analysis section below for more information. Infrastructure Improvements Approximately one-half mile of the existing 18 ft to 35 ft wide gravel private access road beginning at the access point at the terminus of on Redwood Avenue (traversing the Noguera Properties), to the house sites, would be paved to serve the future housing development sites. The road improvements will also include developing a cul-de-sac on Proposed Parcel 4 to serve the Development Parcels. All improvements will be in accordance with applicable fire and building Page 292 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 6 codes. The property owner/developer will complete the road improvements; the road will remain under private ownership and be maintained by a Homeowner’s Association (HOA) through a road maintenance and access agreement. The agreement will also allow the City to maintain access to public utilities and city-owned properties. Sewer, water and electric utilities would be provided to the Development Parcels. Sewer and water will be developed by the property owner, while electric infrastructure will be developed by the property owner and/or the City. All utilities will be undergrounded and located within or adjacent to existing access roads, on private parcels and previously disturbed areas. A detailed Plan for Services will be included in the application for annexation. Easements will be required for all utility facilities in roadway and on parcels as necessary. An onsite community sewer system with a holding tank and sewer line, rather than a leach field, will be constructed for discharging wastewater (effluent only) to a sewer main at the end of Redwood Avenue. Proposed Development Parcels 1-3 are located within the Ukiah Valley Sanitation District (UVSD) service area, while Proposed Development Parcels 4-7 are not. However, sewer service would be provided to the Development Parcels by the City for parcels located both within and outside of the UVSD. Water utilities will be developed by the property owner on-site to support the Development Parcels; approximately 130,000 gallons of storage will be provided by two 65,000 gallon tanks (34ft in diameter and 10.5ft high) that will be placed within the existing water tank pad site (identified by a blue dot on Figure 1 in Attachment 3). Ultimately the Homeowners Association will own the tank and provide all maintenance on the tank and its associated equipment. Fire hydrants are also required to be installed with residential development. Electric utilities would be extended from Helen/Redwood Ave to provide electric service. Easements will be required for all utility facilities in the roadway and on parcels as necessary to provide electric service. The electric system will be in accordance with State and Federal requirements. Upon annexation, the City will own and maintain electric utility infrastructure through a utility easement. Construction Proposed road improvements, the underground extension of utilities, as well as the water tanks and hydrant systems would be completed by the property owner (or its contractors). Road improvements and utility extension is anticipated to take approximately 1-2 months during the dry season. Water tank construction would occur over 5-10 days. All construction will take place between the hours of 7:00 a.m. and 7:00 p.m., per the City’s Noise Ordinance, and will require the use of typical construction equipment including, but not limited to: hand tools, power tools, heavy equipment, manlift, small crane, backhoe, dozer, excavator, forklift, paver, roller, tractor, water truck, grader, etc. Construction equipment and staging will be located within existing disturbed areas and roadways. It is anticipated that approximately 8-10 construction workers will be needed for the road and water system improvements, and extension of utilities. Extension of utilities would require 2-24" wide trenches to be dug within the access road or other disturbed areas for approximately one-half-mile from the connection point within Redwood Avenue to the Development Parcels. Because the road and water tank pad site are pre-existing, minimal vegetation removal and grading will be required; no trees are proposed for removal. Additional grading may be required to extend driveways to the cul-de-sac and access road. Standard Best Management Practices including, but not limited to, the placement of straw, mulch, seeding, straw wattles, silt fencing, etc. will be implemented during construction, as appropriate. Page 293 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 7 With the exception of Development Parcels 1-3 which may be developed by-right prior to annexation in the County’s jurisdiction, the construction of single-family homes would not begin until a buyer purchases one of the proposed Development Parcels and obtains an approved Use Permit by the Planning Commission for development of their home. Typically, construction of a single-family dwelling takes approximately 6-10 months to complete and would require the use of the aforementioned standard construction equipment. SURROUNDING LAND USE & ZONING As previously mentioned, the Project includes parcels currently outside of the City of Ukiah limits, within unincorporated Mendocino County. The Project site(s) currently carry a Remote Residential, 40 Acre Minimum (“RMR40”) land use designation within the Ukiah Valley Area Plan (UVAP; 2011) and the existing zoning is Upland Residential, 40-acre minimum (“UR:40”). Lands to the north (with the exception of the northeastern-most boundary), west and south are largely undeveloped but contain some rural residential development within unincorporated Mendocino County. To the east, the Project is bounded by lands within the City of Ukiah developed with single family housing and zoned Single-Family Residential-Hillside Overlay District (R1-H). A summary of zoning designations and land uses is provided below in Table 2. Project Figures and Maps, including a location map (Figure 1), the existing parcel configuration (Figure 2), the proposed parcel configuration and prezoning (Figure 3), existing zoning designations (Figure 4), and existing General Plan Land Use designations (Figure 5) as well as existing site photographs (Figures 6-8) are included in Attachment 3. Table 2, Surrounding Zoning and Land Uses AGENCY COMMENTS Project referrals were sent to the following trustee agencies with interest or jurisdiction over the project: City of Ukiah Public Works Department, City of Ukiah Police Department, City of Ukiah Electrical Utility Department, City of Ukiah Community Development Department - Building Division, City of Ukiah Municipal Airport Operations Manager, Ukiah Valley Fire Authority, California Department of Forestry and Fire Protection, Mendocino County Planning and Building, Mendocino Transit Authority, California Department of Fish and Wildlife, U.S. Fish and Wildlife Service, Regional Water Quality Control Board, U.S. Army Corps of Engineers, Native American ZONING: USE: NORTH County: Upland Residential, 40-acre minimum (UR:40) City: Single-Family Residential-Hillside Overlay District (R1-H) Undeveloped/ Rural Residential Undeveloped EAST City: Single-Family Residential-Hillside Overlay District (R1-H) Single-Family Residential SOUTH County: Upland Residential, 40-acre minimum (UR:40) Undeveloped/ Rural Residential WEST County: Upland Residential, 40-acre minimum (UR:40) Undeveloped/ Rural Residential Page 294 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 8 Heritage Commission, local and California Native American tribes, Sonoma State University Northwest Information Center, Ukiah Valley Sanitation District, and Willow Water District. Comments received during agency review are included in Attachment 4 and Draft Conditions of Approval in response to agency comments are contained in Attachment 2. In addition, the Initial Study & Mitigated Negative Declaration (ISMND) was circulated for public review and comment to the aforementioned departments and agencies, in accordance with the California Environmental Quality Act (CEQA). Under CEQA the term “responsible agency” includes all public agencies other than the lead agency that have discretionary power over the Proposed Project. Annexation applications require approval by the Mendocino County Local Agency Formation Commission (LAFCo), making LAFCo a responsible agency. The City of Ukiah has been collaborating with LAFCo for several months, providing them with multiple opportunities to comment on the Project. Comments received from LAFCo during the referral process are included in Attachment 4. In addition, City responses to their comments can also be found in Attachment 4. LAFCo also provided comments on the ISMND. Public comments received during the CEQA review period are included in Attachment 6 and City responses to comments received are included in Attachment 7. See the Environmental Documentation Section below for more information. STAFF ANALYSIS General Plan and Zoning Consistency The current Ukiah Valley Area Plan land use designation is Remote Residential, 40 Acre Minimum (“RMR40”) and the existing zoning is Upland Residential, 40-acre minimum (“UR:40”). Both of these designations are intended to be applied to lands having constraints for commercial agriculture, timber production or grazing, which are well suited for small scale farming and low density agricultural/residential uses. Both the existing RMR-40 land use designation and UR-40 zoning designation allow for one dwelling unit per 40 acres (and an ADU); housing development with the UR-40 zoning district is allowed by right. As previously discussed in the Project Description section above, the Conservation Parcels are proposed to be prezoned “PF” (with a “Public” General Plan land use designation) which specifically identifies public or quasi-public uses, including, but not limited to natural resource conservation areas and parks and recreation. Consistent with the Land Use Element of the 1995 City of Ukiah General Plan, the Public (P) land use designation is intended for public facilities as well as open space and conservation areas and may be applied to lands within the City, the Sphere of Influence (SOI), rural communities (identified as Calpella, Talmage and the Forks), master plan areas, and areas within the General Plan’s Unincorporated Planning Area (currently the same boundary as the UVAP and the City’s adopted SOI). Approximately 343 acres of the Conservation Parcels are located within the City’s SOI and 296 acres outside of it (see Figure 1 in Attachment 3). Under Government Code Section 56742, city- owned parcels are not required to be located within the City's SOI. Parcels can be located anywhere in the County, as long as they are less than 300 acres, owned by the City, and used for municipal purposes at the time of the annexation application. Because the portion of the Conservation Parcels proposed for annexation totals approximately 296 acres, and will be under city ownership for open space, this portion of the Project is consistent with the Government Code. Because the area located inside of the SOI is within the 95’ General Plan’s Unincorporated Planning Area, the proposed annexation and prezoning of the parcels to “PF” (with a P General Plan land use designation) are consistent with the intent and land uses identified within the 95’ Page 295 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 9 General Plan. In addition, the City can utilize its Parks Ordinance (Division 1, Chapter 12 of the Ukiah City Code) to provide rules governing City and public use of “PF” zoned property. All proposed Development Parcels (totaling approximately 54 acres) would be prezoned to Single- Family Residential-Hillside Overlay District (R1-H) with a General Plan Designation of Low Density Residential (LDR), consistent with adjacent City zoning and development patterns in the Western Hills. These parcels are located within the ‘95 General Plan’s Unincorporated Planning Area, as well as the current UVAP/SOI boundary, and are consistent with the density and intent of the LDR land use designation and “R1-H” zoning. Although the Noguera Properties will be prezoned “R1-H” for consistency with surrounding zoning and land uses, they are not included in the Development Agreement and no development is proposed at this time; the parcels will continue to be used for access only. UCC Section §9267, Prezoning, states that the City may prezone unincorporated territory adjoining the City for the purpose of determining the zoning which will apply to such property in the event of subsequent annexation to the City. Prezoning of the parcels will also require a Zoning Map and General Plan Map Amendment upon approval of the annexation application by LAFCo. The “–H” Hillside Overlay District is intended to encourage planning, design, and development while preserving natural physical features and minimizing potential safety, water runoff and soil erosion concerns associated with the natural terrain. The City of Ukiah’s General Plan land use designation of Low Density Residential (LDR) allows for a density of six dwelling units per acre. Under these regulations, the 54 acres for residential development could conceivably be developed with up to 330 units. However, the proposed Development Agreement would restrict development to one single family dwelling per parcel and one ADU (except for in cases were the slope exceeds 50 percent, per the City’s Hillside Overlay Ordinance), for a total of up to14 units. R1-H zoning requires a minimum lot size of 10,000 sf (0.23 acre) for parcels with a slope up to 20%; minimum lot size increases as the slope of the parcel increases, as outlined in UCC Section 9139, Hillside Development Standards. Consistent with these standards, the resulting parcel configuration proposes 5-10-acre Development Parcels that would be prezoned “R1-H”. Development within the Hillside Overlay District also requires submittal of the following: soil and geological reports, subsurface investigations, grading plans, vegetation reports, grading plans, hydrology reports, and structure elevations. Additionally, each home would require approval of a Building Permit, which includes additional review and approval by County and City departments. Hull Properties recently recorded sequential Lot Line Adjustments through the County’s ministerial procedures and will submit sequential Lot Line Adjustments through the City’s procedures upon approval of the annexation application to achieve the resulting proposed parcel configuration for the Development Parcels. A copy of the final recorded Lot Line Adjustments, depicted the “proposed configuration” shown in Figure 3 will be submitted to the Community Development Department prior to submittal of a Use Permit for single family housing within Development Parcels 4-7. Review of the Lot Line Adjustments will be conducted by the City Engineer prior to recordation of the final maps to ensure that all development standards contained within the R1-H zoning district are met. Further, through the Use Permit process (for Parcels 4-7) and CC&R regulations (for Parcels 1-3) each proposed home would be subject to all R-1H development regulations (including slope, density, setbacks, height, fire safety and water requirements, access requirements, etc.) contained within the Hillside Overlay District. Hull Properties recently recorded sequential Lot Line Adjustments through the County’s ministerial procedures and will submit sequential Lot Line Adjustments through the City’s procedures upon Page 296 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 10 approval of the annexation application to achieve the resulting proposed parcel configuration for the Development Parcels. A copy of the final recorded Lot Line Adjustments, depicted the “proposed configuration” shown in Figure 3 will be submitted to the Community Development Department prior to submittal of a Use Permit for single family housing within the Development Parcels. Review of the Lot Line Adjustments will be conducted by the City Engineer prior to recordation of the final maps to ensure that all development standards contained within the R1-H zoning district are met. In accordance with Ukiah City Code Section 8296(f), which states “Concurrent Permit Processing: when a lot line adjustment is part of a project that requires one or more discretionary planning entitlements and the applicant does not want the lot line adjustment unless the entire project is approved, then the lot line adjustment shall be reviewed as part of the discretionary planning application. In that event, all permits and approvals, including the lot line adjustment, shall be combined into one application, processed concurrently, and acted upon by the highest review authority required by this code based on the entitlements included in the application. (Ord. 1138, §2 (Exh. A), adopted 2012).” Hull properties has indicated that they wish to record the Lot Line Adjustments, regardless of whether or not the overall Project gets approved. As such, the Lot Line Adjustments remain ministerial and do not require approval by the highest review authority (City Council, in this case). Prezoning of the parcels will require a Zoning Map and General Plan Map Amendment upon approval of the annexation application. Although the City’s General Plan and County’s UVAP do not contain specific policies related to prezoning, they do contain goals and policies that strive for orderly, clustered development, supporting the City and County’s RHNA, and conservation of open space. The City’s 2019-2027 Housing Element includes Goal H-5 and Policy 5-1 which seek to support future housing needs through annexation efforts that lead to orderly expansion of growth. Similarly, the County’s 2019-2027 Housing Element includes Policy 1.3 and Actions 1.3a through 1.3d that strive to work cooperatively with cities within the County on regional housing, support annexation applications to the Mendocino LAFCo from incorporated cities for annexations of contiguous lands etc. Consistent with these goals and policies, the Proposed Project will allow the City to adequately preserve and protect the collective Conservation Parcels (640 acres total), while allowing orderly and clustered low-density residential development within the Development Parcels (54 acres), consistent with land use patterns within the Western Hills. Additionally, the 14 units that could be developed under the Development Agreement would fulfil a portion of the above moderate income units of housing required by the City’s Regional Housing Needs Allocation (RHNA) for the 2019-2027 Housing Element Planning Cycle (see Section 5.14, Population and Housing, of the ISMND for more information). Airport Compatibility The Ukiah Municipal Airport is located within the City of Ukiah jurisdictional limits. The Ukiah Municipal Airport Master Plan and the Mendocino County Airport Comprehensive Land Use Plan (ACLUP; 1996) had been the plans identifying areas with potential hazards and impacts to persons residing or working within the Airport Master Plan area for the last several decades. However, in February 2019, the City of Ukiah, in coordination with the County of Mendocino and the Mendocino County Airport Land Use Commission (ALUC) initiated a planning effort to prepare an updated compatibility plan for the Ukiah Municipal Airport, titled the Ukiah Municipal Airport Land Use Compatibility Plan (UKIALUCP). The UKIALUCP was adopted by the ALUC on May 20, 2021 and adopted by the Ukiah City Council on June 16, 2021. Under the new UKIALUCP, the Project is located within the Other Airport Environs (OAE) Compatibility Zone. Within this airport influenced area, no limits are prescribed with regard to Page 297 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 11 intensity of use, density of dwelling units, nor are there any open land requirements specific to airport safety considerations. Noise and overflight factors are considered minimal, but there may be occasional overflights which may be intrusive to some outdoor activities. In general, the risk level for this zone is low, and no specific safety or airspace protection factors are identified. According to Table 3A of the UKIALUCP, most land-use categories would be considered normally compatible. When uses are identified as conditionally compatible for the OAE, concerns are typically associated with potential flight hazards such as land uses that may attract birds, generate dust, produce smoke or steam plumes, create electronic interference, or otherwise be considered hazardous. The project area is located within an Airspace High Terrain Zone, which would require that any proposed structures or objects having a height of more than 35 feet be referred to the ALUC for review. Per section 1.4.5 of the UKIALUCP, however, referral of the proposed pre-zoning associated with annexation does not require review of the ALUC, as only land use actions occurring within Compatibility Zones 1-6 require review (pg. 2-9). As described, the proposed project would not engender airport safety concerns under the UKIALUCP, and a review of associated residential uses are indicated as ‘Normally Compatible.’ Conclusion For the reasons discussed above, the Project would be consistent with the City’s General Plan, Zoning Code and Subdivision Ordinance, the County’s UVAP, as well as the Government Code and LAFCo policies related to annexation and prezoning. The Ukiah City Code does not identify specific findings required for annexation or prezoning, but Draft Findings supporting Staff’s recommendation are included in Attachment 1. Draft Conditions of Approval for the Project can be found in Attachment 2, and the Draft OrdinanceResolution for the proposed prezoning can be found in Attachment 9. ENVIRONMENTAL DOCUMENTATION In accordance with the California Environmental Quality Act (CEQA), the City of Ukiah Planning Division prepared a draft Initial Study and Mitigated Negative Declaration (ISMND) for the proposed project. The ISMND (State Clearinghouse No. 2021040428) was circulated for public review from April 16, 2021 through May 20, 2021. The Proposed Project was scheduled for Planning Commission consideration on May 26, 2021 and June 9, 2021. However, due to the amount of public comment received on the ISMND and the Development Agreement still being finalized, at Staff’s request, the hearings were continued to a later date; correspondence received for these hearings is included in Attachment 8. Public comments received during the CEQA review period are included in Attachment 6. The Draft ISMND can be found online at: https://www.cityofukiah.com/ceqa-review/. Revisions and clarifications based on public comment and changes in the Project Description were made to the Final Draft ISMND (see Attachment 5). City responses to comments received and a summary of changes made to the Project and ISMND are included in Attachment 7. The ISMND found that Project components including the acquisition, annexation, and prezoning of parcels (and associated Zoning Map and General Plan Map Amendments), in addition to the Lot Line Adjustments, would not directly result in impacts to the physical environment. However, under the Development Agreement, infrastructure improvements and the potential construction of up to seven single-family homes and associated ADUs, could result in a total of 14 units within the easternmost 54 acres of the Project area. It is unknown whether all of the single family homes, Page 298 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 12 and ADUs in particular, would be developed, but physical impacts would vary depending on location, intensity, and other siting factors. However, the Proposed Project does not include specific development designs or proposals, nor does it grant any entitlements for development. Once the parcels are annexed into the City, the site(s) would not be developed until an applicant submits a project site plan for development and receives Planning Commission approval to develop a home on the Development Parcels (4-7). Development of Development Parcels 1-3 may occur prior to annexation, as Hull Properties is retaining the right to develop them within the County’s jurisdiction. If developed prior to annexation, construction of the single-family homes within the County’s jurisdiction would be by-right within the Upland Residential, 40-acre minimum (UR:40) zoning district, and would not require discretionary approval, environmental review, or the development standards contained within the City’s R1-H zoning district. However, Hull Properties is choosing to require the single-family homes to be constructed to R1-H standards by including them in the Declaration of Covenants, Conditions, and Restrictions (CC&Rs) for Development Parcels 1-3. In addition, although not required, the mitigation measures contained within the ISMND for residential development will also be included in the CC&Rs. Although the Noguera Properties will be prezoned “R1-H” for consistency with surrounding zoning and land uses, they are not included in the Development Agreement and no development is proposed at this time; the parcels will continue to be used for access only. For these reasons, these parcels are not included as Development Parcels and have not been included in the development assumptions within the CEQA analysis. As described throughout the ISMND, construction and ground disturbing activities associated with these components could result in direct significant impacts to Air Quality, Biological Resources, Cultural/Tribal Cultural Resources, Geology and Soils, Hazards and Hazardous Materials, Hydrology and Water Quality, Noise, Utilities and Service Systems, and Wildfire. However, mitigation measures identified within the aforementioned sections would reduce all impacts to less than significant. Mitigation measures identified within the Initial Study and Mitigated Negative Declaration related to ground disturbing activities and construction for road and utility improvements, as well as residential development, are included in the Development Agreement and Conditions of Approval to ensure that they are implemented accordingly. A Mitigation Monitoring and Reporting Program is provided in Section VII of the ISMND, as well as in Attachment A of the Conditions of Approval. All future residential development would be analyzed on a project level basis for consistency with land use policies; and would be subject to discretionary and environmental review of their individual and cumulative environmental impacts, as applicable (with the exception of by-right development). Based upon the analysis contained within the ISMND, all potential impacts resulting from the Proposed Project would be less than significant with incorporation of mitigation. Draft Findings for approval of the ISMND are included in Attachment 1. NOTICE The Notice of Intent to adopt the ISMND and conduct a public hearing was provided in the following manner, in accordance with Ukiah City Code (UCC) §9267 and California Environmental Quality Act (CEQA) Guidelines Section 15073: Page 299 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 13 • Provided to property owners within 300 feet of the project parcels, as well as agencies and departments with jurisdiction or interest over the project on April 16, 2021, June 1, 2021 and August 13, 2021; • Provided to members of the public, agencies, and interested parties who submitted written comments on the Draft ISMND during the public review period on August 13, 2021; • Published in the Ukiah Daily Journal on April 24, 2021, June 5, 2021 and August 14, 2021; • Posted on the Project site on May 3, 2021, June 1, 2021, and August 11; • Posted at the Civic Center (glass case) 72 hours prior to the public hearing; • Noticed for continuance at the May 26, 2021 Planning Commission hearing to a date certain of June 9, 2021; and • Notice for continuance at the June 9, 2021 Planning Commission to a date uncertain. In addition, based on the amount of interest in the Project and to receive as much public input as possible, additional public noticing was conducted in the following manner: • Posted on the City of Ukiah website on April 16, 2021 and August 16, 2021; • Emailed to Planning Commissioners and City Councilmembers on April 16, 2021 and August 13, 2021; • Hand-delivered to all residences (in addition to and beyond the 300-foot requirement) on Redwood Avenue on May 13, 2021 and mailed to all residences on Redwood Avenue on August 11, 2021. RECOMMENDATION The Ukiah City Code places the authority for adoption of the Initial Study and Mitigated Negative Declaration, as well as approval of the overall Project, including acquisition and annexation, prezoning, Lot Line Adjustments, Development Agreement, and associated site improvements with the City Council. The Planning Commission has the authority to consider the aforementioned and make recommendations to the City Council. With the exception of the ISMND and Development Agreement, each of the Project components requires further approval by other entities. Specifically, the annexation and prezoning require LAFCo approval and the Lot Line Adjustments for parcels within the City’s jurisdiction require approval by the City Engineer. Similarly, construction of future single-family homes on all Development Parcels requires approval of Building Permits, and under the Development Agreement, construction of homes within Development Parcels 4-7 requires approval of a Use Permit by the Planning Commission. As such, Staff recommends Planning Commission: 1) Conduct a public hearing; 2) Make a recommendation to the City Council to adopt the Initial Study and Mitigated Negative Declaration; 3) Make a recommendation to the City Council to approve the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project including: acquisition and annexation of approximately 707 acres, prezoning, Lot Line Adjustments, a Development Agreement between Hull Properties and the City of Ukiah, and associated site improvements; and 4) Make a recommendation to the City Council to adopt an resolution ordinance to prezone the Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1-H” Single Family Residential-Hillside Overlay District. Page 300 of 800 Staff Report Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 14 ATTACHMENTS 1. Draft Findings 2. Draft Conditions of Approval 3. Project Figures and Maps 1) Location Map 2) Existing Parcel Configuration 3) Proposed Parcel Configuration and Prezoning 4) Existing Zoning Designation Map 5) Existing General Plan Land Use Designation Map 6-8) Existing Site Photographs 4. Agency Comments from Project Referral 5. Final Draft ISMND, Revised August 16, 2021 6. Written ISMND Comments Received during the Public Review Period 7. City Reponses to Written Comments Received on the Draft ISMND 8. Correspondence received for May 26, 2021 and June 9, 2021 Planning Commission hearings. 9. Draft Resolution Ordinance for Prezoning of Annexation Parcels Page 301 of 800 Page 1 of 3 CITY OF UKIAH PLANNING COMMISSION MINUTES REGULAR MEETING Virtual Meeting Link: https://gloabal.gotomeeting.com/join/678443853 Ukiah, CA 95482 August 25, 2021 6:00 p.m. 1.CALL TO ORDER The City of Ukiah Planning Commission held a Regular Meeting on August 25, 2021, having been legally noticed on August 13, 2021, which was called to order by Chair Christensen at 6:00 p.m. on the following virtual link: https://global.gotomeeting.com/join/678443853 CHAIR CHRISTENSEN PRESIDING. 2.ROLL CALL Roll was taken with the following Commissioners Present: Rick Johnson, Michelle Johnson, Van Antwerp, Hilliker, and Chair Christensen. Commissioners Absent: None Staff Present: Craig Schlatter, Community Development Director; Michelle Irace, Planning Manager; Maya Simerson, Project Analyst; David Rapport, Legal Counsel; Doug Hutchison, Fire Chief; Ian Broeske, Fire Marshal; Kristine Lawler, City Clerk; and Stephanie Abba, Planning Commission Secretary. 3.PLEDGE OF ALLEGIANCE Everyone Recited 4.APPROVAL OF MINUTES a.Approval of the Draft Minutes of July 14, 2021 Motion/Second Hilliker/R. Johnson to approve the Minutes of July 14, 2021. Motion carried by the following roll call vote: AYES: R. Johnson, M. Johnson, Van Antwerp, Hilliker and Chair Christensen. NOES: None. ABSENT: None. ABSTAIN: None. 5.APPEAL PROCESS Note: For matters heard at this meeting the final date to appeal is September 6, 2021 at 5:00 p.m. 6.COMMENTS FROM AUDIENCE ON NON-AGENDA ITEMS No public comment was received. 7.SITE VISIT VERIFICATION Verified 8.VERIFICATION OF NOTICE Verified by Staff 9.PLANNING COMMISSIONERS’ REPORT No Report was given. ATTACHMENT 3 Page 302 of 800 Minutes of the Planning Commission, August 25, 2021 Continued: Page 2 of 3 10. PLANNING COMMISSION DIRECTOR’S REPORT No Report was given. 11. CONSENT CALENDAR No items on consent calendar. 12. NEW BUSINESS a. Consideration and Possible Recommendation to the City Council for approval of an Initial Study and Mitigated Negative Declaration and approval of the Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Project. File No. 20-5915. Presenter: Michelle Irace, Planning Manager and Maya Simerson, Project Analyst. Note: Planning Manager Michelle Irace noted that Attachment 9, Draft Resolution for Prezoning, has been replaced with a Draft Ordinance for Prezoning and that all references in the Staff Report to a resolution should be replaced with reference to an ordinance. Planning Manager Michelle Irace also noted that Table 1 of the Staff Report has been corrected as follows: 157-030-03 60.0 60.0 Parcel 9 is an Outside will become a Conservation Parcel and will not be prezoned PF. Staff Comment: Ian Broeske, Fire Marshal; David Rapport, Legal Counsel Public Comment: Dave Hull, Land Owner; Pinky Kushner; Don Rowe; Chris Watt. Motion/Second M. Johnson/R. Johnson to make a recommendation to the City Council to adopt the Initial Study and Mitigated Negative Declaration; to approve the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project including: acquisition and annexation of approximately 707 acres, prezoning, Lot Line Adjustments, a Development Agreement between Hull Properties and the City of Ukiah, and associated site improvements; Motion carried by the following roll call vote: AYES: R. Johnson, M. Johnson, Hilliker and Chair Christensen. NOES: Van Antwerp ABSENT: None. ABSTAIN: None. Motion/Second Hilliker/R. Johnson to recommend to City Council to adopt an Ordinance (to prezone the Conservation Parcels to “PF” Public Facilities and the Development Parcels to “R1- H” Single Family Residential-Hillside Overlay District). Motion carried by the following roll call vote: AYES: R. Johnson, M. Johnson, Hilliker and Chair Christensen. NOES: Van Antwerp ABSENT: None. ABSTAIN: None. 13. UNFINISHED BUSINESS None 14. ADJOURNMENT There being no further business, the meeting adjourned at 8:20 p.m. Page 303 of 800 Minutes of the Planning Commission, August 25, 2021 Continued: Page 3 of 3 _______________________________________ Stephanie Abba, Planning Commission Secretary Page 304 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 1 ATTACHMENT 4 DRAFT CONDITIONS OF APPROVAL FOR THE UKIAH WESTERN HILLS OPEN LAND ACQUIS ITION & LIMITE D DEVELOPMENT AGREEMENT PROJECT, INITIAL STUDY AND MITIGATED NEGATIVE DECLARATION, AND ORDINANCE FOR PREZONING FILE NO.: 20-5915. The following Conditions of Approval shall be made a permanent part of the Lot Line Adjustments, Development Agreement, site improvements, prezoning and annexation associated with the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project, shall remain in force regardless of property ownership, and shall be implemented in order for this entitlement to remain valid. Project Summary. The Ukiah Western Hills Open Land Acquisition & Limited Development Project includes the following components: 1) Acquisition and annexation of approximately 707 acres into the City of Ukiah limits; 2) Prezoning the parcels to PF and R1-H (and associated Zoning Map and General Plan Map Amendments upon approval of the annexation application); 3) Sequential Lot Line Adjustments to reconfigure the existing parcels into seven lots (“Development Parcels”) for future potential development; 4) Development Agreement between Hull Properties and the City allowing up to one single-family home and one accessory dwelling unit on each Development Parcel (14 units total); and 5) site improvements including extension of utilities, road improvements, and construction of the water tanks. The Project includes several parcels located within unincorporated Mendocino County within the Ukiah Western Hills referred to as the “Hull Properties” (APNs 001-040-83, 157-070 -01, 157-070 - 02, 003-190 -01, 157 -050 -09, 157-060 -02, 157 -050-02, 157-050-04, 157-050-01, 157-030-02, 157-030-03, 157-050-11 & 157-050-12); “Noguera Properties” (APNs 003-190-09 & 003-110-90); and the City-owned “Donation Parcel” (APNs 157-050-03,157-060-003). The following Conditions of Approval apply to the Project. City of Ukiah Special Conditions 1. In accordance with LAFCo-adopted procedures, and as required under the Development Agreement, the City will submit its annexation application to the Mendocino County Local Agency Formation (LAFCo), after it acquires title to the Annexation Parcels, and upon City Council approval of the Proposed Project. 2. An application for annexation and prezoning shall be approved by the Mendocino County Local Agency Formation Commission (LAFCo) prior to the prezoning becoming effective. Prezoning will also require a General Plan Map Amendment and Zoning Map Amendment, upon approval of the annexation application. 3. Upon approval of the annexation application, a copy of the final Lot Line Adjustment shall be provided to the City Engineer for final review before recordation. The final map shall conform to the Subdivision Map Act and Division 9, Chapter 1 of the Ukiah Municipal Code, as applicable. A copy of the recorded Lot Line Adjustment shall be submitted to the Community Development Department prior to submittal of a Use Permit for single family housing within the Development Parcels located within the City’s jurisdiction. Page 305 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 2 4. In accordance with the terms described in the Development Agreement, Hull shall have the option to withdraw the Hull Development Parcels from the City’s annexation application, if LAFCo has failed to approve the annexation within one (1) year from the date the Executive Officer of LAFCo accepts the application as complete. 5. The Initial Study and Mitigated Negative Declaration prepared for the Project (SCH No. 2021040428) found that construction and ground disturbing activities associated with the Development Agreement, future residential development, and site improvements could result in direct significant impacts to Air Quality, Biological Resources, Cultural/Tribal Cultural Resources, Geology and Soils, Hazards and Hazardous Materials, Hydrology and Water Quality, Noise, Utilities and Service Systems, and Wildfire. However, the mitigation measures identified within the Mitigation Monitoring and Reporting Program (Attachment A) shall be implemented as described to reduce potential environmental impacts. These mitigation measures shall apply to all future ground disturbing activities and development (including residential development), as described further in the Mitigation Monitoring Reporting Program. 6. Future residential development of the Development Parcels shall be in accordance with the Hillside Overlay Zoning District regulations contained within UCC Section s 9135-9139. All future development shall require discretionary review and may require additional environmental review. Additional project-specific Conditions of Approval may be required upon review by City departments and applicable agencies. 7. In accordance with the terms described in the Development Agreement, Hull shall retain the right to develop Development Parcels 1-3 prior to annexation. Single-family homes on Development Parcels 1-3 shall be constructed to R1-H standards by including them in the Declaration of Covenants, Conditions, and Restrictions (CC&Rs). In addition, the mitigation measures contained within the ISMND for residential development shall also be included in the CC&Rs and implemented for Development Parcels 1-3 if developed prior to annexation. 8. If development of Development Parcels 1-3 occurs after annexation, development shall comply with all R1-H development standards and be subject to discretionary review, in accordance with the City’s Hillside Overlay District. 9. The Developer shall obtain regulatory permits, including but not limited to a 401 Water Quality Certification, California Department of Fish and Wildlife Lake and Streambed Alteration Agreement, etc., if work is proposed to the existing culverts, or in and around any watercourses in the future, in accordance with existing regulatory requirements. 10. The water tanks shall be painted green or a similar color to blend into the landscape. 11. An address assignment application shall be submitted to assign addresses to the proposed Development Parcels at the time of development. City of Ukiah Standard Conditions 12. City Council approval is not effective until the 10-day appeal period applicable to the project has expired without the filing of a timely appeal. If a timely appeal is filed, the project is subject to the outcome of the appeal and shall be revised as necessary to comply with any modifications, conditions, or requirements that were imposed as part of the appeal. Page 306 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 3 13. All use, construction and the location thereof, or occupancy, shall conform to the application and to any supporting documents submitted therewith, including any maps, sketches, or plot plans accompanying the application or submitted by applicant in support thereof. 14. Any construction shall comply with the "Standard Specifications" for such type of construction now existing or which may hereafter be promulgated by the Engineering Department of the City of Ukiah; except where higher standards are imposed by law, rule, or regulation or by action of the Planning Commission such standards shall be met. 15. The Applicant shall submit verification of all applicable permits or approvals in compliance with all local, state and federal laws to the Community Development Department prior to issuance of building permits. Department of Public Works 16. Future residential development and site improvements (including road and access improvements) shall be reviewed by the Department of Public Works to identify site- specific requirements. 17. Construction projects that would disturb more than one acre of land, would be subject to the requirements of General Construction Activity Stormwater Permit (Construction General Permit Order 2009-0009-DWQ, also known as the CGP), which requires operators of such construction sites to implement stormwater controls and develop a Stormwater Pollution Prevention Plan (SWPPP) identifying specific BMPs to be implemented to reduce the amount of sediment and other pollutants associated with construction sites from being discharged in stormwater runoff. 18. Applicable City water and sewer connection fees shall be paid at the time of building permit issuance. 19. All work within the public right-of-way shall be performed by a licensed and properly insured contractor. The contractor shall obtain an encroachment permit for work within this area or otherwise affecting this area. Encroachment permit fee shall be $45 plus 3% of estimated construction costs. Electric Utility Department 20. A 10-ft. utility easement for any underground distribution extended into the parcel beyond the existing PUE shall be required. Prior to recordation of the Lot Line Adjustment easements must be surveyed and deeded or defined on the map. Alterations to the 10-ft. utility easement shall be submitted to the COUEUD for approval. 21. Upon individual parcel development, additional easements may be required to provide electric service. 22. Future site improvements shall be submitted to the Electric Utility Department for review and comment. Construction requirements and associated developer costs will be determined to provide electric service. 23. Developer shall incur all costs of project, to include labor, materials, and equipment. Page 307 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 4 Building Division 24. Submit plans and building permit application. Please submit four complete plan sets, two wet stamped and signed. All Conditions of Approval shall be printed on the first page of the Building Plans. 25. The design and construction of all site alterations shall comply with the current California Building Code, Plumbing Code, Electrical Code, California Mechanical Code, California Fire Code, California Energy Code, Title 24 California Energy Efficiency Standards, California Green Building Standards Code and City of Ukiah Ordinances and Amendments. Ukiah Valley Fire Authority 26. All access improvements, roadways and residential development shall be reviewed by the Fire Marshall and adhere to all current local, state and federal fire regulations relating to access and safety, including but not limited to: California Building Code, Chapter 7A (Materials and Construction Methods for Exterior Wildfire Exposure, including Wildland Urban Interface regulations); California Residential Code, Section R337 (Materials and Construction Methods for Exterior Wildlife Exposure); California Referenced Standards Code, Chapter 12-7A (Fire Resistive Standards); California Code of Regulations, Title 14, Division 1.5, Chapter 7, Subchapter 3 (Fire Hazard Reduction Around Buildings and Structures); and California Government Code, Section 51182 (Very High Fire Hazard Severity Zones). In addition, Public Resources Code Sections 4290 and 4291 contain additional requirements for lands within Very High Fire Severity Zones. These include the following in order to provide defensible space and fire protection for new construction and ensure adequate emergency access: increased property line setbacks for all applicable construction; on-site water storage for fire protection, driveway/roadway types and specifications based on designated usage; all weather driveway/roadway surfaces being engineered for 75,000lb vehicles; maximum slope of 16%; turnout requirements; gate requirements and setbacks, parking standards, fuels reduction regulations, etc. Page 308 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 5 ATTACHMENT A UKIAH WESTERN HILLS OPEN LAND & LIMITED DEVELOPMENT AGREEMENT PROJECT MITIGATION MONITORING REPORTING PROGRAM Potential Impact Mitigation Measure Implementation Responsibility Monitoring & Reporting Responsibility Timing Date Implemented Construction and ground disturbing activities could result in short- term impacts to air quality. AQ-1: Diesel Engines – Stationary and Portable Equipment and Mobile Vehicles: 1. Any stationary onsite diesel IC engines 50 horsepower or greater (i.e. large power generators or pumps) or any propane or natural gas engines 250 horsepower or greater may require a permit from the District. 2. Portable diesel powered equipment that may be used during the proposed project are required to be registered with the state Portable Equipment Registration Program (PERP) or obtain permits from the District. 3. Projects located adjacent to sensitive receptors (schools, child care facilities, health care facilities, senior facilities, businesses, and residences, etc.) during the construction phase of this project have the potential for exposure to diesel particulate. 4. Heavy duty truck idling and off-road diesel equipment or other diesel engine idling is limited to less than 5 minutes. Developer Developer During construction and ground disturbing activities AQ-2: Grading Projects- During Construction-All grading activities must comply with the following fugitive dust mitigation measures in accordance with District Regulation 1, Rule 1-430: 1. All visibly dry disturbed soil road surfaces shall be watered to minimize fugitive dust emissions. Developer Developer During construction and ground disturbing activities Page 309 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 6 2. All unpaved surfaces, unless otherwise treated with suitable chemicals or oils, shall have a posted speed limit of 10 mph. 3. Earth or other material that has been transported by trucking or earth moving equipment, erosion by water, or other means onto paved streets shall be promptly removed. 4. Asphalt, oil, water, or suitable chemicals shall be applied on materials stockpiles, and other surfaces that can give rise airborne dusts. 5. All earthmoving activities shall cease when sustained winds exceed 15 mph. 6. The operator shall take reasonable precautions to prevent the entry of unauthorized vehicles onto the site during non-work hours. 7. The operator shall keep a daily log of activities to control fugitive dust. 8. For projects greater than one acre or one mile of road not located within a Naturally Occurring Asbestos Area, prior to starting any construction the applicant is required to: 1. Submit a Large Area Grading permit application to the District. 2. Obtain a final determination from the Air Quality Management District as to the need for an Asbestos Dust Mitigation Plan and/or Geologic Survey to comply with CCR sections 93106 and 93105 relating to Naturally Occurring Asbestos. 3. Obtain written verification from the District stating that the project is in compliance with State and Local regulations relating to Naturally Occurring Asbestos. 4. If the project is located within a Naturally Occurring Asbestos Area, additional mitigations shall be required. Page 310 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 7 AQ-3: Property Development-Prior to starting any construction, the applicant is required to: a. Obtain a Property Development Permit from the District for any open outdoor burning. b. Obtain a Grading Permit, if applicable. c. Confirm whether the project is in a Naturally Occurring Asbestos Area, and follow additional MCAQMD recommendations, if applicable. d. Consider alternate means of disposal other than open burning, such as cutting the majority of the larger material up as firewood, and chipping smaller material, if feasible to mitigate impacts from open outdoor burning. e. Obtain written verification from the MCAQMD stating that the project is in compliance with State and Local regulations. Developer Developer Prior to construction Biological Resources Construction and ground disturbing activities could result in impacts to sensitive plant species and sensitive woodland tree habiat BIO-1: Sensitive Trees. If trees are proposed for removal, preconstruction surveys shall be conducted by a qualified biologist to identify Oregon white oak forest and woodland, as well as California bay forest and woodland habitat; removal of sensitive habitat shall be conducted in accordance with California Department of Fish and Wildlife (CDFW) regulations. Qualified Biologist Developer Prior to ground disturbing activities Construction and ground disturbing activities could impact Red-belly newt, and other special status amphibians and their habitat BIO-2: Sensitive Amphibian Species. A qualified biologist shall survey the area prior to any groundbreaking activities to determine the presence of Red-belly newt, or other sensitive amphibian species, and identify additional avoidance measures, if needed. A qualified biologist shall be on-site for any dewatering event to address the potential for the presence of Qualified Biologist Developer Prior to ground disturbing activities Page 311 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 8 sensitive amphibian species such as foothill yellow- legged frog (Rana boylii). Construction, vegetation removal, and ground disturbing activities could impact nesting birds and their habitat BIO-3: Nesting Birds. Pre-construction surveys shall be conducted prior to any vegetation removal or ground disturbing activities occurring between March 1 and August 31 of any year. All active bird nests shall not be removed, relocated, or otherwise disturbed for any purpose until all fledglings have left the nest. Qualified Biologist Developer Prior to vegetation removal or ground disturbing activities between March 1 and August 31 Construction and ground disturbing activities could impact special- status insects and their habitat BIO-4: Special-Status Insects. A qualified biologist shall survey the area prior to any groundbreaking activities to determine the presence of special-status insect species and identify additional avoidance measures if needed. If a special-status insect nests are observed, active nests shall not be removed, relocated, or otherwise disturbed until the nest becomes inactive. Qualified Biologist Developer Prior to ground disturbing activities Construction and ground disturbing activities could impact special- status mammals and their habitat BIO-5: Special-Status Mammals. Pre-construction surveys shall be conducted prior to any vegetation removal or ground disturbing activities. If evidence of bat roosts is observed (i.e. bat guano, ammonia odor, grease stained cavities) around trees or structures, pre-construction bat surveys shall be conducted by a qualified biologist for activities that may affect bat roosting habitat and den sites. Qualified Biologist Developer Prior to ground disturbing activities Cultural Resources and Tribal Cultural Resources Page 312 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 9 Ground disturbing activities have the potential for accidental discovery of unknown, undiscovered cultural resources and tribal cultural resources CUL-1: Unanticipated Discovery. If previously unidentified cultural, historic, palentologic or archeologic resources are encountered during project implementation, altering the materials and their stratigraphic context shall be avoided and work shall halt immediately. A qualified professional archaeologist shall be contacted to evaluate the resource and methods necessary to protect it. Project personnel shall not collect, move, or disturb cultural resources. Prehistoric resources include, but are not limited to, chert or obsidian flakes, projectile points, mortars, pestles, and dark friable soil containing shell and bone dietary debris, heat-affected rock, or human burials. Historic resources include stone or abode foundations or walls; structures and remains with square nails; and refuse deposits or bottle dumps, often located in old wells or privies. Qualified archaeologist Developer During ground disturbing activities Ground disturbing activities have the potential for accidental discovery of unknown Native American remains CUL-2: Encountering Native American Remains. If human remains are encountered during ground disturbing activities, all work shall stop in the immediate vicinity of the discovered remains and the County Coroner and a qualified archaeologist shall be notified immediately so that an evaluation can be performed. If the remains are deemed to be Native American and prehistoric, the Native American Heritage Commission must be contacted by the Coroner so that a “Most Likely Descendant” can be designated and further recommendations regarding treatment of the remains will be provided. Qualified archaeologist Developer During ground disturbing activities Geology and Soils Ground disturbing activities could result in impacts associated with Incorporation of Mitigation Measure CUL-1 Qualified archaeologist Developer During ground disturbing activities Page 313 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 10 erosion, the loss of topsoil and landslides if not properly designed GEO-1: The Project shall comply with the erosion and design standards outlined in Chapter 7 of the Ukiah City Code. Prior to any ground disturbance, erosion and sediment control plans shall be submitted to the Public Works and Community Development Departments for review and approval. Said plans shall protect against soil erosion and runoff through the implementation of appropriate Best Management Practices (BMPs). Typical BMPs include the placement of straw, mulch, seeding, straw wattles, silt fencing, etc. No silt, sediment or other materials shall be allowed to flow from the project area. Developer Developer Prior to any ground disturbance and throughout construction activities; ongoing as needed to control erosion Hazards and Hazardous Materials Project construction could result in a hazard to the public or the environment if the incidental use of petroleum hydrocarbons (fuel, oil) in tools used during construction were to lead to accidental leaks or spills in or around the work area HAZ -1: The developer shall establish and implement construction site management practices that will prevent toxic materials and other debris from entering the City’s storm drainage and waterway systems, including: a) There shall be no storage of hazardous materials at the Project Site; b) The developer shall provide adequate materials management, including covering, securing, and segregating potentially toxic materials (grease, oils, fuel, solvents, etc.); and c) The developer shall maintain supplies on-hand to contain spills of oil and any other hazardous materials used on-site. Developer Developer During construction Construction of the Project may involve the use of gasoline-powered tools and equipment potentially HAZ-2: Should portable gasoline-powered equipment be used on site, the following firesafe precautions shall be taken: a) Spark arresters are required on all portable gasoline-powered equipment. b) Equipment shall be maintained in good working condition, with exhaust systems and spark Developer Developer During construction Page 314 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 11 introducing new temporary sources of ignition that could increase fire risk. arresters in proper working order and free of carbon buildup. c) Fuel the equipment in a safe place where spills can be contained and a fire extinguisher is nearby. Use the recommended gas/oil mixture and do not top off. Use a funnel or spout for pouring. Wipe off any spills. d) Do not refuel running or hot equipment. Dispense fuel at least 10 feet from sources of ignition. e) Do not use equipment in areas of dry vegetation. Keep leaves and dry materials away from a hot muffler. f) No smoking or open flame allowed near gasoline- powered equipment. Hydrology and Water Quality Ground disturbing activities and construction of the project would result in impervious surfaces that could impact water quality Implementation of Mitigation Measures GEO-1 and HAZ-1 Developer Developer Prior to and during construction; ongoing as needed to control erosion Noise Ground disturbing activities and construction of the project would result in temporary noise impacts NOI-1: Prior to building permit or grading permit issuance, the developer shall comply with the following: a. Construction contracts shall specify that all construction equipment, fixed or mobile, shall be equipped with properly operating and maintained mufflers and other state-required noise attenuation devices. b. Construction haul routes shall be designed to avoid or lessen impacts to noise-sensitive uses Developer Developer Prior to issuance of building or grading permits, and during construction Page 315 of 800 Draft Conditions of Approval Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 12 (e.g., residences, schools, convalescent homes), to the extent feasible. c. During construction, stationary construction equipment shall be placed such that emitted noise is directed away from sensitive noise receivers. d. Per the City’s Noise Ordinance, construction shall not take place outside of the hours of 7:00 a.m. to 7:00 p.m. Utilities and Service Systems City sewer, water and electric utilities would be extended to the area which could result in physical impacts to the environment Implementation of BIO-1 through BIO-5, and GEO-1. See BIO-1 through BIO-5 and GEO-1 See BIO-1 through BIO-5 and GEO-1 See BIO-1 through BIO-5 and GEO-1 Wildfire Construction of the Project may involve the use of gasoline-powered equipment and machinery, potentially introducing new sources of ignition that could increase fire risk Implementation of Mitigation Measure HAZ -2 Developer Developer During construction Page 316 of 800 Findings Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 1 ATTACHMENT 5 DRAFT FINDINGS TO ADOPT AN INITIAL STUDY/MIT IGATED NEGATIVE DECLARATION AND FOR APPROVAL OF THE UKIAH WESTERN HILLS OPEN LAND ACQUISITION & LIMITED DEVELOPMENT AGREEMENT PROJECT, AND ORDINANCE FOR PREZONING FILE NO.: 20-5915. The Community Development Department’s recommendation for approval of an Initial Study/Mitigated Negative Declaration (SCH No. 2021040428) and conditional approval of the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project (‘Proposed Project”) including: 1) Acquisition and annexation of approximately 707 acres; 2) Prezoning the Conservation Parcels to PF and Development Parcels to R1-H (and associated Zoning Map and General Plan Map Amendments upon approval of the annexation application; 3) Sequential Lot Line Adjustments; 4) Development Agreement between Hull Properties and the City of Ukiah; and 5) Associated site improvements including extension of utilities, road improvements, and construction of the water storage tank(s), is based in part on the following findings, in accordance with UCC §9267 and §8297, as well as the Subdivision Map Act, Section 65895 of the Government Code and CEQA Guidelines Section 15074. 1. The proposed parcels for annexation would be contiguous to existing City of Ukiah city limits, in accordance with LAFCo policies and the Government Code Section 65895. 2. In accordance with LAFCo-adopted procedures, and as required under the Development Agreement, the City will submit its annexation application to the Mendocino County Local Agency Formation (LAFCo), after it acquires title to the Annexation Parcels, and upon City Council approval of the Proposed Project. As further described in the Staff Report, the Proposed Project would be consistent with the City’s General Plan Zoning Code, the County’s Ukiah Valley Area Plan, as well as the Government Code and LAFCo policies related to annexation and prezoning. Although the City’s General Plan and County’s Ukiah Valley Area Plan (UVAP) do not contain specific policies related to prezoning, they do contain goals and policies that strive for orderly, clustered development, and support the City’s and County’s Regional Housing Needs Allocation (RHNA) goals and conservation of open space. The City’s 2019-2027 Housing Element includes Goal H-5 and Policy 5-1 which seek to support future housing needs through annexation efforts that lead to orderly expansion of growth. Similarly, the County’s 2019-2027 Housing Element includes Policy 1.3 and Actions 1.3a through 1.3d that strive to work cooperatively with cities within the County on regional housing, support annexation applications to the Mendocino LAFCo from incorporated cities for annexations of contiguous lands etc. 3. The proposed Development Parcels (totaling approximately 54 acres) proposed for annexation are located within the ‘95 General Plan’s Unincorporated Planning Area, as well as the current UVAP/SOI boundary, and are consistent with the density and intent of the Low Density (LDR) land use designation and Single-Family Residential-Hillside Overlay Zoning District (R1-H) zoning. 4. Because the portion of the Conservation Parcels within the City’s current SOI (343 acres) are within the City’s ‘95 General Plan Unincorporated Planning Area, the proposed annexation Page 317 of 800 Findings Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 2 and ‘PF” prezoning (with a P General Plan land use designation) is consistent with the intent and land uses identified within the ‘95 General Plan. In addition, the City can utilize its Parks Ordinance (Division 1, Chapter 12 of the Ukiah City Code) to provide rules governing City and public use of “PF” zoned property. The approximately 296 acres of Conservation parcels located outside of the SOI proposed for annexation and PF prezoning are consistent with Government Code Section 56742 that states city-owned parcels proposed for annexation can be located anywhere in the County, as long as they are less than 300 acres, owned by the City, and used for municipal purposes at the time of the annexation application. 5. In accordance with UCC Section §9267, Prezoning, the City may prezone unincorporated territory adjoining the City for the purpose of determining the zoning which will apply to such property in the event of subsequent annexation to the City. Prezoning of the parcels will also require a Zoning Map and General Plan Map Amendment upon approval of the annexation application by LAFCo. 6. To achieve the resulting proposed parcel configuration of up to seven Development Parcels, the Project includes sequential Lot Line Adjustments in both the City and County jurisdictions, in accordance with the Subdivision Map Act.1 Although Development Parcels 1-3 may be developed prior to annexation, they will be developed in accordance with R1-H regulations through Declaration of Covenants, Conditions, and Restrictions (CC&Rs). Review of the Lot Line Adjustments will be conducted by the City Engineer prior to recordation of the final maps to ensure that all development standards contained within the R1-H zoning district are met. 7. Although the final configuration of the Development Parcels may vary slightly, the footprint of the resulting configuration for the Development Parcels (54 acres) and number of parcels will remain the same. The Lot Line Adjustments will not create a greater number of parcels than existed prior to the adjustments and will not result in an increase in the number of nonconforming parcels, nor will it increase the nonconformity of any parcel. 8. The project was evaluated by various departments and agencies including (but not limited to) the City Engineer, City Building Division, City Department of Public Works, the County of Mendocino, Ukiah Valley Fire Authority, California Department of Forestry and Fire Protection, etc. and conditions of approval have been incorporated to ensure public safety and access. 9. The potential development of seven single-family residential units and associated accessory dwelling units is compatible with surrounding land uses and will not be detrimental to the public’s health, safety, and general welfare. All future single-family residential development within the City’s jurisdiction will be subject to the City’s development regulations and discretionary review, as outlined in the Hillside Overlay Zoning District, as well as the mitigation measures identified in the Initial Study and Mitigated Negative Declaration for the Project. 10. In accordance with Sections 15070 through 15075 and Appendix G of the California Environmental Quality Act (CEQA) Guidelines, th e Planning Division prepared an Initial Study and Mitigated Negative Declaration (SCH No. 2021040428) for the Proposed Project. 11. In accordance with CEQA Guidelines Section 15073 the ISMND (State Clearinghouse No. 2021040428) was circulated for public review and comment on April 16, 2021 through May 20, 2021. 1 The Subdivision Map Act excludes from its requirements lot line adjustments “between four or fewer existing adjoining parcels” if there is no resulting increase in the number of parcels. Government Code § 66412(d) Page 318 of 800 Findings Western Hills Open Land Acquisition & Limited Development Agreement Project File No.: 20-5915 3 12. Because the revisions and clarifications summarized within the Reponses to public comments document and others made to the Final Draft ISMND (dated August 16, 2021) are for clarification purposes and/or do not result in a new significant effect that was previously not analyzed within the Draft ISMND, recirculation of the ISMND is not required (CEQA Guidelines Section 15073.5(a)). 13. The ISMND found that Project components including the acquisition, annexation, and prezoning of parcels (and associated Zoning Map and General Plan Map Amendments), in addition to the Lot Line Adjustments, would not result in impacts to the physical environment. However, construction and ground disturbing activities associated with the Development Agreement, future residential development, and site improvements could result in direct significant impacts to Air Quality, Biological Resources, Cultural/Tribal Cultural Resources, Geology and Soils, Hazards and Hazardous Materials, Hydrology and Water Quality, Noise, Utilities and Service Systems, and Wildfire. However, mitigation measures identified within the aforementioned sections and incorporated into the Mitigation Monitoring Repotting Program would reduce all impacts to less than significant. Tribal consultation was conducted and completed with Pinoleville Pomo Nation in accordance with Assembly Bill 52. 14. Based on information contained with the Staff Report, ISMND, public comments, and the whole record there is no substantial evidence that the Project will have a significant effect on the environment. 15. The Notice of Intent to adopt the ISMND and conduct a public hearing was provided in the following manner, in accordance with Ukiah City Code (UCC) §9267 and California Environmental Quality Act (CEQA) Guidelines Section 15073: • Provided to property owners within 300 feet of the project parcels, as well as agencies and departments with jurisdiction or interest over the project on April 16, 2021, June 1, 2021 and August 13, 2021; • Provided to members of the public, agencies, and interested parties who submitted written comments on the Draft ISMND during the public review period on August 13, 2021; • Published in the Ukiah Daily Journal on April 24, 2021, June 5, 2021 and August 14, 2021; • Posted on the Project site on May 3, 2021, June 1, 2021, and August 11; • Posted at the Civic Center (glass case) 72 hours prior to each public hearing; • Noticed for continuance at the May 26, 2021 Planning Commission hearing to a date certain of June 9, 2021; and • Notice for continuance at the June 9, 2021 Planning Commission to a date uncertain. In addition, based on the amount of interest in the Project and to receive as much public input as possible, additional public noticing was conducted in the following manner: • Posted on the City of Ukiah website on April 16, 2021 and August 16, 2021; • Emailed to Planning Commissioners and City Councilmembers on April 16, 2021 and August 13, 2021; • Hand-delivered to all residences (in addition to and beyond the 300-foot requirement) on Redwood Avenue on May 13, 2021 and mailed to all residences on Redwood Avenue on August 11, 2021. Page 319 of 800 1 ORDINANCE NO. UNCODIFIED ORDINANCE OF THE CITY COUNCIL OF THE CITY OF UKIAH TO PREZONE CERTAIN PARCELS IN ASSOCIATION WITH THE WESTERN HILLS OPEN LAND ACQUISITION AND LIMITED DEVELOPMENT PROJECT. The City Council of the City of Ukiah hereby ordains as follows: SECTION ONE. FINDINGS 1.The City proposes to acquire and annex approximately 707 acres total, including the “Hull Properties” (APNs 001-040-83, 157-070-01, 157-070-02, 003-190-01, 157- 050-09, 157-060-02, 157-050-02, 157-050-04, 157-050-01, 157-030-02, 157- 030- 03, 157-050-11 & 157-050-12),the “Noguera Properties” (APNs 003-190-09 & 003- 110-90) and the City-owned “Donation Parcel” (APNs 157-050-03,157-060- 003) in the Western Hills for open space preservation, while allowing the potential for future low-density residential development on the approximately 54 easternmost acres (“Development Parcels”), consistent with existing development in the Western Hills within the City of Ukiah limits; and 2.Government Code Section 65859 allows the City to adopt a zoning district for land outside of the city limits in anticipation of annexation and development, i.e. prezone. 3.Government Code Section 56742 allows the City to annex parcels that are not located within the City's Sphere of Influence (“SOI”), provided that those parcels are located in the County of Mendocino, less than 300 acres, owned by the City, and used for municipal purposes at the time of the annexation application. SECTION TWO. The City Council of the City of Ukiah hereby ordains that: 1.The City will apply to annex approximately 640 acres total referred to as the “Conservation Parcels”, for open space and conservation. The Conservation Parcels will be pre-zoned with a Public Facilities (PF) zoning designation, which encompasses lands within the City that contain open space and parks, as well as other public facilities. Approximately 343 acres of the Conservation Parcels are located within the City’s SOI and 296 acres outside of it. 2.The proposed Development Parcels (totaling approximately 54 acres) will be zoned to Single-Family Residential-Hillside Overlay District (R1-H) with a General Plan Designation of Low Density Residential (LDR), consistent with adjacent City zoning and development patterns in the Western Hills. In addition, the Noguera Properties will be zoned R1-H for consistency with surrounding zoning and land uses. 3.A map of the affected territories is set forth in Exhibit A, and the parcel configuration, intended use, and proposed prezoning of the affected territories are set forth in Exhibit B, attached hereto and by reference incorporated herein. SECTION THREE. ATTACHMENT 6 Page 320 of 800 2 1.Publication: Within fifteen (15) days after its adoption, this Ordinance shall be published once in a newspaper of general circulation in the City of Ukiah. In lieu of publishing the full text of the Ordinance, the City may publish a summary of the Ordinance once 5 days prior to its adoption and again within fifteen (15) days after its adoption. 3.Effective Date: Section 2 and 3 of this ordinance shall become effective as of the date that the annexation of the Conservation Parcels, Development Parcels, and Noguera Properties becomes final. Introduced by title only on __________, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: Adopted on ___________, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: _______________ Juan V. Orozco, Mayor ATTEST: _______ Kristine Lawler, City Clerk Page 321 of 800 APN:00104083 APN:00319001 APN:15707002 APN:15707001 APN:15705009 APN:15705011 APN:15705012 APN:15705002 APN:15706003 & 157050003  APN:157030003 APN:15703002 APN:15705001 APN:15705004 APN:15706002 Sphere of Influence   APNs:003-190-09 & 003-110-90 Ukiah Western Hills Open Land Acquisition & Limited Development Project Annexation Parcels (+/-707ac) Parcel Donation to City Development Parcels (+/-54ac) Proposed Water Tanks Sphere of Influence City Limits Existing Access Road This map is a guide. Every reasonable effort has been made to ensure accuracy of the map and data provided. Parcel lines are not intended to represent surveyed data.Document Path: S:\Public Works\Stricklin, Andrew\GIS\Projects\Planning\Western Hills Project Figure 1 Exhibit A Location Map Page 322 of 800 :k,E E ;I . f i tH N - SE ; r $; i T s: t q .. E B €E '. ,6E !9o fEq\ $oR IIEo*)EqI\0 'i i*)h 'l x.xr{II -- - - - - - - - - - - - - - - - - t IIIIIIIIIIIIIIIIIII *t * r. Y E fi b i o-\ fNs €f{dq :B r d$ E 't $ o :* Bet r .t ) $ tN se $ b "E S 8 fr E& t s $ tB t^ . b I r. S a- oB s so{qo0bEob u= $ H n ii $ - * 5 a' " . € * \ RS N rt f , $t i $ n fc $ * N $ Es S R Figure 2 Existing Parcel Configuraton Page 323 of 800 Proposed Parcel Configuration & Prezoning for Western Hills (Hull Properties) Open Land Acquisition & Limited Development Agreement Project Sphere of Influence Conservation Parcels” (640ac) with Public Facilities (PF) Prezoning “Development Parcels (54ac) with Single-Family Residential- Hillside Overlay District (R1-H) Prezoning Last revised June 2, 2021 Figure 3 Proposed Parcel Configuration & Prezoning Exhibit B Page 324 of 800 EXHIBIT B- ANNEXATION PARCELS AND PREZONING Assessor’s Parcel Number (APN) Existing Size (+/acres) Proposed Size (+/-acres) through Lot Line Adjustments1 Resulting Parcel Configuration, Intended Use and Proposed Prezoning 001-040-83 77.6 9.8 Parcel 1 will become a Development Parcel intended for single family housing and prezoned R1-H. 157-070 01, 157-070-02, 003-190-01 & 157-050-09 148.2 5.1 Parcel 2 on Existing Conditions Tentative Map, contains several APNs but is one legal parcel (149 acres total). This parcel will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-11 40.0 9.9 Parcel 3 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-02 40.5 9.0 Parcel 4 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-01 40.3 5.0 Parcel 5 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-030-02 20.0 9.7 Parcel 6 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-12 40.0 5.0 Parcel 7 will become a Development Parcel intended for single-family housing and prezoned R1-H. 157-050-04 & 157-060-02 38.7 391.5 Parcel 8 will become a Conservation Parcel and be prezoned PF. The proposed water tanks will be placed on this parcel within the existing water tank pad site (on existing Parcel 2). 157-030-03 60.0 60.0 Parcel 9 is an Conservation Parcel and will prezoned PF. 157-030-03 & 157-060-03 188.5 188.5 Parcel 10 (City-owned “Donation Parcel”) will become a Conservation Parcel and will be prezoned PF. “Noguera Properties” 003-190-09 & 003-110-90 10.20 4.14 10.20 4.14 These parcels contain the existing access road that will be improved but remain under private ownership. It will be included in the annexation proposal and prezoned R1-H, consistent with surrounding zoning and land uses, but no development is proposed; this parcel is not included in the Lot Line Adjustment. TOTAL +/- 707 acres 1 Resulting parcel configuration is subject to change but the Development Parcel area footprint and number of resulting parcels will remain the same. Page 325 of 800 &$/,)251,$(19,5210(17$/48$/,7<$&7 ),1$/'5 $)7 ,1,7,$/678'<$1' 0,7,*$7('1(*$7,9('(&/$5$7,21 )25 8.,$+:(67(51+,//623(1/$1'$&48,6,7,21$1' /,0,7(''(9(/230(17$*5((0(17 -XQH 5HYLVHGAugust 6&+1R Prepared by: &LW\RI8NLDK &RPPXQLW\'HYHORSPHQW'HSDUWPHQW 3ODQQLQJ'LYLVLRQ 6HPLQDU\$YHQXH8NLDK&$ ATTACHMENT 7 Page 326 of 800 7DEOHRI&RQWHQWV I. PROJECT INFORMATION 1 II.PROJECT DESCRIPTION 2 1.Project Location 2 2.Environmental Setting 2 3.Background 3 4.Project Components 3 ACQUISITION & ANNEXATION 4 PREZONE 4 LOT LINE ADJUSTMENT 6 DEVELOPMENT AGREEMENT & ASSUMPTIONS 7 INFRASTRUCTURE IMPROVEMENTS 8 CONSTRUCTION 9 III.ENVIRONMENTAL FACTORS POTENTIALLY AFFECTED 14 IV.DETERMINATION 16 V. EVALUATION OF ENVIRONMENTAL IMPACTS 17 1.Aesthetics 17 2.Agriculture and Forestry Resources 20 3.Air Quality 21 4.Biological Resources 25 5.Cultural Resources 29 6.Energy 33 7.Geology and Soils 34 8.Greenhouse Gas Emissions 37 9.Hazards and Hazardous Materials 38 10.Hydrology and Water Quality 42 11.Land Use and Planning 44 12.Mineral Resources 48 13.Noise 48 14.Population and Housing 51 15.Public Services 53 16.Recreation 54 17.Transportation 55 18.Tribal Cultural Resources 58 19.Utilities and Service Systems 59 20.Wildfire 62 21.Mandatory Findings of Significance 64 VI.REFERENCES 66 VII.MITIGATION MONITORING AND REPORTING PROGRAM 69 $77$&+0(176 $([LVWLQJ6LWH3KRWRJUDSKV %%LRORJLFDO5HVRXUFH$VVHVVPHQW %$GGHQGXPIRU5DUH3ODQW$VVHVVPHQWDQG%RWDQLFDO6XUYH\ &/LVWLI7ULEHV&RQWDFWHGIRU$% '3XEOLF&RPPentV5HFHLYHGRQWKH'UDIW,QLWLDO6WXG\ 0LWLJDWHG1HJDWLYH 'HFODUDWLRQDQG&iW\5HVSRnsesWR&RPPHQWV Page 327 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK , 352-(&7,1)250$7,21 3URMHFW7LWOH 8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW /HDG$JHQF\$GGUHVVDQG3KRQH1XPEHU &LW\RI8NLDK 6HPLQDU\$YHQXH 8NLDK&DOLIRUQLD   5HVSRQVLEOH$JHQF\ 0HQGRFLQR&RXQW\/RFDO$JHQF\)RUPDWLRQ&RPPLVVLRQ /$)&R  &RQWDFW8PD+LQPDQ([HFXWLYH2IILFHUHR#PHQGRODIFRRUJ 66FKRRO6WUHHW8NLDK&$ 3URMHFW&RQWDFW3HUVRQDQG3KRQH1XPEHU 0D\D6LPHUVRQ3URMHFW$GPLQLVWUDWRU &LW\RI8NLDK&LW\0DQDJHU¶V2IILFH   PVLPHUVRQ#FLW\RIXNLDKFRP &(4$&RQWDFW3HUVRQDQG3KRQH1XPEHU 0LFKHOOH,UDFH3ODQQLQJ0DQDJHU &LW\RI8NLDK&RPPXQLW\'HYHORSPHQW'HSDUWPHQW   PLUDFH#FLW\RIXNLDKFRP 3URMHFW/RFDWLRQ 8QLQFRUSRUDWHG8NLDK:HVWHUQ+LOOV³+XOO3URSHUWLHV´ $31V          DQGWKH&LW\RZQHG³'RQDWLRQ3DUFHO´ $31V  ,QDGGLWLRQWKH³1RJXHUD3URSHUWLHV´ $31V  DUH LQFOXGHGLQWKHDQQH[DWLRQSURSRVDOIRUDFFHVVRQO\ &XUUHQW&RXQW\RI0HQGRFLQR*HQHUDO3ODQ'HVLJQDWLRQ 0HQGRFLQR&RXQW\*HQHUDO3ODQ 8NLDK9DOOH\$UHD3ODQ 5HPRWH5HVLGHQWLDO$FUH0LQLPXP ³505´  3URSRVHG&LW\RI8NLDK*HQHUDO3ODQ'HVLJQDWLRQ /RZ'HQVLW\5HVLGHQWLDO /'5 DQG3XEOLF 3  &XUUHQW&RXQW\RI0HQGRFLQR=RQLQJ'LVWULFW 8SODQG5HVLGHQWLDODFUHPLQLPXP ³85´  3URSRVHG&LW\RI8NLDK=RQLQJ'LVWULFW 6LQJOH)DPLO\5HVLGHQWLDO+LOOVLGH2YHUOD\'LVWULFW 5+ DQG3XEOLF)DFLOLWLHV 3)  Page 328 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK ,, 352-(&7'(6&5,37,21 3URMHFW/RFDWLRQ 7KH3URMHFWSDUFHOVDUHFXUUHQWO\ORFDWHGZLWKLQXQLQFRUSRUDWHG0HQGRFLQR&RXQW\ZLWKLQWKH8NLDK :HVWHUQ +LOOV  $V D SDUW RI WKH3URMHFW WKH &LW\ RI 8NLDK LV SURSRVLQJ WR DFTXLUH DQG DQQH[ DSSUR[LPDWHO\DFUHVNQRZQDVWKH³+XOO3URSHUWLHV´ $31V    DQGWKH&LW\RZQHG³'RQDWLRQ3DUFHO´ $31V  LQWRWKH&LW\RI8NLDK¶VFLW\OLPLWVDVVKRZQLQ7DEOH,QDGGLWLRQWKH³1RJXHUD3URSHUWLHV´ $31V  WRWDOLQJDSSUR[LPDWHO\DFUHVZLOOEHLQFOXGHGLQWKHDQQH[DWLRQ SURSRVDOIRUDFFHVVRQO\$OORIWKHSDUFHOVDUHFXUUHQWO\ORFDWHGZLWKLQWKH&LW\¶VDGRSWHG6SKHUHRI ,QIOXHQFH 62, ZLWKWKHH[FHSWLRQRI$31VDQGDSRUWLRQRI $31VDQG WRWDOLQJDSSUR[LPDWHO\ DFUHV 6HH)LJXUH3URMHFW/RFDWLRQ0DS$VDSDUWRIWKH3URMHFWWKH&LW\RI8NLDKLVSURSRVLQJWR DFTXLUH ZLWKWKHH[FHSWLRQRIWKH1RJXHUD3URSHUWLHVZKLFKZLOOUHPDLQSULYDWHO\RZQHG DQGDQQH[ DOORIWKHDIRUHPHQWLRQHGSURSHUWLHVLQWRWKH&LW\RI8NLDK¶VFLW\OLPLWV (QYLURQPHQWDO6HWWLQJ 7KH3URMHFWDUHDLVVLWXDWHGZLWKLQWKH&RDVW5DQJHJHRORJLFSURYLQFH7KH1RUWK&RDVW5DQJHLV FRPSULVHGRIDJHRORJLFIHDWXUHXQLTXHWR&DOLIRUQLDWKH)UDQFLVFDQ)RUPDWLRQZKLFKGLFWDWHVWKH YHJHWDWLYHFRPPXQLWLHV7KH)UDQFLVFDQ)RUPDWLRQLVFRPSULVHGRIVHUSHQWLQHVDQGVWRQHDQGRWKHU VHGLPHQWDU\URFNV7KLVDUHDLVFKDUDFWHUL]HGE\D0HGLWHUUDQHDQFOLPDWHWKHZLQWHUVDUHFRRODQG ZHWDQGWKHVXPPHUVDUHKRWDQGGU\$QQXDOWHPSHUDWXUHVIRUWKLVUHJLRQUDQJHIURPDERXWWR GHJUHHV)DKUHQKHLW 7KH3URMHFWLVORFDWHGZLWKLQWKH8NLDK9DOOH\ZHVWRIWKH&LW\RI8NLDKLQFHQWUDO0HQGRFLQR&RXQW\ ZLWKHOHYDWLRQVYDU\LQJIURPDSSUR[LPDWHO\IHHWDERYHPHDQVHDOHYHOXSWRDSSUR[LPDWHO\ IHHW LQ WKH KLOOV VXUURXQGLQJ WKH FLW\ LQFOXGLQJ WKH :HVWHUQ +LOOV 7KH 8NLDK YDOOH\ LV ORFDWHG DSSUR[LPDWHO\PLOHVHDVWDQGLQODQGIURPWKH3DFLILF2FHDQ,WUXQVQRUWKVRXWKIRUDSSUR[LPDWHO\ QLQHPLOHVZLWKDPD[LPXPZLGWKRIWKUHHPLOHV7KH5XVVLDQ5LYHUHQWHUVWKHYDOOH\DWWKHQRUWKHQG DQGUXQVVRXWKDORQJWKHYDOOH\IORRU8NLDKLVORFDWHGDORQJWKH+LJKZD\FRUULGRUDQGQHDUWKH HDVWZHVWLQWHUVHFWLRQRI+LJKZD\WZRKRXUVQRUWKRIWKH*ROGHQ*DWH%ULGJH VHH)LJXUH  ,QFRUSRUDWHGLQ8NLDKLVWKHFRXQW\VHDWDQGODUJHVWFLW\LQ0HQGRFLQR&RXQW\ 6RLOVLQWKH3URMHFWDUHDDUHFKDUDFWHUL]HGDVERWK+RSODQGZKLFKFRQVLVWVRIYHU\GHHSZHOOGUDLQHG VRLOVIRUPHGLQFROOXYLXPDQGUHVLGXXPZHDWKHUHGIURPVDQGVWRQHRUVKDOHRQVWHHSKLOOVDQGVORSHV DQG0D\PHQVRLOVWKDWDUHVKDOORZVRPHZKDWH[FHVVLYHO\GUDLQHGVRLOVWKDWIRUPHGLQUHVLGXXP ZHDWKHUHGIURPVKDOHVFKLVWJUHHQVWRQHVDQGVWRQHDQGFRQJORPHUDWH7KHVHVRLOVKDYHDVKDOORZ GHSWKWREHGURFN 7KH3URMHFWVLWH V FRQVLVWVRIPRVWO\XQGHYHORSHGSDUFHOVZLWKILUHEUHDNVDQGSULYDWHDFFHVVURDGV 7KHSDUFHOVDUHFXUUHQWO\DFFHVVHGWKURXJKH[LVWLQJGLUWDQGJUDYHOURDGVWKDWWUDYHUVHWKH1RJXHUD Page 329 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK 3URSHUWLHVDQGFRQQHFWWR5HGZRRG$YHQXH7KHDFFHVVURDGZLGWKUDQJHVIURPIWWRIWZLWK WKHPDMRULW\RILWEHLQJDPLQLPXPRIIWZLGH7KHVHFWLRQVWKDWDUHIWZLGHDUHDSSUR[LPDWHO\ IWORQJDQGKDYHZLGHUWXUQRXWVLPPHGLDWHO\EHIRUHRUDIWHUWKHP,QDVKDGHGIXHOEUHDN ZDVFRQVWUXFWHG 1RUWKWR6RXWK DORQJWKHEDVHRIWKHZHVWHUQKLOOVDORQJWKHHQWLUHOHQJWKRIWKH&LW\ WRUHGXFHIXHOORDGVDQGSURWHFWWKHFRPPXQLW\IURPZLOGILUHULVN0DLQWHQDQFHZDVSHUIRUPHGRQWKH IWZLGHPLOHIXHO EUHDN LQ ODWH  DQG HDUO\  7KH SDUFHOV KDYH EHHQ VXEMHFW WR YHJHWDWLRQPDQDJHPHQWDQGJUDGLQJSUDFWLFHVLQFOXGLQJFOHDULQJDUHDVIRUSRWHQWLDOZDWHUWDQNSDG VLWHVDQGKRXVHVLWHVRYHUWKHODVWVHYHUDO\HDUVWKURXJKWKH&RXQW\¶VSHUPLWWLQJSURFHVV 9HJHWDWLRQRQWKH3URMHFWSDUFHOVLQFOXGHVQDWLYHDQGQRQQDWLYHDQQXDODQGSHUHQQLDOJUDVVHVZLWK GHQVHFKDSDUUDODQGPL[HGKDUGZRRGIRUHVWWKURXJKRXW1DWLYHWUHHVLQWKHDUHDSULPDULO\FRQVLVWRI &DOLIRUQLD ED\ ODXUHO 8PEHOOXODULD FDOLIRUQLFD DQG &DOLIRUQLD EODFN RDN 4XHUFXV NHOORJJLL  8QGHUJURZWKFRQVLVWVODUJHO\RISRLVRQRDN 7R[LFRGHQGURQGLYHUVLOREXP DQG:HVWHUQEUDFNHQIHUQ 3WHULGLXPDTXLOLQLXP 7KHWHUUDLQLVYHU\UXJJHGDQGVWHHS JUHDWHUWKDQVORSHLQPDQ\DUHDV  7KH5XVVLDQ 5LYHUUXQV QRUWK WR VRXWK RQH PLOH HDVW RIWKH3URMHFWDUHD7ZR XQQDPHGFUHHN GUDLQDJHVIORZWKURXJKWZRRIWKHSDUFHOVDWWKHERWWRPRIVWHHSFDQ\RQV,QDGGLWLRQWZRSHUHQQLDO VWUHDPVIORZDSSUR[LPDWHO\IHHWWRWKHQRUWKDQGVRXWK²*LEVRQ&UHHNDQG'RRODQ&UHHN UHVSHFWLYHO\ %DFNJURXQG &HUWLILFDWHVRI&RPSOLDQFHDQG/RW/LQH$GMXVWPHQWVZHUHUHFRUGHGRYHUWKHODVWVHYHUDO\HDUV UHVXOWLQJLQWKHFXUUHQWSDUFHOFRQILJXUDWLRQ VHH)LJXUH 7KHH[LVWLQJURDGZDVLQVWDOOHGLQWKH ¶V DQG URDG LPSURYHPHQWV ZHUH FRPSOHWHG WKURXJKRXW  LQ  WKH URDG ZDV H[WHQGHG IXUWKHU ZHVW ,Q DGGLWLRQ D ZDWHU WDQN SDG VLWH ZDV FOHDUHG DQG GHYHORSHGLQ  9HJHWDWLRQPDQDJHPHQWZDVDOVRSHUIRUPHGRQWKHSURSHUW\WKURXJKRXWDQGLQFOXGHGVLWH SUHS YHJHWDWLRQUHPRYDORQO\QRJUDGLQJ RIWKHVHYHQSRWHQWLDOKRXVHVLWHV SURSRVHG³'HYHORSPHQW 3DUFHOV´  7KH&LW\KDVDYLVLRQDQGLVZRUNLQJWRZDUGVDJRDORISURPRWLQJWKHSURWHFWLRQRI8NLDK¶VZHVWHUQ XUEDQLQWHUIDFHWRUHVWRUHDQGFRQVHUYHIRUHVWDQGVWUHDPHFRV\VWHPVSURYLGHODUJHVFDOHZLOGILUH PLWLJDWLRQDQGWRSURWHFWWKH8SSHU5XVVLDQ5LYHU:DWHUVKHGWREHQHILWILVKZLOGOLIHVFHQLFUHVRXUFHV DQGWKHJUHDWHU8NLDKFRPPXQLW\,QRUGHUWRDFKLHYHWKLVJRDOWKH&LW\SURSRVHVWRDFTXLUHDQGDQQH[ DSSUR[LPDWHO\DFUHV ³+XOO3URSHUWLHV´ LQWKH:HVWHUQ+LOOVIRURSHQVSDFHSUHVHUYDWLRQZKLOH DOORZLQJ WKH SRWHQWLDO IRU IXWXUH ORZGHQVLW\ UHVLGHQWLDO GHYHORSPHQW RQ WKH DSSUR[LPDWHO\  HDVWHUQPRVWDFUHVFRQVLVWHQWZLWKH[LVWLQJGHYHORSPHQWLQWKH:HVWHUQ+LOOVZLWKLQWKH&LW\RI8NLDK OLPLWV,QDGGLWLRQWKH³1RJXHUD3URSHUWLHV´WRWDOLQJDSSUR[LPDWHO\DFUHVDUHLQFOXGHGLQWKH DQQH[DWLRQSURSRVDOIRUDFFHVVRQO\EXWZLOOUHPDLQXQGHUSULYDWHRZQHUVKLS 3URMHFW&RPSRQHQWV 6HFWLRQRIWKH&DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW &(4$ GHILQHVD³3URMHFW´DVDQDFWLYLW\ WKDW   LV D GLVFUHWLRQDU\ DFWLRQ E\ DJRYHUQPHQWDO DJHQF\ DQG   ZLOO HLWKHU KDYH D GLUHFWRU UHDVRQDEO\IRUHVHHDEOHLQGLUHFWLPSDFWRQWKHHQYLURQPHQW 3XE5HV&RGH† ³3URMHFW´ PHDQVWKHZKROHRIDQDFWLRQZKLFKKDVDSRWHQWLDOIRUUHVXOWLQJLQHLWKHUDGLUHFWSK\VLFDOFKDQJHLQ WKHHQYLURQPHQWRUDUHDVRQDEO\IRUHVHHDEOHLQGLUHFWSK\VLFDOFKDQJHLQWKHHQYLURQPHQWDQGWKDWLV DQ\RIWKHIROORZLQJ$QDFWLYLW\GLUHFWO\XQGHUWDNHQE\DQ\SXEOLFDJHQF\LQFOXGLQJEXWQRWOLPLWHGWR SXEOLFZRUNVFRQVWUXFWLRQDQGUHODWHGDFWLYLWLHVFOHDULQJRUJUDGLQJRIODQGLPSURYHPHQWVWRH[LVWLQJ Page 330 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK SXEOLFVWUXFWXUHVHQDFWPHQWDQGDPHQGPHQWRI]RQLQJRUGLQDQFHVDQGWKHDGRSWLRQDQGDPHQGPHQW RIORFDO*HQHUDO3ODQVRUHOHPHQWVWKHUHRISXUVXDQWWR*RYHUQPHQW&RGH6HFWLRQV± $FFRUGLQJO\IRUWKLV&(4$DQDO\VLVWKH³3URSRVHG3URMHFW´LQFOXGHVWKHIROORZLQJ $FTXLVLWLRQDQG DQQH[DWLRQRIWKHSDUFHOV 3UH]RQLQJWKHSDUFHOVWR3)DQG5+ DQGDVVRFLDWHG=RQLQJ0DSDQG *HQHUDO3ODQ0DS$PHQGPHQWVXSRQDSSURYDORIWKHDQQH[DWLRQDSSOLFDWLRQ  6HTXHQWLDO/RW/LQH $GMXVWPHQWVWRUHFRQILJXUHWKHH[LVWLQJSDUFHOVLQWRVHYHQORWV ³'HYHORSPHQW3DUFHOV´ IRUIXWXUH SRWHQWLDOGHYHORSPHQW 'HYHORSPHQW$JUHHPHQWEHWZHHQ+XOO3URSHUWLHVDQGWKH&LW\DOORZLQJXS WRRQHVLQJOHIDPLO\KRPHDQGRQHDFFHVVRU\GZHOOLQJXQLWRQHDFK'HYHORSPHQW3DUFHO XQLWV WRWDO DQG VLWHLPSURYHPHQWVLQFOXGLQJH[WHQVLRQRIXWLOLWLHVURDGLPSURYHPHQWVDQGFRQVWUXFWLRQ RIWKHZDWHUWDQNV(DFKRIWKHVHFRPSRQHQWVDUHGHVFULEHGIXUWKHULQGHWDLOEHORZ $&48,6,7,21 $11(;$7,21 7KH3URMHFWSURSRVHVWRDQQH[WKHSDUFHOVOLVWHGEHORZLQ7DEOHWRWDOLQJDSSUR[LPDWHO\DFUHV ³$QQH[DWLRQ3DUFHOV´ DQGZLWKLQWKH&RXQW\RI0HQGRFLQR¶VMXULVGLFWLRQLQWRWKH&LW\RI8NLDK2QH DSSUR[LPDWHO\ DFUH SDUFHO $31V     ZDV GRQDWHG WR WKH &LW\ LQ 'HFHPEHU7KH&LW\LVFXUUHQWO\DFWLYHO\SXUVXLQJWKHSXUFKDVHDQGDFTXLVLWLRQRIWKHUHPDLQLQJ SDUFHOV ³+XOO3URSHUWLHV´ ZLWKWKHH[FHSWLRQRIWKH³1RJXHUD3URSHUWLHV´ $31V   ZKLFKZLOOEHXWLOL]HGIRUDFFHVVRQO\DQGUHPDLQXQGHUSULYDWHRZQHUVKLS,QRUGHUWRFRPSOHWH WKH DFTXLVLWLRQ WKH &LW\ ZLOO HQWHU LQWR D 3URSHUW\ ([FKDQJH DQG 'HYHORSPHQW $JUHHPHQW ³'HYHORSPHQW$JUHHPHQW´ ZLWKWKHFXUUHQWRZQHURIWKH+XOO3URSHUWLHVVXEMHFWWRWKHDQQH[DWLRQ DSSOLFDWLRQ8QGHUWKH'HYHORSPHQW$JUHHPHQWWKHFXUUHQWRZQHUZLOOFRQYH\WKH$QQH[DWLRQ3DUFHOV WRWKH&LW\LQH[FKDQJHIRUUHDOSURSHUW\RZQHGE\WKH&LW\DQGDSD\PHQWIURPWKH&LW\RIDQDPRXQW WRPDNHXSWKHGLIIHUHQFHEHWZHHQWKHIDLUPDUNHWYDOXHRIWKHH[FKDQJHGSURSHUWLHV8QGHUWKH 'HYHORSPHQW$JUHHPHQWWKH&LW\LVUHTXLUHGWRVXEPLWLWVDQQH[DWLRQDSSOLFDWLRQWRWKH0HQGRFLQR &RXQW\/RFDO$JHQF\)RUPDWLRQ /$)&R DIWHULWDFTXLUHVWLWOHWRWKH$QQH[DWLRQ3DUFHOV 7KHSURSRVHGSDUFHOVIRUDQQH[DWLRQZRXOGEHFRQWLJXRXVWRH[LVWLQJ&LW\RI8NLDKLQFRUSRUDWHGOLPLWV LQDFFRUGDQFHZLWK/$)&RSROLFLHVDQGWKH*RYHUQPHQW&RGH$OVRLQDFFRUGDQFHZLWK/$)&R DGRSWHGSURFHGXUHVDQGDVUHTXLUHGXQGHUWKH'HYHORSPHQW$JUHHPHQWWKH&LW\ZLOOVXEPLWLWV DQQH[DWLRQDSSOLFDWLRQWR/$)&RDIWHULWDFTXLUHVWLWOHWRWKH$QQH[DWLRQ3DUFHOVDQGXSRQ&LW\&RXQFLO DSSURYDORIWKH3URSRVHG3URMHFW 7KLV,QLWLDO6WXG\LVLQWHQGHGWRPHHWERWKWKH/$)&RDQG&(4$UHTXLUHPHQWVIRUDQQH[DWLRQDQGWKH 3URSRVHG3URMHFW8QGHU&(4$WKHWHUP³UHVSRQVLEOHDJHQF\´LQFOXGHVDOOSXEOLFDJHQFLHVRWKHUWKDQ WKHOHDGDJHQF\WKDWKDYHGLVFUHWLRQDU\SRZHURYHUWKH3URSRVHG3URMHFW$FFRUGLQJO\WKH&LW\RI 8NLDKLVWKHOHDGDJHQF\DQG/$)&RLVWKHUHVSRQVLEOHDJHQF\ 35(=21( 7KH$QQH[DWLRQ3DUFHOVZLOOEHSUH]RQHGSULRUWRWKHLUDQQH[DWLRQLQWRWKH&LW\RI8NLDK*RYHUQPHQW &RGH6HFWLRQDOORZVWKH&LW\RI8NLDKWRDGRSW LHSUH]RQH D]RQLQJGLVWULFWIRUODQGRXWVLGH RIWKHFLW\OLPLWVLQDQWLFLSDWLRQRIDQQH[DWLRQDQGGHYHORSPHQW8QGHU*RYHUQPHQW&RGH6HFWLRQ &LW\RZQHGSDUFHOVSURSRVHGIRUDQQH[DWLRQDUHQRWUHTXLUHGWREHORFDWHGZLWKLQWKH&LW\ V 62,&LW\RZQHGSDUFHOVFDQEHORFDWHGDQ\ZKHUHLQWKH&RXQW\DVORQJDVWKH\DUHOHVVWKDQ DFUHVRZQHGE\WKH&LW\DQGXVHGIRUPXQLFLSDOSXUSRVHVDWWKHWLPHRIWKHDQQH[DWLRQDSSOLFDWLRQ 8QGHUWKHSURYLVLRQVRIWKH*RYHUQPHQW&RGHWKH]RQLQJGLVWULFWDGRSWHGE\WKH&LW\GRHVQRWEHFRPH 8QGHU6HFWLRQLIWKH&LW\FRQYH\VDQ\VXFK&LW\RZQHGSDUFHOVDIWHUWKH\ZHUHDQQH[HGWKH\DXWRPDWLFDOO\EHFRPH GHWDFKHGIURPWKH&LW\XQOHVVWKH\KDYHEHFRPHFRQWLJXRXVWRWKH&LW\OLPLWV Page 331 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK HIIHFWLYHXQOHVVDQGXQWLOWKHODQGLVDQQH[HGLQWRWKH&LW\:LWKWKHH[FHSWLRQRI'HYHORSPHQW3DUFHOV ZKLFK+XOO3URSHUWLHVLVFKRRVLQJWRUHWDLQWKHULJKWWRVHOODQGGHYHORSSULRUWRDQQH[DWLRQDQG ZKLFKZLOOEHLQFOXGHGLQWKHDQQH[DWLRQDSSOLFDWLRQ VHH'HYHORSPHQW$JUHHPHQWDQG$VVXPSWLRQV VHFWLRQEHORZIRUPRUHLQIRUPDWLRQ RQFHWKHSDUFHOVDUHDQQH[HGLQWRWKH&LW\WKHVLWH V ZRXOGQRW EH GHYHORSHG XQWLO DQ DSSOLFDQW DSSOLHV IRU D XVH SHUPLW DQG VXEPLWV D SURMHFW VLWH SODQ IRU GHYHORSPHQWRQWKH'HYHORSPHQW3DUFHOVDQGDXVHSHUPLWLVDSSURYHGE\WKH3ODQQLQJ&RPPLVVLRQ 8QWLO WKH SURSHUW\ LV DQQH[HG LW LV VXEMHFWWR H[LVWLQJ ]RQLQJ XQGHU 0HQGRFLQR &RXQW\¶V =RQLQJ 2UGLQDQFH$IWHUWKH&LW\DFTXLUHVWLWOHWRWKH$QQH[DWLRQ3DUFHOVSULRUWRWKHLUDQQH[DWLRQLQWRWKH&LW\ WKRVH SDUFHOV XVHG IRU PXQLFLSDO SXUSRVHV DUH QRW VXEMHFW WR &RXQW\ ]RQLQJ RU EXLOGLQJ FRGHV 3UH]RQLQJRIWKHSDUFHOVZLOOUHTXLUHD=RQLQJ0DSDQG*HQHUDO3ODQ0DS$PHQGPHQWXSRQDSSURYDO RIWKHDQQH[DWLRQDSSOLFDWLRQ 7KH&LW\SURSRVHVWRDQQH[DSSUR[LPDWHO\DFUHVWRWDOFROOHFWLYHO\UHIHUUHGWRDVWKH³&RQVHUYDWLRQ 3DUFHOVIRURSHQVSDFHDQGFRQVHUYDWLRQ$OWKRXJKWKH&LW\GRHVQRWFXUUHQWO\KDYHDVWDQGDORQH 2SHQ 6SDFH ]RQLQJ GHVLJQDWLRQ WKH &LW\¶V H[LVWLQJ 3XEOLF )DFLOLWLHV 3)  ]RQLQJ GHVLJQDWLRQ HQFRPSDVVHVODQGVZLWKLQWKH&LW\WKDWFRQWDLQRSHQVSDFHDQGSDUNVDVZHOODVRWKHUSXEOLFIDFLOLWLHV $FFRUGLQJO\WKH&RQVHUYDWLRQ3DUFHOV LQFOXGLQJDSSUR[LPDWHO\DFUHVORFDWHGRXWVLGHRIWKH FXUUHQW62, DUHSURSRVHGWREHSUH]RQHG3) ZLWKD³3XEOLF´*HQHUDO3ODQODQGXVHGHVLJQDWLRQ  ZKLFKVSHFLILFDOO\LGHQWLILHVSXEOLFRUTXDVLSXEOLFXVHVLQFOXGLQJEXWQRWOLPLWHGWRQDWXUDOUHVRXUFH FRQVHUYDWLRQDUHDVDQGSDUNVDQGUHFUHDWLRQ,QDGGLWLRQWKH&LW\FDQXWLOL]HLWVSDUNVRUGLQDQFH 'LYLVLRQ&KDSWHURIWKH8NLDK&LW\&RGH WRSURYLGHUXOHVJRYHUQLQJ&LW\DQGSXEOLFXVHRI3) ]RQHGSURSHUW\6HH)LJXUH3URSRVHG3DUFHO&RQILJXUDWLRQ 3UH]RQLQJ 7KHSURSRVHG'HYHORSPHQW3DUFHOV DOOORFDWHGZLWKLQWKHFXUUHQW62,WRWDOLQJDSSUR[LPDWHO\ DFUHV ZLOOEHSUH]RQHGWR6LQJOH)DPLO\5HVLGHQWLDO+LOOVLGH2YHUOD\'LVWULFW 5+ ZLWKD*HQHUDO 3ODQ 'HVLJQDWLRQ RI /RZ 'HQVLW\ 5HVLGHQWLDO /'5  FRQVLVWHQW ZLWK DGMDFHQW &LW\ ]RQLQJ DQG GHYHORSPHQWSDWWHUQVLQWKH:HVWHUQ+LOOV,QDGGLWLRQWKH1RJXHUD3URSHUWLHV $31V   ZLOOEHSUH]RQHG5+IRUFRQVLVWHQF\ZLWKVXUURXQGLQJ]RQLQJDQGODQGXVHVEXWDUH QRWLQFOXGHGDV'HYHORSPHQW3DUFHOVDVWKH\ZLOOFRQWLQXHWREHXWLOL]HGIRUDFFHVVRQO\7KH±+ 2YHUOD\'LVWULFWLVLQWHQGHGWRHQFRXUDJHSODQQLQJGHVLJQDQGGHYHORSPHQWZKLOHSUHVHUYLQJQDWXUDO SK\VLFDOIHDWXUHVDQGPLQLPL]LQJSRWHQWLDOVDIHW\ZDWHUUXQRIIDQGVRLOHURVLRQFRQFHUQVDVVRFLDWHG ZLWKWKHQDWXUDOWHUUDLQ 7KLVDSSURDFKZLOODOORZWKH&LW\WRDGHTXDWHO\SUHVHUYHDQGSURWHFWWKHFROOHFWLYH&RQVHUYDWLRQ 3DUFHOV DFUHVWRWDO ZKLOHDOORZLQJRUGHUO\DQGFOXVWHUHGORZGHQVLW\UHVLGHQWLDOGHYHORSPHQW ZLWKLQWKH'HYHORSPHQW3DUFHOV DFUHV  7KH+LOOVLGH2YHUOD\'LVWULFW5HJXODWLRQVFDQEHIRXQGRQOLQHDW KWWSVZZZFRGHSXEOLVKLQJFRP&$8NLDK8NLDK8NLDKKWPODUW Page 332 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK /27/,1($'-8670(17 7RDFKLHYHWKHUHVXOWLQJSURSRVHGSDUFHOFRQILJXUDWLRQRIXSWRVHYHQ'HYHORSPHQW3DUFHOVWKH 3URMHFWDOVRLQFOXGHVVHTXHQWLDO/RW/LQH$GMXVWPHQWVLQERWKWKH&LW\DQG&RXQW\MXULVGLFWLRQVLQ DFFRUGDQFHZLWKWKH6XEGLYLVLRQ0DS$FW+XOO3URSHUWLHVUHFHQWO\UHFRUGHGVHTXHQWLDO/RW/LQH $GMXVWPHQWV WKURXJK WKH &RXQW\¶V PLQLVWHULDO SURFHGXUHV DQG ZLOO VXEPLW VHTXHQWLDO /RW /LQH $GMXVWPHQWVWKURXJKWKH&LW\¶VSURFHGXUHVWRDFKLHYHFRQILJXUDWLRQRIWKH'HYHORSPHQW3DUFHOV+XOO 3URSHUWLHVLQWHQGVWRVHOOWKH'HYHORSPHQW3DUFHOV UDQJLQJLQVL]HVIURPWRDFUHVHDFKLQ DFFRUGDQFHZLWKWKH5+UHJXODWLRQV IRULQGLYLGXDOGHYHORSPHQW$OWKRXJK'HYHORSPHQW3DUFHOV PD\EHGHYHORSHGSULRUWRDQQH[DWLRQWKH\ZLOOEHGHYHORSHGLQDFFRUGDQFHZLWK5+UHJXODWLRQV WKURXJK'HFODUDWLRQRI&RYHQDQWV&RQGLWLRQVDQG5HVWULFWLRQV && 5V 5HYLHZRIWKH/RW/LQH $GMXVWPHQWVZLOOEHFRQGXFWHGE\WKH&LW\(QJLQHHUSULRUWRUHFRUGDWLRQRIWKHILQDOPDSVWRHQVXUH WKDWDOOGHYHORSPHQWVWDQGDUGVFRQWDLQHGZLWKLQWKH5+]RQLQJGLVWULFWDUHPHW7DEOHLGHQWLILHV WKHH[LVWLQJSDUFHOVWREHUHFRQILJXUHGDQG)LJXUH3URMHFW/RFDWLRQ0DSLGHQWLILHVWKH'HYHORSPHQW 3DUFHODUHDLQ\HOORZ)LJXUHVKRZVWKHH[LVWLQJSDUFHOFRQILJXUDWLRQDQG)LJXUHVKRZVWKH SUHOLPLQDU\UHVXOWLQJSDUFHOFRQILJXUDWLRQDQGSURSRVHGSUH]RQLQJ$OWKRXJKWKHILQDOFRQILJXUDWLRQRI WKH 'HYHORSPHQW 3DUFHOV PD\ YDU\ VOLJKWO\ WKH IRRWSULQW RI WKH UHVXOWLQJ FRQILJXUDWLRQ IRU WKH 'HYHORSPHQW3DUFHOV DFUHV DQGQXPEHURISDUFHOVZLOOUHPDLQWKHVDPH ,QDFFRUGDQFHZLWK8NLDK&LW\&RGH6HFWLRQ I ZKLFKVWDWHV³Concurrent Permit Processing ZKHn a lot line adjustment is part of a project that requires one or more discretionary planning entitlements and the applicant does not want the lot line adjustment unless the entire project is approved, then the lot line adjustment shall be reviewed as part of the discretionary planning application. In that event, all permits and approvals, including the lot line adjustment, shall be combined into one application, processed concurrently, and acted upon by the highest review authority required by this code based on the entitlements included in the application. (Ord. 1138, §2 (Exh. A), adopted 2012).” +XOOSURSHUWLHVKDVLQGLFDWHGWKDWWKH\ZLVKWRUHFRUGWKH/RW/LQH$GMXVWPHQWV UHJDUGOHVVRIZKHWKHURUQRWWKHRYHUDOO3URMHFWJHWVDSSURYHG$VVXFKWKH/RW/LQH$GMXVWPHQWV UHPDLQPLQLVWHULDODQGGRQRWUHTXLUHDSSURYDOE\WKHKLJKHVWUHYLHZDXWKRULW\ &LW\&RXQFLOLQWKLV FDVH  7KH6XEGLYLVLRQ0DS$FWH[FOXGHVIURPLWVUHTXLUHPHQWVORWOLQHDGMXVWPHQWV³EHWZHHQIRXURUIHZHUH[LVWLQJDGMRLQLQJ SDUFHOV´LIWKHUHLVQRUHVXOWLQJLQFUHDVHLQWKHQXPEHURISDUFHOV*RYHUQPHQW&RGH† G  Page 333 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK Table 1. Annexation Parcels, Proposed Lot Line Adjustment and Prezoning $VVHVVRU¶V 3DUFHO 1XPEHU $31  ([LVWLQJ 6L]H DFUHV  3URSRVHG6L]H DFUHV  WKURXJK /RW/LQH $GMXVWPHQWV  5HVXOWLQJ3DUFHO&RQILJXUDWLRQ,QWHQGHG8VHDQG 3URSRVHG3UH]RQLQJ 3DUFHOZLOOEHFRPHD'HYHORSPHQW3DUFHOLQWHQGHGIRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+       3DUFHORQ([LVWLQJ&RQGLWLRQV7HQWDWLYH0DSFRQWDLQV VHYHUDO$31VEXWLVRQHOHJDOSDUFHO DFUHVWRWDO 7KLV SDUFHO ZLOO EHFRPH D 'HYHORSPHQW 3DUFHO LQWHQGHG IRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+ 3DUFHOZLOOEHFRPHD'HYHORSPHQW3DUFHOLQWHQGHGIRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+ 3DUFHOZLOOEHFRPHD'HYHORSPHQW3DUFHOLQWHQGHGIRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+ 3DUFHOZLOOEHFRPHD'HYHORSPHQW3DUFHOLQWHQGHGIRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+ 3DUFHOZLOOEHFRPHD'HYHORSPHQW3DUFHOLQWHQGHGIRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+ 3DUFHOZLOOEHFRPHD'HYHORSPHQW3DUFHOLQWHQGHGIRU VLQJOHIDPLO\KRXVLQJDQGSUH]RQHG5+    3DUFHO  ZLOO EHFRPH D &RQVHUYDWLRQ 3DUFHODQGEH SUH]RQHG3)7KHSURSRVHGZDWHUWDQNVZLOOEHSODFHGRQ WKLV SDUFHO ZLWKLQ WKH H[LVWLQJ ZDWHU WDQN SDG VLWH RQ H[LVWLQJ3DUFHO  3DUFHOLVD&RQVHUYDWLRQ3DUFHODQGZLOOEHSUH]RQHG 3)    3DUFHO &LW\RZQHG³'RQDWLRQ3DUFHO´ ZLOOEHFRPHD &RQVHUYDWLRQ3DUFHODQGZLOOEHSUH]RQHG3) ³1RJXHUD 3URSHUWLHV´        7KHVHSDUFHOVFRQWDLQWKHH[LVWLQJDFFHVVURDGWKDWZLOOEH LPSURYHGEXWUHPDLQXQGHUSULYDWHRZQHUVKLS,WZLOOEH LQFOXGHGLQWKHDQQH[DWLRQSURSRVDODQGSUH]RQHG5+ FRQVLVWHQWZLWKVXUURXQGLQJ]RQLQJDQGODQGXVHVEXWQR GHYHORSPHQWLVSURSRVHGWKLVSDUFHOLVQRWLQFOXGHGLQWKH /RW/LQH$GMXVWPHQW 727$/DFUHV '(9(/230(17$*5((0(17 $668037,216 $VSUHYLRXVO\QRWHGWKHWRWDODFUHDJHWREHSRWHQWLDOO\GHYHORSHGLVDSSUR[LPDWHO\DFUHV7KH UHPDLQLQJDFUHDJHRIDFUHVDQGWKHPDMRULW\RIWKHWRWDODFUHDJHSURSRVHGIRUDQQH[DWLRQLV LQWHQGHG IRU RSHQ VSDFH FRQVHUYDWLRQ 7KH SURSRVHG 'HYHORSPHQW $JUHHPHQW EHWZHHQ +XOO 3URSHUWLHVDQGWKH&LW\OLPLWVGHYHORSPHQWWRRQHVLQJOHIDPLO\GZHOOLQJDQGRQHDFFHVVRU\GZHOOLQJ XQLW $'8 SHUSDUFHO XQLWVWRWDO +XOO3URSHUWLHVLVFKRRVLQJWRUHWDLQWKHULJKWWRVHOODQGGHYHORS 'HYHORSPHQW3DUFHOVSULRUWRDQQH[DWLRQ7KH'HYHORSPHQW3DUFHOVDUHORFDWHGZLWKLQWKH&RXQW\ RI0HQGRFLQR¶VMXULVGLFWLRQZLWKLQWKH8SODQG5HVLGHQWLDODFUHPLQLPXP 85 ]RQLQJGLVWULFW &RQVWUXFWLRQRIWKHVLQJOHIDPLO\KRPHVZLWKLQWKH&RXQW\¶VMXULVGLFWLRQZRXOGEHE\ULJKWDQGQRW UHTXLUHGLVFUHWLRQDU\DSSURYDOHQYLURQPHQWDOUHYLHZQRUWKHGHYHORSPHQWVWDQGDUGVFRQWDLQHGZLWKLQ 5HVXOWLQJSDUFHOFRQILJXUDWLRQLVVXEMHFWWRFKDQJHEXWWKH'HYHORSPHQW3DUFHODUHDIRRWSULQWZLOOUHPDLQWKHVDPH Page 334 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK WKH&LW\¶V5+]RQLQJGLVWULFW+RZHYHU+XOO3URSHUWLHVLVFKRRVLQJWRUHTXLUHWKHVLQJOHIDPLO\KRPHV WREHFRQVWUXFWHGWR5+VWDQGDUGVE\LQFOXGLQJWKHPLQWKH'HFODUDWLRQRI&RYHQDQWV&RQGLWLRQV DQG 5HVWULFWLRQV && 5V  IRU 'HYHORSPHQW 3DUFHOV  ,Q DGGLWLRQ DOWKRXJK QRW UHTXLUHG WKH PLWLJDWLRQPHDVXUHVFRQWDLQHGZLWKLQWKH,601'IRUUHVLGHQWLDOGHYHORSPHQWZLOODOVREHLQFOXGHGLQ WKH&& 5V'HYHORSPHQW3DUFHOVZLOOVWLOO EHLQFOXGHGLQWKHDSSOLFDWLRQIRUDQQH[DWLRQDQG SUH]RQHGWR5+ $IWHUWKH$QQH[DWLRQ3DUFHOVDUHVXFFHVVIXOO\DQQH[HGLQWRWKH&LW\WKHUHPDLQLQJ'HYHORSPHQW 3DUFHOV  ZRXOGQRWEHGHYHORSHGXQWLODQDSSOLFDQWVXEPLWVDSURMHFWVLWHSODQIRUGHYHORSPHQW VXEMHFWWRGLVFUHWLRQDU\UHYLHZDQGUHFHLYHG3ODQQLQJ&RPPLVVLRQDSSURYDODVUHTXLUHGE\WKH&LW\¶V +LOOVLGH2YHUOD\=RQLQJ'LVWULFW+RZHYHUQRSXUFKDVHUVKDYHEHHQLGHQWLILHGDQGWKHWLPLQJRIWKH VDOHDQGGHYHORSPHQWRIWKHSURSHUWLHVLVXQNQRZQ7KH1RJXHUD3URSHUWLHVWKDWZLOOEHDQQH[HGDQG XWLOL]HGIRUDFFHVVDUHQRWLQFOXGHGLQWKH+XOO3URSHUWLHV'HYHORSPHQW$JUHHPHQW :KLOHWKH5]RQLQJGLVWULFWGRHVQRWLGHQWLI\DPD[LPXPORWVL]HLWW\SLFDOO\FRQWDLQVVLQJOHIDPLO\ UHVLGHQWLDOVXEGLYLVLRQORWVUDQJLQJLQVL]HIURPVL[WKRXVDQG  WRWHQWKRXVDQG  VTXDUH IHHW7KH±+2YHUOD\'LVWULFWUHTXLUHVDPLQLPXPVTXDUHIRRWORWDQGLQFUHDVHVZLWKWKHVORSH RIWKHVLWH7KH±+2YHUOD\'LVWULFWDOORZVIRUVLQJOHIDPLO\UHVLGHQWLDOGHYHORSPHQWDQGGHYHORSPHQW RIDQ$'8LQDUHDVZLWKOHVVWKDQVORSH VXEMHFWWRDSSURYDORIDGLVFUHWLRQDU\8VH3HUPLWDQG 6LWH'HYHORSPHQW3HUPLW  7KH&LW\RI8NLDK*HQHUDO3ODQDOORZVIRUVL[GZHOOLQJXQLWVSHUDFUHIRUWKH/RZ'HQVLW\5HVLGHQWLDO GHVLJQDWLRQ+RZHYHUEHFDXVHWKHSURSRVHG'HYHORSPHQW$JUHHPHQWZRXOGOLPLWGHYHORSPHQWWR RQHSULPDU\GZHOOLQJXQLWSHUSDUFHOIRUWKLVDQDO\VLVLWLVDVVXPHGWKDWXSWRVHYHQVLQJOHIDPLO\ KRPHVZLOOEHGHYHORSHG,QDGGLWLRQRQH$'8PD\EHGHYHORSHGSHUORWIRUDWRWDORIXQLWV:KLOH WKLV³PD[LPXPEXLOGRXW´VFHQDULRPD\QRWFRPHWRIUXLWLRQEDVHGRQVLWHWRSRJUDSK\DQGEXLOGLQJ FRQVWUDLQWVWKHDERYHGHVFULEHGDVVXPSWLRQVHQVXUHWKDWWKH'HYHORSPHQW$JUHHPHQWSRUWLRQRIWKH 3URMHFWLVDGHTXDWHO\DQDO\]HGXQGHU&(4$$OOIXWXUHGHYHORSPHQWRQ3DUFHOVZRXOGEHDQDO\]HG RQDSURMHFWOHYHOEDVLVIRUFRQVLVWHQF\ZLWKODQGXVHSROLFLHVDQGZRXOGEHVXEMHFWWRGLVFUHWLRQDU\ DQGHQYLURQPHQWDOUHYLHZRIWKHLULQGLYLGXDODQGFXPXODWLYHHQYLURQPHQWDOLPSDFWVDVDSSOLFDEOH $OWKRXJK'HYHORSPHQW 3DUFHOV  PD\ EH GHYHORSHG ZLWKLQ WKH &RXQW\¶V MXULVGLFWLRQ SULRU WR DQQH[DWLRQE\ULJKWWKH\ZLOOEHUHTXLUHGWREHGHYHORSHGWR5+VWDQGDUGVWKURXJK&& 5V,Q DGGLWLRQDOOPLWLJDWLRQPHDVXUHVLGHQWLILHGIRUUHVLGHQWLDOGHYHORSPHQWLQWKH,601'ZLOOEHDSSOLHGWR 'HYHORSPHQW3DUFHOV*HQHUDOFRQVWUXFWLRQLQIRUPDWLRQIRUVLQJOHIDPLO\KRPHVRQDOORIWKH 'HYHORSPHQW3DUFHOVKDVEHHQLQFOXGHGLQWKHDQDO\VLV$OWKRXJKWKH1RJXHUD3URSHUWLHVZLOOEH SUH]RQHG5+IRUFRQVLVWHQF\ZLWKVXUURXQGLQJ]RQLQJDQGODQGXVHVQRGHYHORSPHQWLVSURSRVHG DQGWKHSDUFHOVZLOOFRQWLQXHWREHXVHGIRUDFFHVVRQO\)RUWKHVHUHDVRQVGHYHORSPHQWRIWKHVH SURSHUWLHVLVQRWLQFOXGHGLQWKHGHYHORSPHQWDVVXPSWLRQV ,1)5$6758&785(,03529(0(176 $SSUR[LPDWHO\RQHKDOIPLOHRIWKHH[LVWLQJWRIWZLGHJUDYHOSULYDWHDFFHVVURDGEHJLQQLQJDWWKH DFFHVVSRLQWDWWKHWHUPLQXVRIRQ5HGZRRG$YHQXH WUDYHUVLQJWKH1RJXHUD3URSHUWLHV WRWKHKRXVH VLWHVZRXOGEHSDYHGWRVHUYHWKHIXWXUHKRXVLQJGHYHORSPHQWVLWHV7KHURDGLPSURYHPHQWVZLOO LQFOXGH GHYHORSLQJ DFXOGHVDFRQ 3URSRVHG 3DUFHO WR VHUYH WKH 'HYHORSPHQW 3DUFHOV$OO LPSURYHPHQWV ZLOO EH LQ DFFRUGDQFH ZLWK DSSOLFDEOH ILUH DQG EXLOGLQJ FRGHV 7KH SURSHUW\ RZQHUGHYHORSHUZLOOFRPSOHWHWKHURDGLPSURYHPHQWVWKHURDGZLOOUHPDLQXQGHUSULYDWHRZQHUVKLS DQGEHPDLQWDLQHGE\D+RPHRZQHU¶V$VVRFLDWLRQ +2$ WKURXJKDURDGPDLQWHQDQFHDQGDFFHVV DJUHHPHQW7KHDJUHHPHQWZLOODOVRDOORZWKH&LW\WRPDLQWDLQDFFHVVWRSXEOLFXWLOLWLHVDQGFLW\RZQHG SURSHUWLHV Page 335 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK 6HZHUZDWHUDQGHOHFWULFXWLOLWLHVZRXOGEHSURYLGHGWRWKH'HYHORSPHQW3DUFHOV6HZHUDQGZDWHU ZLOOEHGHYHORSHGE\WKHSURSHUW\RZQHUZKLOHHOHFWULFLQIUDVWUXFWXUHZLOOEHGHYHORSHGE\WKHSURSHUW\ RZQHUDQGRUWKH&LW\$OOXWLOLWLHVZLOOEHXQGHUJURXQGHGDQGORFDWHGZLWKLQRUDGMDFHQWWRH[LVWLQJ DFFHVVURDGVRQSULYDWHSDUFHOVDQGSUHYLRXVO\GLVWXUEHGDUHDV$GHWDLOHG3ODQIRU6HUYLFHVZLOOEH LQFOXGHGLQWKHDSSOLFDWLRQIRUDQQH[DWLRQ(DVHPHQWVZLOOEHUHTXLUHGIRUDOOXWLOLW\IDFLOLWLHVLQURDGZD\ DQGRQSDUFHOVDVQHFHVVDU\ $QRQVLWHFRPPXQLW\VHZHUV\VWHPZLWKDKROGLQJWDQNDQGVHZHUOLQHUDWKHUWKDQDOHDFKILHOGZLOO EHFRQVWUXFWHGIRUGLVFKDUJLQJZDVWHZDWHU HIIOXHQWRQO\ WRDVHZHUPDLQDWWKHHQGRI5HGZRRG $YHQXH3URSRVHG'HYHORSPHQW3DUFHOVDUHORFDWHGZLWKLQWKH8NLDK9DOOH\6DQLWDWLRQ'LVWULFW 896' VHUYLFHDUHDZKLOH3URSRVHG'HYHORSPHQW3DUFHOVDUHQRW+RZHYHUVHZHUVHUYLFH ZRXOGEHSURYLGHGWRWKH'HYHORSPHQW3DUFHOVE\WKH&LW\IRUSDUFHOVORFDWHGERWKZLWKLQDQGRXWVLGH RIWKH896' :DWHUXWLOLWLHVZLOOEHGHYHORSHGE\WKHSURSHUW\RZQHURQVLWHWRVXSSRUWWKH'HYHORSPHQW3DUFHOV DSSUR[LPDWHO\JDOORQVRIVWRUDJHZLOOEHSURYLGHGE\WZRJDOORQWDQNV IWLQGLDPHWHU DQGIWKLJK WKDWZLOOEHSODFHGZLWKLQWKHH[LVWLQJZDWHUWDQNSDGVLWH LGHQWLILHGE\DEOXHGRWRQ )LJXUHLQ$WWDFKPHQW 8OWLPDWHO\WKHKRPHRZQHUVDVVRFLDWLRQZLOORZQWKHWDQNDQGSURYLGHDOO PDLQWHQDQFHRQWKHWDQNDQGLWVDVVRFLDWHGHTXLSPHQW)LUHK\GUDQWVDUHDOVRUHTXLUHGWREHLQVWDOOHG ZLWKUHVLGHQWLDOGHYHORSPHQW (OHFWULFXWLOLWLHVZRXOGEHH[WHQGHGIURP+HOHQ5HGZRRG$YHWRSURYLGHHOHFWULFVHUYLFH(DVHPHQWV ZLOOEHUHTXLUHGIRUDOOXWLOLW\IDFLOLWLHVLQWKHURDGZD\DQGRQSDUFHOVDVQHFHVVDU\WRSURYLGHHOHFWULF VHUYLFH7KHHOHFWULF V\VWHP ZLOO EH LQ DFFRUGDQFH ZLWK 6WDWH DQG )HGHUDO UHTXLUHPHQWV8SRQ DQQH[DWLRQWKH&LW\ZLOORZQDQGPDLQWDLQHOHFWULFXWLOLW\LQIUDVWUXFWXUHWKURXJKDXWLOLW\HDVHPHQW &216758&7,21 3URSRVHGURDGLPSURYHPHQWVWKHXQGHUJURXQGH[WHQVLRQRIXWLOLWLHVDVZHOODVWKHZDWHUWDQNVDQG K\GUDQWV\VWHPVZRXOGEHFRPSOHWHGE\WKHSURSHUW\RZQHU RULWVFRQWUDFWRUV 5RDGLPSURYHPHQWV DQGXWLOLW\H[WHQVLRQLVDQWLFLSDWHGWRWDNHDSSUR[LPDWHO\PRQWKVGXULQJWKHGU\VHDVRQ:DWHUWDQN FRQVWUXFWLRQZRXOGRFFXURYHUGD\V$OOFRQVWUXFWLRQZLOOWDNHSODFHEHWZHHQWKHKRXUVRI DPDQGSPSHUWKH&LW\¶V1RLVH2UGLQDQFHDQGZLOOUHTXLUHWKHXVHRIW\SLFDOFRQVWUXFWLRQ HTXLSPHQWLQFOXGLQJEXWQRWOLPLWHGWRKDQGWRROVSRZHUWRROVKHDY\HTXLSPHQWPDQOLIWVPDOOFUDQH EDFNKRH GR]HU H[FDYDWRU IRUNOLIW SDYHU UROOHU WUDFWRU ZDWHU WUXFN JUDGHU HWF &RQVWUXFWLRQ HTXLSPHQWDQGVWDJLQJZLOOEHORFDWHGZLWKLQH[LVWLQJGLVWXUEHGDUHDVDQGURDGZD\V,WLVDQWLFLSDWHG WKDW DSSUR[LPDWHO\ FRQVWUXFWLRQZRUNHUV ZLOO EHQHHGHGIRU WKH URDG DQG ZDWHU V\VWHP LPSURYHPHQWVDQGH[WHQVLRQRIXWLOLWLHV ([WHQVLRQRIXWLOLWLHVZRXOGUHTXLUHZLGHWUHQFKHVWREHGXJZLWKLQWKHDFFHVVURDGRURWKHU GLVWXUEHGDUHDVIRUDSSUR[LPDWHO\RQHKDOIPLOHIURPWKHFRQQHFWLRQSRLQWZLWKLQ5HGZRRG$YHQXHWR WKH 'HYHORSPHQW 3DUFHOV %HFDXVH WKH URDG DQG ZDWHU WDQN SDG VLWH DUH SUHH[LVWLQJ PLQLPDO YHJHWDWLRQUHPRYDODQGJUDGLQJZLOOEHUHTXLUHGQRWUHHVDUHSURSRVHGIRUUHPRYDO$GGLWLRQDOJUDGLQJ PD\EHUHTXLUHGWRH[WHQGGULYHZD\VWRWKHFXOGHVDFDQGDFFHVVURDG6WDQGDUG%HVW0DQDJHPHQW 3UDFWLFHVLQFOXGLQJEXWQRWOLPLWHGWRWKHSODFHPHQWRIVWUDZPXOFKVHHGLQJVWUDZZDWWOHVVLOW IHQFLQJHWFZLOOEHLPSOHPHQWHGGXULQJFRQVWUXFWLRQDVDSSURSULDWH :LWKWKHH[FHSWLRQRI'HYHORSPHQW3DUFHOVZKLFKPD\EHGHYHORSHGE\ULJKWSULRUWRDQQH[DWLRQ LQWKH&RXQW\¶VMXULVGLFWLRQWKHFRQVWUXFWLRQRIVLQJOHIDPLO\KRPHVZRXOGQRWEHJLQXQWLODEX\HU Page 336 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK SXUFKDVHVRQHRIWKHSURSRVHG'HYHORSPHQW3DUFHOVDQGREWDLQVDQDSSURYHG8VH3HUPLWE\WKH 3ODQQLQJ&RPPLVVLRQIRUGHYHORSPHQWRIWKHLUKRPH7\SLFDOO\FRQVWUXFWLRQRIDVLQJOHIDPLO\GZHOOLQJ WDNHV DSSUR[LPDWHO\  PRQWKV WR FRPSOHWHDQG ZRXOG UHTXLUHWKHXVH RIWKH DIRUHPHQWLRQHG VWDQGDUGFRQVWUXFWLRQHTXLSPHQW Page 337 of 800 $31 $31 $31 $31 $31 $31 $31 $31 $31    $31 $31 $31 $31 $31 Sphere of Influence   APNs:003-190-09 & 003-110-90 8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQ /LPLWHG'HYHORSPHQW3URMHFW $QQH[DWLRQ3DUFHOV DF 3DUFHO'RQDWLRQWR&LW\'HYHORSPHQW3DUFHOV DF  3URSRVHG:DWHU7DQNV6SKHUHRI,QIOXHQFH&LW\/LPLWV([LVWLQJ$FFHVV5RDG 7KLVPDSLVDJXLGH(YHU\UHDVRQDEOHHIIRUWKDVEHHQPDGHWRHQVXUHDFFXUDF\ RIWKHPDS DQG GDWDSURYLGHG 3DUFHO OLQHVDUHQRWLQWHQGHGWRUHSUHVHQWVXUYH\HGGDWD'RFXPHQW3DWK 6?3XEOLF:RUNV?6WULFNOLQ $QGUHZ?*,6?3URMHFWV?3ODQQLQJ?:HVWHUQ+LOOV3URMHFW )LJXUH /RFDWLRQ0DS Page 338 of 800 :k,E E ;I . f i tH N - SE ; r $; i T s: t q .. E B €E '. ,6E !9o fEq\ $oR IIEo*)EqI\0 'i i*)h 'l x.xr{II -- - - - - - - - - - - - - - - - - t IIIIIIIIIIIIIIIIIII *t * r. Y E fi b i o-\ fNs €f{dq :B r d$ E 't $ o :* Bet r .t ) $ tN se $ b "E S 8 fr E& t s $ tB t^ . b I r. S a- oB s so{qo0bEob u= $ H n ii $ - * 5 a' " . € * \ RS N rt f , $t i $ n fc $ * N $ Es S R )LJXUH ([LVWLQJ3DUFHO&RQILJXUDWRQ Page 339 of 800 Proposed Parcel Configuration & Prezoning for Western Hills (Hull Properties) Open Land Acquisition & Limited Development Agreement Project Sphere of Influence Conservation Parcels” (640ac) with Public Facilities (PF) Prezoning “Development Parcels (54ac) with Single-Family Residential- Hillside Overlay District (R1-H) Prezoning Last revised June 2, 2021 )LJXUH 3URSRVHG3DUFHO&RQILJXUDWLRQ 3UH]RQLQJPage 340 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK ,,,(19,5210(17$/)$&7256327(17,$//<$))(&7(' 3XUSRVHRIWKH,QLWLDO(QYLURQPHQWDO6WXG\7KLV,QLWLDO6WXG\KDVEHHQSUHSDUHGFRQVLVWHQWZLWK &(4$*XLGHOLQHV6HFWLRQWRGHWHUPLQHLIWKH3URMHFWDVSURSRVHGZRXOGKDYHDVLJQLILFDQW LPSDFWXSRQWKHHQYLURQPHQW 7KHHQYLURQPHQWDOIDFWRUVFKHFNHGEHORZZRXOGEHSRWHQWLDOO\DIIHFWHGE\WKLV3URMHFWLQYROYLQJDW OHDVWRQHLPSDFWWKDWLVD3RWHQWLDOO\6LJQLILFDQW,PSDFWDVLQGLFDWHGE\WKHFKHFNOLVWRQWKHIROORZLQJ SDJHV $HVWKHWLFV$JULFXOWXUH )RUHVWU\$LU4XDOLW\ %LRORJLFDO5HVRXUFHV&XOWXUDO5HVRXUFHV(QHUJ\ *HRORJ\6RLOV*UHHQKRXVH*DV(PLVVLRQV+D]DUGV +D]DUGRXV0DWHULDOV +\GURORJ\:DWHU4XDOLW\/DQG8VH3ODQQLQJ0LQHUDO5HVRXUFHV 1RLVH3RSXODWLRQ+RXVLQJ3XEOLF6HUYLFHV 5HFUHDWLRQ7UDQVSRUWDWLRQ7ULEDO&XOWXUDO5HVRXUFHV 8WLOLWLHV6HUYLFH6\VWHPV:LOGILUH0DQGDWRU\)LQGLQJVRI 6LJQLILFDQFH 6XPPDU\RI)LQGLQJV7KH&LW\SURSRVHVWRDFTXLUHDQGDQQH[DSSUR[LPDWHO\DFUHV ³+XOO 3URSHUWLHV´DQGWKH&LW\¶V³'RQDWLRQ3DUFHO´ LQWKH:HVWHUQ+LOOVIRURSHQVSDFHSUHVHUYDWLRQZKLOH DOORZLQJWKHSRWHQWLDOIRUIXWXUHVHYHQVLQJOHIDPLO\KRPHVRQWKHDSSUR[LPDWHO\HDVWHUQPRVW DFUHVFRQVLVWHQWZLWKH[LVWLQJGHYHORSPHQWLQWKH:HVWHUQ+LOOVZLWKLQWKH&LW\RI8NLDKOLPLWV,Q DGGLWLRQWKH³1RJXHUD3URSHUWLHV´WRWDOLQJDSSUR[LPDWHO\DFUHVZLOOEHLQFOXGHGLQWKHDQQH[DWLRQ SURSRVDOIRUDFFHVVRQO\EXWZLOOUHPDLQXQGHUSULYDWHRZQHUVKLS 3URMHFWFRPSRQHQWVLQFOXGLQJWKHDFTXLVLWLRQDQQH[DWLRQDQGSUH]RQLQJRISDUFHOV DQGDVVRFLDWHG =RQLQJ0DSDQG*HQHUDO3ODQ0DS$PHQGPHQWV LQDGGLWLRQWRWKH/RW/LQH$GMXVWPHQWZRXOGQRW GLUHFWO\UHVXOWLQLPSDFWVWRWKHSK\VLFDOHQYLURQPHQW7KHUHIRUHWKH\DUHQRWGLVFXVVHGLQGHWDLO WKURXJKRXWWKHUHVRXUFHVHFWLRQVUHODWHGWRSK\VLFDOHQYLURQPHQWDOLPSDFWV +RZHYHUXQGHU WKH 'HYHORSPHQW $JUHHPHQW LQIUDVWUXFWXUH LPSURYHPHQWV DQG WKH SRWHQWLDO FRQVWUXFWLRQRIXSWRVHYHQVLQJOHIDPLO\KRPHVDQGDVVRFLDWHG$'8VFRXOGUHVXOWLQDWRWDORI XQLWVZLWKLQWKHHDVWHUQPRVWDFUHVRIWKH3URMHFWDUHD,WLVXQNQRZQZKHWKHUDOORIWKHVLQJOHIDPLO\ KRPHVDQG$'8VLQSDUWLFXODUZRXOGEHGHYHORSHGEXWSK\VLFDOLPSDFWVZRXOGYDU\GHSHQGLQJRQ ORFDWLRQLQWHQVLW\DQGRWKHUVLWLQJIDFWRUV+RZHYHUWKH3URSRVHG3URMHFWGRHVQRWLQFOXGHVSHFLILF GHYHORSPHQWGHVLJQVRUSURSRVDOVQRUGRHVLWJUDQWDQ\HQWLWOHPHQWVIRUGHYHORSPHQW2QFHWKH SDUFHOVDUHDQQH[HGLQWRWKH&LW\WKHVLWH V ZRXOGQRWEHGHYHORSHGXQWLODQDSSOLFDQWVXEPLWVD SURMHFWVLWHSODQIRUGHYHORSPHQWDQGUHFHLYHV3ODQQLQJ&RPPLVVLRQDSSURYDOWRGHYHORSDKRPHRQ WKH'HYHORSPHQW3DUFHOV  +XOO3URSHUWLHVLVFKRRVLQJWRUHWDLQWKHULJKWWRVHOODQGGHYHORS 'HYHORSPHQW3DUFHOVSULRUWRDQQH[DWLRQ7KH'HYHORSPHQW3DUFHOVDUHORFDWHGZLWKLQWKH&RXQW\ RI0HQGRFLQR¶VMXULVGLFWLRQZLWKLQWKH8SODQG5HVLGHQWLDODFUHPLQLPXP 85 ]RQLQJGLVWULFW &RQVWUXFWLRQRIWKHVLQJOHIDPLO\KRPHVZLWKLQWKH&RXQW\¶VMXULVGLFWLRQZRXOGEHE\ULJKWDQGQRW UHTXLUHGLVFUHWLRQDU\DSSURYDOHQYLURQPHQWDOUHYLHZQRUWKHGHYHORSPHQWVWDQGDUGVFRQWDLQHGZLWKLQ Page 341 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK WKH&LW\¶V5+]RQLQJGLVWULFW+RZHYHU+XOO3URSHUWLHVLVFKRRVLQJWRUHTXLUHWKHVLQJOHIDPLO\KRPHV WREHFRQVWUXFWHGWR5+VWDQGDUGVE\LQFOXGLQJWKHPLQWKH'HFODUDWLRQRI&RYHQDQWV&RQGLWLRQV DQG 5HVWULFWLRQV && 5V  IRU 'HYHORSPHQW 3DUFHOV  ,Q DGGLWLRQ DOWKRXJK QRW UHTXLUHG WKH PLWLJDWLRQPHDVXUHVFRQWDLQHGZLWKLQWKH,601'IRUUHVLGHQWLDOGHYHORSPHQWZLOODOVREHLQFOXGHGLQ WKH&& 5V 5HJDUGOHVV IRU WKH SXUSRVHV RI WKLV &(4$ DQDO\VLV LW LV DVVXPHG WKDW WKH GHYHORSPHQWRI DOO 'HYHORSPHQW 3DUFHOVZLOO RFFXU$OWKRXJK WKH 1RJXHUD 3URSHUWLHVZLOO EH SUH]RQHG 5+ IRU FRQVLVWHQF\ ZLWK VXUURXQGLQJ ]RQLQJ DQG ODQG XVHV WKH\ DUH QRW LQFOXGHG LQ WKH 'HYHORSPHQW $JUHHPHQWDQGQRGHYHORSPHQWLVSURSRVHGWKHSDUFHOVZLOOFRQWLQXHWREHXVHGIRUDFFHVVRQO\)RU WKHVHUHDVRQVWKHVHSDUFHOVDUHQRWLQFOXGHGDV'HYHORSPHQW3DUFHOVDQGKDYHQRWEHHQLQFOXGHG LQWKHGHYHORSPHQWDVVXPSWLRQV $VGHVFULEHGWKURXJKRXWWKH,QLWLDO6WXG\FRQVWUXFWLRQDQGJURXQGGLVWXUELQJDFWLYLWLHVDVVRFLDWHGZLWK WKHVH FRPSRQHQWV FRXOG UHVXOW LQ GLUHFW VLJQLILFDQW LPSDFWVWR$LU 4XDOLW\ %LRORJLFDO 5HVRXUFHV &XOWXUDO7ULEDO&XOWXUDO5HVRXUFHV*HRORJ\DQG6RLOV+D]DUGVDQG+D]DUGRXV0DWHULDOV+\GURORJ\ DQG:DWHU4XDOLW\1RLVH8WLOLWLHVDQG6HUYLFH6\VWHPVDQG:LOGILUH+RZHYHUPLWLJDWLRQPHDVXUHV LGHQWLILHGZLWKLQWKHDIRUHPHQWLRQHGVHFWLRQVZRXOGUHGXFHLPSDFWVWROHVVWKDQVLJQLILFDQW0LWLJDWLRQ PHDVXUHVLGHQWLILHGZLWKLQWKH,QLWLDO6WXG\DQG0LWLJDWHG1HJDWLYH'HFODUDWLRQUHODWHGWRJURXQG GLVWXUELQJ DFWLYLWLHV DQG FRQVWUXFWLRQ IRU URDG DQG XWLOLW\ LPSURYHPHQWV DV ZHOO DV UHVLGHQWLDO GHYHORSPHQWZLOOEHLQFOXGHGLQWKH'HYHORSPHQW$JUHHPHQWDQG&RQGLWLRQVRI$SSURYDOWRHQVXUH WKDWWKH\DUHLPSOHPHQWHGDFFRUGLQJO\$0LWLJDWLRQ0RQLWRULQJDQG5HSRUWLQJ3URJUDPLVSURYLGHGLQ 6HFWLRQ9,,RIWKLV,QLWLDO6WXG\ $OOIXWXUHUHVLGHQWLDOGHYHORSPHQWZRXOGEHDQDO\]HGRQDSURMHFWOHYHOEDVLVIRUFRQVLVWHQF\ZLWKODQG XVHSROLFLHVDQGZRXOGEHVXEMHFWWRGLVFUHWLRQDU\DQGHQYLURQPHQWDOUHYLHZRIWKHLULQGLYLGXDODQG FXPXODWLYHHQYLURQPHQWDOLPSDFWVDVDSSOLFDEOH ZLWKWKHH[FHSWLRQRIE\ULJKWGHYHORSPHQW  %DVHGXSRQWKHDQDO\VLVFRQWDLQHGZLWKLQWKLV,QLWLDO6WXG\DQG0LWLJDWHG1HJDWLYH'HFODUDWLRQDOO SRWHQWLDOLPSDFWVUHVXOWLQJIURPWKH3URSRVHG3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQWZLWKLQFRUSRUDWLRQ RIPLWLJDWLRQ Page 342 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK ,9 '(7(50,1$7,21 2QWKHEDVLVRIWKHLQLWLDOHYDOXDWLRQWKDWIROORZV BBBB, ILQG WKDW WKH SURSRVHG3URMHFW&28/' 127 KDYH D VLJQLILFDQW HIIHFW RQ WKH HQYLURQPHQWDQGD1(*$7,9('(&/$5$7,21ZLOOEHSUHSDUHG BB;BB,ILQGWKDW DOWKRXJK WKH SURSRVHG 3URMHFWFRXOG KDYH D VLJQLILFDQW HIIHFW RQ WKH HQYLURQPHQWWKHUHZLOOQRWEHDVLJQLILFDQWHIIHFWLQWKLVFDVHEHFDXVHPLWLJDWLRQPHDVXUHV DQGSURMHFWUHYLVLRQVKDYHEHHQLGHQWLILHGWKDWZRXOGUHGXFHDOOLPSDFWVWRDOHVVWKDQ VLJQLILFDQWOHYHO$0,7,*$7('1(*$7,9('(&/$5$7,21ZLOOEHSUHSDUHG BBBBB,ILQGWKDWWKHSURSRVHG3URMHFW0$<KDYHDVLJQLILFDQWHIIHFWRQWKHHQYLURQPHQW$Q (19,5210(17$/,03$&75(3257LVUHTXLUHG BBBBB , ILQG WKDW WKHSURSRVHG 3URMHFW 0$< KDYH D ³SRWHQWLDOO\ VLJQLILFDQW LPSDFW´ RU ³SRWHQWLDOO\VLJQLILFDQWXQOHVVPLWLJDWHG´LPSDFWRQWKHHQYLURQPHQWEXWDWOHDVWRQHHIIHFW  KDV EHHQ DGHTXDWHO\ DQDO\]HG LQ DQ HDUOLHU GRFXPHQW SXUVXDQW WR DSSOLFDEOH OHJDO VWDQGDUGVDQG KDVEHHQDGGUHVVHGE\PLWLJDWLRQPHDVXUHVEDVHGRQWKHHDUOLHUDQDO\VLV DVGHVFULEHGRQDWWDFKHGVKHHWV$Q(19,5210(17$/,03$&75(3257LVUHTXLUHGEXW LWPXVWDQDO\]HRQO\WKHHIIHFWVWKDWUHPDLQWREHDGGUHVVHG BBBBB ,ILQGWKDW DOWKRXJKWKH SURSRVHG 3URMHFW FRXOG KDYH D VLJQLILFDQW HIIHFW RQ WKH HQYLURQPHQWEHFDXVHDOOSRWHQWLDOO\VLJQLILFDQWHIIHFWV D KDYHEHHQDQDO\]HGDGHTXDWHO\ LQDQHDUOLHU(,5RU1(*$7,9('(&/$5$7,21SXUVXDQWWRDSSOLFDEOHVWDQGDUGVDQG E  KDYHEHHQDYRLGHGRUPLWLJDWHGSXUVXDQWWRWKDWHDUOLHU(,5RU1(*$7,9('(&/$5$7,21 LQFOXGLQJUHYLVLRQVRUPLWLJDWLRQPHDVXUHVWKDWDUHLPSRVHGXSRQWKHSURSRVHG3URMHFW QRWKLQJIXUWKHULVUHTXLUHG 6LJQDWXUH'DWH 0LFKHOOH,UDFH3ODQQLQJ0DQDJHU 3ODQQLQJ &RPPXQLW\'HYHORSPHQW'HSDUWPHQW &LW\RI8NLDK PLUDFH#FLW\RIXNLDKFRP August 16, 2021 Page 343 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK 9(9$/8$7,212)(19,5210(17$/,03$&76  7KHSXUSRVHRIWKLV,QLWLDO6WXG\0LWLJDWHG1HJDWLYH'HFODUDWLRQ ,601' LVWRSURYLGHDQDQDO\VLVRI WKHSRWHQWLDOHQYLURQPHQWDOFRQVHTXHQFHVDVDUHVXOWRIWKHSURSRVHG3URMHFW7KHHQYLURQPHQWDO HYDOXDWLRQUHOLHGRQWKHIROORZLQJFDWHJRULHVRILPSDFWVQRWHGDVFROXPQKHDGLQJVLQWKH,6FKHFNOLVW LQDFFRUGDQFHZLWK&(4$*XLGHOLQHV$SSHQGL[* ³3RWHQWLDOO\6LJQLILFDQW,PSDFW´LVDSSURSULDWHLIWKHUHLVVXEVWDQWLDOHYLGHQFHWKDWDQHIIHFWPD\EH VLJQLILFDQW,IWKHUHDUHRQHRUPRUH³3RWHQWLDOO\6LJQLILFDQW,PSDFW´HQWULHVZKHQWKHGHWHUPLQDWLRQLV PDGHDQ(,5LVUHTXLUHG /HVV7KDQ6LJQLILFDQW:LWK0LWLJDWLRQ,QFRUSRUDWHG´DSSOLHVZKHUHWKHLQFRUSRUDWLRQRIPLWLJDWLRQ PHDVXUHVKDVUHGXFHGDQHIIHFWIURP³3RWHQWLDOO\6LJQLILFDQW,PSDFW´WRD³/HVV7KDQ6LJQLILFDQW ,PSDFW´ ³/HVV7KDQ6LJQLILFDQW,PSDFW´DSSOLHVZKHUHWKH3URMHFWZRXOGQRWUHVXOWLQDVLJQLILFDQWHIIHFW LH WKH3URMHFWLPSDFWZRXOGEHOHVVWKDQVLJQLILFDQWZLWKRXWWKHQHHGWRLQFRUSRUDWHPLWLJDWLRQ  ³1R,PSDFW´DSSOLHVZKHUHWKH3URMHFWZRXOGQRWUHVXOWLQDQ\LPSDFWLQWKHFDWHJRU\RUWKHFDWHJRU\ GRHVQRWDSSO\7KLVPD\EHEHFDXVHWKHLPSDFWFDWHJRU\GRHVQRWDSSO\WRWKHSURSRVHG3URMHFW IRU LQVWDQFHWKH3URMHFW6LWHLVQRWZLWKLQDVXUIDFHIDXOWUXSWXUHKD]DUG]RQH RUEHFDXVHRIRWKHUSURMHFW VSHFLILFIDFWRUV  $HVWKHWLFV $(67+(7,&6:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D +DYHDVXEVWDQWLDODGYHUVHHIIHFWRQDVFHQLFYLVWD" E 6XEVWDQWLDOO\GDPDJHVFHQLFUHVRXUFHVLQFOXGLQJEXWQRW OLPLWHG WR WUHHV URFN RXWFURSSLQJV DQG KLVWRULF EXLOGLQJV ZLWKLQDVWDWHVFHQLFKLJKZD\" F ,QQRQXUEDQL]HGDUHDVVXEVWDQWLDOO\GHJUDGHWKHH[LVWLQJ YLVXDOFKDUDFWHURUTXDOLW\RISXEOLFYLHZVRIWKHVLWHDQGLWV VXUURXQGLQJV" 3XEOLFYLHZVDUHWKRVHWKDWDUHH[SHULHQFHG IURPSXEOLFO\DFFHVVLEOHYDQWDJHSRLQW ,IWKHSURMHFWLVLQDQ XUEDQL]HG DUHD ZRXOG WKH SURMHFW FRQIOLFW ZLWK DSSOLFDEOH ]RQLQJDQGRWKHUUHJXODWLRQVJRYHUQLQJVFHQLFTXDOLW\" G &UHDWH D QHZ VRXUFH RI VXEVWDQWLDO OLJKW RU JODUH ZKLFK ZRXOGDGYHUVHO\DIIHFWGD\RUQLJKWWLPHYLHZVLQWKHDUHD" 6LJQLILFDQFH&ULWHULD$HVWKHWLFLPSDFWVZRXOGEHVLJQLILFDQWLIWKH3URMHFWUHVXOWHGLQWKHREVWUXFWLRQ RIDQ\VFHQLFYLVWDRSHQWRWKHSXEOLFGDPDJHWRVLJQLILFDQWVFHQLFUHVRXUFHVZLWKLQDGHVLJQDWHG Page 344 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  6WDWHVFHQLFKLJKZD\VXEVWDQWLDOGHJUDGDWLRQWRWKHH[LVWLQJYLVXDOFKDUDFWHURUTXDOLW\RIWKHVLWHDQG LWVVXUURXQGLQJVIURPSXEOLFYLHZVRUJHQHUDWHQHZVRXUFHVRIOLJKWRUJODUHWKDWZRXOGDGYHUVHO\ DIIHFWGD\RUQLJKWWLPHYLHZVLQWKHDUHDLQFOXGLQJWKDWZKLFKZRXOGGLUHFWO\LOOXPLQDWHRUUHIOHFWXSRQ DGMDFHQWSURSHUW\RUFRXOGEHGLUHFWO\VHHQE\PRWRULVWVRUSHUVRQVUHVLGLQJZRUNLQJRURWKHUZLVH VLWXDWHGZLWKLQVLJKWRIWKH3URMHFW  (QYLURQPHQWDO6HWWLQJ7KH&LW\RI8NLDKLVORFDWHGZLWKLQWKH8NLDK9DOOH\DQGVFHQLFUHVRXUFHV LQFOXGHQRWRQO\WKHQDWXUDOHQYLURQPHQWEXWWKHEXLOWHQYLURQPHQWDVZHOO2QHRIWKHPRVWQRWDEOH VFHQLFUHVRXUFHVLQWKH&LW\OLPLWVLVWKH:HVWHUQ+LOOV9LHZVRIH[SDQVLYHKLOOVLGHVWRWKHQRUWKHDVW DQGVRXWKZLWKLQWKH&RXQW\MXULVGLFWLRQDOVRVXUURXQGWKH&LW\6RPHKLOOVLGHVDUHGHQVHO\IRUHVWHG ZLWKHYHUJUHHQWUHHVZKLOHRWKHUVDUHUHODWLYHO\RSHQLQFRPSDULVRQGRPLQDWHGE\PDWXUHRDNWUHHV VHWDPLGVFUXEDQGJUDVVODQGV6RPHUHVLGHQWLDOGHYHORSPHQWLVYLVLEOHZLWKLQWKH:HVWHUQ+LOOVIURP WKHYDOOH\IORRU:DWHULQWKHIRUPRIFUHHNVVWUHDPVDQGULYHUVLVRIWHQDSURPLQHQWIHDWXUHLQWKH ODQGVFDSHDVZHOO3URWHFWLQJWKHQDWXUDOVFHQLFIHDWXUHVKDVEHHQDSULRULW\IRUWKH&LW\  7KH0HQGRFLQR&RXQW\*HQHUDO3ODQLGHQWLILHVWKH0HQGRFLQR&RDVW5HGZRRGJURYHVDQGWKHS\JP\ IRUHVWVDUHVFHQLFUHVRXUFHVLQWKH&RXQW\0DQ\RSHQVSDFHDQGVFHQLFDUHDVLQ0HQGRFLQR&RXQW\ DUHSURWHFWHGXQGHUHDVHPHQWVPDQDJHGE\ODQGWUXVWVQRQHRIZKLFKDUHORFDWHGZLWKLQWKHYLFLQLW\ RIWKH3URSRVHG3URMHFW$FFRUGLQJWRWKH8NLDK9DOOH\$UHD3ODQ 89$3 GHYHORSPHQWLQWKHLQODQG SRUWLRQRI0HQGRFLQR&RXQW\LVJHQHUDOO\FRQFHQWUDWHGLQWRQRGHVVXUURXQGHGE\RSHQVSDFHDQG DJULFXOWXUH7KLVGHYHORSPHQWSDWWHUQFRQWULEXWHVWRWKHUXUDO³VPDOOWRZQ´FKDUDFWHURIWKH8NLDK YDOOH\3UHVHUYLQJWKLVFKDUDFWHULVHVVHQWLDOWRWKHFRPPXQLW\YLVLRQIRUWKHIXWXUH7KHZHVWHUQDQG HDVWHUQ KLOOV IUDPH WKH YDOOH\ FUHDWLQJ DQ DHVWKHWLF UHVRXUFH IRU UHVLGHQWV DQG YLVLWRUV0DQ\ GHYHORSHGSRUWLRQV RI WKH YDOOH\ HQMR\ VZHHSLQJ YLHZV RI RSHQ VSDFH DQG WKH KLOOVLGHV DGGLQJ FKDUDFWHUDQGHFRQRPLFYDOXHWRSURSHUW\WKURXJKRXWWKHYDOOH\  7KH3URMHFWVLWH V FRQVLVWVRIPRVWO\XQGHYHORSHGSDUFHOVZLWKILUHEUHDNVDQGSULYDWHDFFHVVURDGV 7KHSDUFHOVKDYHEHHQVXEMHFWWRYHJHWDWLRQPDQDJHPHQWDQGJUDGLQJSUDFWLFHVLQFOXGLQJFOHDULQJ DUHDVIRUSRWHQWLDOZDWHUWDQNSDGVLWHVDQGKRXVHVLWHVRYHUWKHODVWVHYHUDO\HDUVWKURXJKWKH &RXQW\¶VSHUPLWWLQJSURFHVV9HJHWDWLRQRQWKH3URMHFWSDUFHOVLQFOXGHVQDWLYHDQGQRQQDWLYHDQQXDO DQGSHUHQQLDOJUDVVHVZLWKGHQVHFKDSDUUDODQGPL[HGKDUGZRRGIRUHVWWKURXJKRXW  'LVFXVVLRQ D F /HVVWKDQVLJQLILFDQWLPSDFW6FHQLFYLVWDVDUHW\SLFDOO\GHVFULEHGDVDUHDVRI QDWXUDOEHDXW\ZLWKIHDWXUHVVXFKDVWRSRJUDSK\ZDWHUFRXUVHVURFNRXWFURSVDQGQDWXUDOYHJHWDWLRQ WKDWFRQWULEXWHWRWKHODQGVFDSH¶VTXDOLW\7KH:HVWHUQ+LOOVLQFOXGLQJWKH3URMHFWVLWHDUHFRQVLGHUHG DVFHQLFYLVWD*HQHUDOO\VSHDNLQJSXEOLFYLHZVRIWKH:HVWHUQ+LOOVDUHDYDLODEOHIURPURDGZD\VDQG DGMDFHQWUHVLGHQWLDODUHDVZLWKLQWKHYDOOH\IORRU6RPHUHVLGHQWLDOGHYHORSPHQWLVYLVLEOHZLWKLQWKH :HVWHUQ+LOOVIURPWKHYDOOH\IORRU  7KH3URMHFWSURSRVHVWRDFTXLUHDQGSUHVHUYHRSHQVSDFHIRUVHYHUDOUHDVRQVLQFOXGLQJVRXUFHZDWHU SUHVHUYDWLRQILUHPLWLJDWLRQVFHQLFUHVRXUFHVDQGELRORJLFDOSUHVHUYDWLRQ$SSUR[LPDWHO\DFUHV ZRXOGUHPDLQRSHQVSDFHZKLOHDFUHVZRXOGEHSRWHQWLDOO\GHYHORSHGZLWKXSWRXQLWV RQH VLQJOHIDPLO\ GZHOOLQJDQG RQH $'8 SHU ORW  $OWKRXJK WKH3URMHFWGRHV QRW LQFOXGH VSHFLILF GHYHORSPHQW SURSRVDOV IRU FRQVWUXFWLRQ RI WKH KRPHV WKH 'HYHORSPHQW $JUHHPHQW DOORZV WKH SRWHQWLDOIRUWKHKRPHVWREHEXLOWDWVRPHSRLQWLQWKHIXWXUH)XWXUHGHYHORSPHQWRIWKHVHKRPHVLQ DGGLWLRQWRFRQVWUXFWLRQRIWKHZDWHUWDQNDQGLQIUDVWUXFWXUHLPSURYHPHQWVFRXOGKDYHWKHSRWHQWLDOWR LPSDFWVFHQLFYLVWDVDQGWKHYLVXDOFKDUDFWHURIWKHDUHDGHSHQGLQJRQORFDWLRQKHLJKWVLWLQJGHVLJQ SUR[LPLW\WRVFHQLFUHVRXUFHVHWF+RZHYHUWKHSRWHQWLDOKRPHVDUHDOOSURSRVHGLQWKHORZHVW HOHYDWLRQRIWKH3URMHFWDUHDWKHUHIRUHOLPLWLQJYLVXDOLPSDFWIURPWKHYDOOH\IORRU,QDGGLWLRQDV Page 345 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  RXWOLQHG LQ WKH &LW\¶V =RQLQJ 2UGLQDQFH 8&& 6HFWLRQ   5 ]RQLQJ FRQWDLQV GHYHORSPHQW VWDQGDUGV LQFOXGLQJ D IRRWKHLJKWOLPLWDWLRQIRUVLQJOHIDPLO\ KRPH7KLVVFDOH RI SRWHQWLDO GHYHORSPHQWZRXOG EHVLPLODUWR UHVLGHQWLDO GHYHORSPHQW LQ WKH DUHDHDVW RIWKH VLWH:KLOHWKH HDVWHUQPRVWSRUWLRQRIWKH3URMHFWWKDWFRXOGEHGHYHORSHGZLWKKRPHVGHYHORSPHQWRIWKHVHKRPHV ZRXOGQRWVXEVWDQWLDOO\GHJUDGHDVFHQLFYLVWDRUWKHYLVXDOFKDUDFWHURIWKHDUHDDVLWLVDVVXPHG WKH\ZRXOGEHFRQVWUXFWHGZLWKLQWKHH[LVWLQJKRXVHVLWHVDQGQRWUHTXLUHDVXEVWDQWLDODPRXQWRI YHJHWDWLRQUHPRYDO,QDGGLWLRQRQHRIWKHLQWHQWLRQVRIWKH±+'LVWULFWLVWRSUHVHUYHRXWVWDQGLQJ QDWXUDOSK\VLFDOIHDWXUHVVXFKDVWKHKLJKHVWFUHVWRIDKLOOQDWXUDOURFNRXWFURSSLQJVPDMRUWUHHEHOWV HWF$OORZLQJWKHGHYHORSPHQWRIKRPHVRQWKHHDVWHUQPRVWSRUWLRQRIWKHVLWHZKLOHSUHYHQWLQJ UHVLGHQWLDOGHYHORSPHQWRQWKHUHPDLQLQJDFUHVZLOOHQVXUHRUGHUO\GHYHORSPHQWSDWWHUQVWR SUHYHQW VSUDZO DQG YLVXDO GHJUDGDWLRQ ZLWKLQ WKH:HVWHUQ +LOOV7KH DVVXPHGORZGHQVLW\ GHYHORSPHQWSDWWHUQLVFRQVLVWHQWDQGFRQWULEXWHVWRWKHUXUDO³VPDOOWRZQ´FKDUDFWHURIWKH8NLDK 9DOOH\DQG FRQVLVWHQW ZLWK SURSRVHG &LW\ ]RQLQJ IRU WKH VLWHV,Q DGGLWLRQ IXWXUHUHVLGHQWLDO GHYHORSPHQW RQ3DUFHOV ZRXOGEHVXEMHFWWRGLVFUHWLRQDU\DQGHQYLURQPHQWDOUHYLHZDQGEH UHTXLUHG WR FRPSO\ ZLWK &LW\ UHJXODWLRQV IRU KHLJKW VHWEDFNV DQG RWKHU GHYHORSPHQW VWDQGDUGV HVWDEOLVKHG WR SURWHFW QDWXUDO IHDWXUHV DQG VFHQLF UHVRXUFHV ZLWKLQWKH :HVWHUQ +LOOV$OWKRXJK 'HYHORSPHQW3DUFHOVPD\EHGHYHORSHGZLWKLQWKH&RXQW\¶VMXULVGLFWLRQSULRUWRDQQH[DWLRQE\ ULJKW WKH\ ZLOO EH UHTXLUHG WR EH GHYHORSHG WR 5+ VWDQGDUGV WKURXJK&& 5V ,Q DGGLWLRQ DOO PLWLJDWLRQ PHDVXUHV LGHQWLILHG IRU UHVLGHQWLDO GHYHORSPHQW LQWKH ,601' ZLOO EH DSSOLHG WR 'HYHORSPHQW3DUFHOV7KHUHIRUHWKHSRWHQWLDOUHVLGHQWLDOGHYHORSPHQWDVVRFLDWHGZLWKWKH3URMHFW ZRXOGQRWFRQIOLFWZLWKDSSOLFDEOH]RQLQJDQGRWKHUUHJXODWLRQVJRYHUQLQJVFHQLFTXDOLW\  6HZHUDQGHOHFWULFXWLOLWLHVZRXOGEHH[WHQGHGIURP5HGZRRG$YHQXHWRWKHKRXVHVLWHVEXWZRXOG EHORFDWHGXQGHUJURXQGZLWKLQWKHH[LVWLQJURDGZD\WRDYRLGYLVXDOLPSDFWV7KHWZRSURSRVHGZDWHU WDQNV IW[IWIWKLJK ZRXOGEHFRORUHGDVKDGHRIJUHHQWREOHQGLQZLWKWKHODQGVFDSH7KH ZDWHUWDQNVLWHKDVDOUHDG\EHHQFOHDUHGRIYHJHWDWLRQDQGLVVXUURXQGHGE\WUHHVPDNLQJLWOHVV YLVLEOHWRWKHSXEOLF'XHWRWKHORFDWLRQDQGWRSRJUDSK\RIWKHVLWHDQGGLVWDQFHIURPSXEOLFYLHZV VXFKDVWKRVHLQDGMDFHQWUHVLGHQWLDODUHDVRUYLHZVIURPWKHYDOOH\IORRUWKHSURSRVHGZDWHUWDQN ZRXOGQRWVLJQLILFDQWO\LPSDFWVFHQLFUHVRXUFHVRQWKHVLWHRULQWKHDUHD  )RUWKHDIRUHPHQWLRQHGUHDVRQVWKH3URMHFWZRXOGQRWUHVXOWLQDVLJQLILFDQWLPSDFWWRVFHQLFYLVWDV QRUWKHYLVXDOFKDUDFWHURIWKHVLWHRUDUHD,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  E 1RLPSDFW$FFRUGLQJWRWKH&DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ¶V &DOWUDQV 6WDWH6FHQLF +LJKZD\6\VWHP0DSWKHUHDUHQRGHVLJQDWHGVWDWHVFHQLFKLJKZD\VZLWKLQWKHYLFLQLW\RIWKHSURMHFW ,QDGGLWLRQWKHUHDUHQRKLJKZD\VLGHQWLILHGDVHOLJLEOHIRUVWDWHGHVLJQDWLRQ7KHUHIRUHWKH3URMHFW ZRXOG QRW VXEVWDQWLDOO\ GDPDJH VFHQLF UHVRXUFHV LQFOXGLQJ EXW QRW OLPLWHG WR WUHHV URFN RXWFURSSLQJVDQGKLVWRULFEXLOGLQJVZLWKLQDVWDWHVFHQLFKLJKZD\/DVWO\WKH&LW\¶V*HQHUDO3ODQWKH &RXQW\*HQHUDO3ODQDQGWKH8NLDK9DOOH\$UHD3ODQGRQRWGHVLJQDWHDQ\ORFDOVFHQLFURDGVLQWKH 3URMHFWDUHDQRLPSDFWWRVFHQLFUHVRXUFHVZLWKLQDGHVLJQDWHGVFHQLFFRUULGRUZRXOGRFFXU  G /HVVWKDQVLJQLILFDQWLPSDFW1HZVRXUFHVRIOLJKWDQGJODUHDVVRFLDWHGZLWKIXWXUHUHVLGHQWLDO GHYHORSPHQWFRXOGLQFOXGHEXLOGLQJPRXQWHGRXWGRRUOLJKWLQJLQGRRUUHVLGHQWLDOOLJKWLQJDQGQHZ VRXUFHVRIJODUHIURPZLQGRZVDQGFDUV$OOOLJKWLQJZRXOGEHUHTXLUHGWREHGRZQVKLHOGHGDQGFRPSO\ ZLWKWKH'DUN6NLHV2UGLQDQFHWRSURWHFWQLJKWWLPHYLHZV7KHVHVRXUFHVRIOLJKWDQGJODUHZRXOGEH W\SLFDORIWKRVHDVVRFLDWHGZLWKORZGHQVLW\UHVLGHQWLDOGHYHORSPHQWDQGZRXOGQRWEHFRQVLGHUHG ³VXEVWDQWLDO´7KHUHIRUHLPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW Page 346 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   $JULFXOWXUHDQG)RUHVWU\5HVRXUFHV $*5,&8/785($1')25(675<5(6285&(6,QGHWHUPLQLQJZKHWKHULPSDFWVWRDJULFXOWXUDOUHVRXUFHVDUHVLJQLILFDQW HQYLURQPHQWDOHIIHFWVOHDGDJHQFLHVPD\UHIHUWRWKH&DOLIRUQLD$JULFXOWXUDO/DQG(YDOXDWLRQDQG6LWH$VVHVVPHQW0RGHO  SUHSDUHGE\WKH&DOLIRUQLD'HSWRI&RQVHUYDWLRQDVDQRSWLRQDOPRGHOWRXVHLQDVVHVVLQJLPSDFWVRQDJULFXOWXUH DQGIDUPODQG,QGHWHUPLQLQJZKHWKHULPSDFWVWRIRUHVWUHVRXUFHVLQFOXGLQJWLPEHUODQGDUHVLJQLILFDQWHQYLURQPHQWDO HIIHFWVOHDGDJHQFLHVPD\UHIHUWRLQIRUPDWLRQFRPSLOHGE\WKH&DOLIRUQLD'HSDUWPHQWRI)RUHVWU\DQG)LUH3URWHFWLRQ UHJDUGLQJWKHVWDWH¶VLQYHQWRU\RIIRUHVWODQGLQFOXGLQJWKH)RUHVWDQG5DQJH$VVHVVPHQW3URMHFWDQGWKH)RUHVW/HJDF\ $VVHVVPHQWSURMHFWDQGIRUHVWFDUERQPHDVXUHPHQWPHWKRGRORJ\SURYLGHGLQ)RUHVW3URWRFROVDGRSWHGE\WKH&DOLIRUQLD $LU5HVRXUFHV%RDUG :RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D &RQYHUW3ULPH)DUPODQG8QLTXH)DUPODQGRU)DUPODQGRI 6WDWHZLGH ,PSRUWDQFH )DUPODQG  DV VKRZQ RQ WKH PDSV SUHSDUHGSXUVXDQWWRWKH)DUPODQG0DSSLQJDQG0RQLWRULQJ 3URJUDP RI WKH &DOLIRUQLD 5HVRXUFHV $JHQF\ WR QRQ DJULFXOWXUDOXVH"  E  &RQIOLFW ZLWK H[LVWLQJ ]RQLQJ IRU DJULFXOWXUDO XVH RU D :LOOLDPVRQ$FWFRQWUDFW" F &RQIOLFWZLWKH[LVWLQJ]RQLQJIRURUFDXVHUH]RQLQJRIIRUHVW ODQG DVGHILQHGLQ3XEOLF5HVRXUFHV&RGHVHFWLRQ J  WLPEHUODQG DV GHILQHG E\ 3XEOLF 5HVRXUFHV &RGH VHFWLRQ  RUWLPEHUODQG]RQHG7LPEHUODQG3URGXFWLRQ DVGHILQHG E\*RYHUQPHQW&RGHVHFWLRQ J "  G 5HVXOWLQWKHORVVRIIRUHVWODQGRUFRQYHUVLRQRIIRUHVWODQG WRQRQIRUHVWXVH" H ,QYROYHRWKHUFKDQJHVLQWKHH[LVWLQJHQYLURQPHQWZKLFK GXHWRWKHLUORFDWLRQRUQDWXUHFRXOGUHVXOWLQFRQYHUVLRQRI )DUPODQGWRQRQDJULFXOWXUDOXVHRUFRQYHUVLRQRIIRUHVWODQG WRQRQIRUHVWXVH"   6LJQLILFDQFH &ULWHULD7KH3URSRVHG 3URMHFWZRXOG KDYH D SRWHQWLDOO\ VLJQLILFDQW LPSDFWRQ DJULFXOWXUDOUHVRXUFHVLILWZRXOGFRQYHUWSULPHIDUPODQGWRDQRQDJULFXOWXUDOXVHFRQIOLFWZLWKD :LOOLDPVRQ$FWFRQWUDFWRUGLVUXSWDYLDEOHDQGORFDOO\LPSRUWDQWDJULFXOWXUDOXVH7KH3URMHFWZRXOG KDYHDSRWHQWLDOO\VLJQLILFDQWLPSDFWRQIRUHVWU\UHVRXUFHVLILWZRXOGUHVXOWLQWKHORVVUH]RQLQJRU FRQYHUVLRQRIIRUHVWODQGWRDQRQIRUHVWXVH  (QYLURQPHQWDO6HWWLQJ$FFRUGLQJWRWKH89$3HDUO\DJULFXOWXUDOHIIRUWVLQWKH8NLDK9DOOH\LQFOXGHG WKH UDLVLQJ RI OLYHVWRFN DQG WKH JURZLQJ RI YDULRXV JUDLQV KD\ DOIDOID DQG KRSV:KHQ WKH 1RUWKZHVWHUQ3DFLILF5DLOURDGZDVFRPSOHWHGLQSUXQHVSRWDWRHVSHDUVDQGKRSVFRXOGEH JURZQDQGVHQWWR6DQ)UDQFLVFRDQGRWKHUUHJLRQDOPDUNHWV:LQHJUDSHVZHUHSODQWHGDQGLUULJDWLRQ ZDVSUDFWLFHGRQDVPDOOVFDOH7KURXJKWKH¶VKRSVSHDUVSUXQHVDQGJUDSHVZHUHWKHPRVW ZLGHO\SODQWHGFURSVLQWKH8NLDK9DOOH\$IWHUWKHUDLOURDGZDVFRPSOHWHGOXPEHUPLOOVVSUDQJXSLQ WKH8NLDK9DOOH\DQGEHFDPHWKHPDMRULQGXVWU\LQ0HQGRFLQR&RXQW\DVWUDLQVWRRNUHGZRRGORJV DQGSURFHVVHGERDUGVVRXWKWRWKH6DQ)UDQFLVFRUHJLRQ  7RGD\PXFKRIWKHDFWLYHDJULFXOWXUDOODQGLQWKH89$3SODQQLQJDUHDLVORFDWHGRQWKHYDOOH\IORRU DQG ORZHU HOHYDWLRQV DORQJWKH 5XVVLDQ 5LYHU V\VWHP2QO\ D OLPLWHG SHUFHQWDJH RI WKHYDOOH\¶V DJULFXOWXUDOODQGVDUHFXUUHQWO\SURWHFWHGXQGHU:LOOLDPVRQ$FW$JULFXOWXUDO3UHVHUYHFRQWUDFWV7KH Page 347 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  &RXQW\ RI 0HQGRFLQR FRQWDLQV WKUHH ]RQLQJ GLVWULFWV IRU DJULFXOWXUDO XVHV $JULFXOWXUDO $*  5DQJHODQG 5/  RU )RUHVWODQG )/  +RZHYHU WKHUH DUH VRPH DFWLYH DJULFXOWXUDO ODQGV LQ XQLQFRUSRUDWHG0HQGRFLQR&RXQW\WKDWFXUUHQWO\LQSURGXFWLRQWKDWDUHQRW]RQHGIRUDJULFXOWXUDORU UDQJHODQGXVHV$FFRUGLQJWRWKH&RXQW\¶V3XEOLF*,6V\VWHPWKHUHDUHQR:LOOLDPVRQ$FWFRQWUDFWV ZLWKLQWKH3URMHFWVLWH  7KHUHDUHQR]RQLQJGLVWULFWVZLWKLQWKH&LW\OLPLWVIRU$JULFXOWXUHRU7LPEHU3UHVHUYH:KLOHWKHUHLV DQRYHUOD\IRUDJULFXOWXUHLQWKH]RQLQJRUGLQDQFHLWLVQRWDSSOLHGRYHUDQ\SDUFHOZLWKLQWKH&LW\OLPLWV $FFRUGLQJWRWKH&DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ)DUPODQG0DSSLQJ 0RQLWRULQJ3URJUDP &DOLIRUQLD,PSRUWDQW)DUPODQG)LQGHUWKHPDMRULW\RIODQGVZLWKLQWKH&LW\RI8NLDKDUHLGHQWLILHGDV ³8UEDQ %XLOW8S /DQG´7KHUH DUH WZR SDUFHOVZLWKLQ WKH &LW\ OLPLWV WKDW DUH LGHQWLILHG DV³3ULPH )DUPODQG´$31VDQG$31LVORFDWHGDW/RZ*DS5RDGDQGLV SDUWRIWKH5XVVLDQ5LYHU&HPHWHU\WKDWLVSDUWLDOO\GHYHORSHGZLWKDJULFXOWXUDOXVHVDVZHOODVD URDGZD\DQGSDUNLQJDUHD$31LVDYDFDQWSDUFHOZLWKVRPHDJULFXOWXUDOXVHVORFDWHG DGMDFHQWWR$LUSRUW5RDGZLWKLQWKH$LUSRUW,QGXVWULDO%XVLQHVV3DUN  'LVFXVVLRQ DH /HVVWKDQVLJQLILFDQW$FFRUGLQJWRWKH&DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ )DUPODQG0DSSLQJ 0RQLWRULQJ3URJUDP&DOLIRUQLD,PSRUWDQW)DUPODQG)LQGHUWKH3URMHFWDUHDGRHV QRWFRQWDLQ8QLTXH)DUPODQGRU)DUPODQGRI6WDWHZLGH,PSRUWDQFH+RZHYHUWKHVLWHLVGHVLJQDWHG DV*UD]LQJ/DQGZKLFKLVGHILQHGDVODQGRQZKLFKWKHH[LVWLQJYHJHWDWLRQLVVXLWHGWRWKHJUD]LQJRI OLYHVWRFNEXWKDVQRWEHHQXVHGIRUJUD]LQJ7KHUHDUHQRDJULFXOWXUDOXVHVRU:LOOLDPVRQ$FWFRQWUDFWV RQVLWHRULQWKHLPPHGLDWHYLFLQLW\7KH3URMHFWZRXOGQRWFRQYHUW)DUPODQGFRQIOLFWZLWKH[LVWLQJ ]RQLQJIRUDJULFXOWXUHRUIRUHVWODQGDQGZRXOGQRWLQYROYHFKDQJHVWRWKHHQYLURQPHQWWKDWZRXOG UHVXOW LQ WKH FRQYHUVLRQ RI DJULFXOWXUDO UHVRXUFHV WR QRQDJULFXOWXUH XVHV 7KHUHIRUH LPSDFWV WR DJULFXOWXUDOUHVRXUFHVZRXOGEHOHVVWKDQVLJQLILFDQW   $LU4XDOLW\ $,548$/,7<:KHUHDYDLODEOHWKHVLJQLILFDQFHFULWHULDHVWDEOLVKHGE\WKHDSSOLFDEOHDLUTXDOLW\PDQDJHPHQWGLVWULFWRUDLU SROOXWLRQFRQWUROGLVWULFWPD\EHUHOLHGXSRQWRPDNHWKHIROORZLQJGHWHUPLQDWLRQV :RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D &RQIOLFWZLWKRUREVWUXFWLPSOHPHQWDWLRQRIWKHDSSOLFDEOHDLU TXDOLW\SODQ" E 5HVXOWLQDFXPXODWLYHO\FRQVLGHUDEOHQHWLQFUHDVHRIDQ\ FULWHULDSROOXWDQWIRUZKLFKWKHSURMHFWUHJLRQLVQRQDWWDLQPHQW XQGHU DQ DSSOLFDEOH IHGHUDO RU VWDWH DPELHQW DLU TXDOLW\ VWDQGDUG"  F  ([SRVH VHQVLWLYH UHFHSWRUV WR VXEVWDQWLDO SROOXWDQW FRQFHQWUDWLRQV" G 5HVXOWLQRWKHUHPLVVLRQV VXFKDVWKRVHOHDGLQJWRRGRUV  DGYHUVHO\DIIHFWLQJDVXEVWDQWLDOQXPEHURISHRSOH"  Page 348 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  6LJQLILFDQFH&ULWHULD7KH3URSRVHG3URMHFWZRXOGKDYHDVLJQLILFDQWLPSDFWWRDLUTXDOLW\LILWZRXOG FRQIOLFWZLWKDQDLUTXDOLW\SODQUHVXOWLQDFXPXODWLYHO\FRQVLGHUDEOHQHWLQFUHDVHRIFULWHULDSROOXWDQW ZKLFKWKH0HQGRFLQR&RXQW\$LU4XDOLW\0DQDJHPHQW'LVWULFW 0&$40' KDVGHVLJQDWHGDVQRQ DWWDLQPHQWH[SRVHVHQVLWLYHUHFHSWRUVWRVXEVWDQWLDOFRQFHQWUDWLRQVRIDLUSROOXWDQWVRUUHVXOW LQ HPLVVLRQV WKDW FUHDWHREMHFWLRQDEOHRGRUVRU RWKHUZLVH DGYHUVHO\DIIHFW D VXEVWDQWLDO QXPEHU RI SHRSOH  (QYLURQPHQWDO6HWWLQJ7KH 3URMHFWLVORFDWHGZLWKLQWKH1RUWK&RDVW$LU%DVLQ 1&$%  ZKLFK LQFOXGHV'HO1RUWH+XPEROGW7ULQLW\0HQGRFLQRDQGQRUWKHUQ6RQRPD&RXQWLHVDQGLVXQGHUWKH MXULVGLFWLRQRIWKH0HQGRFLQR&RXQW\$LU4XDOLW\0DQDJHPHQW'LVWULFW 0&$40' 7KHDUHD¶VFOLPDWH LVFRQVLGHUHG 0HGLWHUUDQHDQ ZLWK ZDUP GU\ VXPPHUV DQG FRROHUZHW ZLQWHUV 6XPPHU KLJK WHPSHUDWXUHVDYHUDJHLQWKH¶VZLWKKLJKWHPSHUDWXUHVRQYHU\ZDUPGD\VH[FHHGLQJGHJUHHV 6XPPHUORZWHPSHUDWXUHVUDQJHEHWZHHQGHJUHHV:LQWHUKLJKWHPSHUDWXUHVJHQHUDOO\UDQJH LQWKH¶VDQG¶V7KHDYHUDJHDQQXDOWHPSHUDWXUHLVGHJUHHV:LQWHUFROGDLULQYHUVLRQVDUH FRPPRQLQWKHYDOOH\IURP1RYHPEHUWR)HEUXDU\  3UHYDLOLQJZLQGV DUH JHQHUDOO\ IURP WKH QRUWK 3UHYDLOLQJVWURQJ VXPPHU ZLQGV FRPH IURP WKH QRUWKZHVWKRZHYHUZLQGVFDQFRPHIURPWKHVRXWKDQGHDVWXQGHUFHUWDLQVKRUWOLYHGFRQGLWLRQV ,QHDUO\DXWXPQVWURQJGU\RIIVKRUHZLQGVPD\RFFXUIRUVHYHUDOGD\VLQDURZZKLFKPD\FDXVH DLUSROOXWLRQFUHDWHGLQWKH6DFUDPHQWR9DOOH\6DQWD5RVD3ODLQRUHYHQ6DQ)UDQFLVFR%D\$UHD WRPRYHLQWRWKH8NLDK9DOOH\  7KH0&$40'ZKLFKLQFOXGHVWKH&LW\RI8NLDKDQGVXUURXQGLQJDUHDVLVGHVLJQDWHGDVQRQ DWWDLQPHQWIRUWKH6WDWH6WDQGDUGIRUDLUERUQHSDUWLFXODWHPDWWHUOHVVWKDQPLFURQVLQVL]H 30  3DUWLFXODWHPDWWHU 30 KDVVLJQLILFDQWGRFXPHQWHGKHDOWKHIIHFWV7KH&DOLIRUQLD&OHDQ$LU$FW UHTXLUHVWKDWDQ\GLVWULFWWKDWGRHVQRWPHHWWKH30VWDQGDUGPDNHFRQWLQXLQJSURJUHVVWRDWWDLQ WKHVWDQGDUGDWWKHHDUOLHVWSUDFWLFDEOHGDWH7KHSULPDU\VRXUFHVRI30DUHZRRGFRPEXVWLRQ HPLVVLRQV IXJLWLYH GXVW IURP FRQVWUXFWLRQ SURMHFWV DXWRPRELOH HPLVVLRQV DQG LQGXVWU\1RQ DWWDLQPHQWRI30LVPRVWOLNHO\WRRFFXUGXULQJLQYHUVLRQVLQWKHZLQWHU  5HJXODWLRQRIWKH0&$40'FRQWDLQVWKUHHUXOHVUHODWHGWRWKHFRQWURORIIXJLWLYHGXVW  •5XOH D SURKLELWVDFWLYLWLHVWKDWFDXVHLQMXU\GHWULPHQWQXLVDQFHRUDQQR\DQFHWRD FRQVLGHUDEOHQXPEHURISHUVRQVRUZKLFKHQGDQJHUWKHKHDOWKRUVDIHW\RIWKHSXEOLF«  •5XOH D SURKLELWVDFWLYLWLHVZKLFKPD\DOORZXQQHFHVVDU\DPRXQWVRISDUWLFXODWH PDWWHUWREHFRPHDLUERUQH  •5XOH E UHTXLUHVWKDWUHDVRQDEOHSUHFDXWLRQVVKDOOEHWDNHQWRSUHYHQWSDUWLFXODWH PDWWHUIURPEHFRPLQJDLUERUQH«  7KH0&$40'SURYLGHVWKHIROORZLQJVLJQLILFDQFHWKUHVKROGVIRUFRQVWUXFWLRQHPLVVLRQV SRXQGVSHUGD\RI52*
 UHDFWLYHRUJDQLFJDV  SRXQGVSHUGD\RI12[
 R[LGHVRIQLWURJHQDVQLWURJHQGLR[LGH  SRXQGVSHUGD\RI30 SDUWLFXODWHPDWWHUOHVVWKDQPLFURQVLQVL]H  SRXQGVSHUGD\RI30
 DLUERUQHSDUWLFXODWHPDWWHUZLWKDGLDPHWHURIPLFURQV RUOHVV  %HVW0DQDJHPHQW3UDFWLFHVIRU)XJLWLYH'XVW±30DQG30  Page 349 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK 'LVFXVVLRQ DG /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG,PSURYHPHQWRI URDGZD\VLQVWDOODWLRQRIXWLOLWLHVDQGFRQVWUXFWLRQRIWKHZDWHUWDQN VDVZHOODVIXWXUHSRWHQWLDO FRQVWUXFWLRQRIVLQJOHIDPLO\KRPHVFRXOGUHVXOWLQLPSDFWVWRDLUTXDOLW\6KRUWWHUPFRQVWUXFWLRQ UHODWHGLPSDFWV HPLVVLRQVDQGGXVW ZRXOGUHVXOWIURPJUDGLQJYHJHWDWLRQUHPRYDOWUHQFKLQJSDYLQJ RSHUDWLRQRIFRQVWUXFWLRQHTXLSPHQWDQGYHKLFOHWULSVDVVRFLDWHGZLWKFRQVWUXFWLRQZRUNHUV7KH QHDUHVWVHQVLWLYHUHFHSWRULVWKHUHVLGHQFHORFDWHGDW5HGZRRG$YHQXHDGMDFHQWWRWKHDFFHVV SRLQWDQGDSSUR[LPDWHO\IWDZD\IURPSURSRVHG'HYHORSPHQW3DUFHO DQGIXUWKHUIURPWKH H[LVWLQJ³KRXVHVLWH´RQWKLVSDUFHO  0&$40'KDVDVHWRIVWDQGDUG%HVW0DQDJHPHQW3UDFWLFHV %03V DQGPLWLJDWLRQPHDVXUHVIRU FRQVWUXFWLRQSURMHFWVWKDWDUHLQWHQGHGWRUHGXFHDLUTXDOLW\LPSDFWVDQGHQVXUHWKDWSURMHFWVUHPDLQ LQDWWDLQPHQWZLWKDLUTXDOLW\WKUHVKROGV,QDGGLWLRQLQDFFRUGDQFHZLWKWKH&LW\¶V+LOOVLGH2YHUOD\ 'LVWULFWHDFKLQGLYLGXDOKRXVLQJSURMHFWZLOOUHTXLUHGLVFUHWLRQDU\DQGHQYLURQPHQWDOUHYLHZDQGPD\ UHTXLUHDGGLWLRQDOPLWLJDWLRQDQGDLUTXDOLW\SHUPLWV%\ULJ KWGHYHORSPHQWRI3DUFHOVZLOODOVREH VXEMHFWWRWKHPLWLJDWLRQPHDVXUHVEHORZDQGDLUTXDOLW\UHJXODWLRQVWKURXJKWKH&RXQW\¶V%XLOGLQJ 3HUPLWSURFHVV:LWKLQFRUSRUDWLRQRIWKHPLWLJDWLRQPHDVXUHVLGHQWLILHGEHORZDLUTXDOLW\LPSDFWV DVVRFLDWHG ZLWK VKRUWWHUP FRQVWUXFWLRQ ZRXOG EHOHVV WKDQ VLJQLILFDQWZLWK PLWLJDWLRQ LQFRUSRUDWHG /RQJWHUPDLUTXDOLW\LPSDFWVDVVRFLDWHGZLWKVLQJOHIDPLO\UHVLGHQWLDOGHYHORSPHQWLVW\SLFDOO\PLQLPDO DQG JHQHUDOO\DVVRFLDWHGZLWKYHKLFOH WULSV ZRRG EXUQLQJ VWRYHV ODQGVFDSH DQG PDLQWHQDQFH DFWLYLWLHVHWF+RZHYHUH[LVWLQJEXLOGLQJFRGHVUHTXLULQJHQHUJ\HIILFLHQWDQGORZHPLWWLQJHTXLSPHQW DQGIHDWXUHVIRUQHZUHVLGHQWLDOGHYHORSPHQW VHH6HFWLRQ(QHUJ\6HFWLRQ*UHHQKRXVH*DV (PLVVLRQDQG6HFWLRQ7UDQVSRUWDWLRQRIWKLV,QLWLDO6WXG\IRUPRUHLQIRUPDWLRQ :LWKDGKHUHQFH WRWKHDIRUHPHQWLRQHGUHJXODWLRQVDQGRWKHUVLQWHQGHGWRUHGXFHHPLVVLRQVDQGLPSDFWVWRDLUTXDOLW\ LPSDFWVIURPRSHUDWLRQRIWKH3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQW 7KH0&$40' KDV QRW HVWDEOLVKHG VHSDUDWH VLJQLILFDQFH WKUHVKROGV IRU FXPXODWLYH RSHUDWLRQDO HPLVVLRQV7KHQDWXUHRIDLUHPLVVLRQVLVODUJHO\DFXPXODWLYHLPSDFW$VDUHVXOWQRVLQJOHSURMHFWLV VXIILFLHQWLQVL]HWRE\LWVHOIUHVXOWLQQRQDWWDLQPHQWRIDPELHQWDLUTXDOLW\VWDQGDUGV,QVWHDGD SURMHFW¶VLQGLYLGXDOHPLVVLRQVFRQWULEXWHWRH[LVWLQJFXPXODWLYHO\VLJQLILFDQWDGYHUVHDLUTXDOLW\LPSDFWV 7KH0&$40'GHYHORSHGWKHRSHUDWLRQDOWKUHVKROGVRIVLJQLILFDQFHEDVHGRQWKHOHYHODERYHZKLFK DSURMHFW¶VLQGLYLGXDOHPLVVLRQVZRXOGUHVXOWLQDFXPXODWLYHO\FRQVLGHUDEOHFRQWULEXWLRQWRWKH1RUWK &RDVW$LU%DVLQ¶VH[LVWLQJDLUTXDOLW\FRQGLWLRQV7KHUHIRUHDSURMHFWWKDWH[FHHGVWKH0&$40' RSHUDWLRQDO WKUHVKROGV ZRXOG DOVR EH D FXPXODWLYHO\ FRQVLGHUDEOH FRQWULEXWLRQ WR D VLJQLILFDQW FXPXODWLYHLPSDFW%HFDXVHHDFKLQGLYLGXDOFRQVWUXFWLRQSURMHFW LQFOXGLQJGHYHORSPHQWRIWKHVLQJOH IDPLO\KRPHV LVUHTXLUHGWREHLQDWWDLQPHQWZLWKWKHHVWDEOLVKHG0&$40'WKUHVKROGVLWLVQRWOLNHO\ WKDWFXPXODWLYHLPSDFWVZRXOGEHVLJQLILFDQW 0LWLJDWLRQ0HDVXUHV $4 'LHVHO(QJLQHV±6WDWLRQDU\DQG3RUWDEOH(TXLSPHQWDQG0RELOH9HKLFOHV D$Q\ VWDWLRQDU\ RQVLWH GLHVHO ,& HQJLQHV  KRUVHSRZHU RU JUHDWHU LH ODUJH SRZHU JHQHUDWRUVRUSXPSV RUDQ\SURSDQHRUQDWXUDOJDVHQJLQHVKRUVHSRZHURUJUHDWHU PD\UHTXLUHDSHUPLWIURPWKH'LVWULFW E3RUWDEOHGLHVHOSRZHUHGHTXLSPHQWWKDWPD\EHXVHGGXULQJWKHSURSRVHGSURMHFWDUH UHTXLUHGWREHUHJLVWHUHGZLWKWKHVWDWH3RUWDEOH(TXLSPHQW5HJLVWUDWLRQ3URJUDP 3(53 RUREWDLQSHUPLWVIURPWKH'LVWULFW Page 350 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  F3URMHFWVORFDWHGDGMDFHQWWRVHQVLWLYHUHFHSWRUV VFKRROVFKLOGFDUHIDFLOLWLHVKHDOWKFDUH IDFLOLWLHVVHQLRUIDFLOLWLHVEXVLQHVVHVDQGUHVLGHQFHVHWF GXULQJWKHFRQVWUXFWLRQSKDVH RIWKLVSURMHFWKDYHWKHSRWHQWLDOIRUH[SRVXUHWRGLHVHOSDUWLFXODWH G+HDY\GXW\WUXFNLGOLQJDQGRIIURDGGLHVHOHTXLSPHQWRURWKHUGLHVHOHQJLQHLGOLQJLVOLPLWHG WROHVVWKDQPLQXWHV  $4 *UDGLQJ 3URMHFWV'XULQJ &RQVWUXFWLRQ$OO JUDGLQJ DFWLYLWLHV PXVW FRPSO\ZLWK WKH IROORZLQJIXJLWLYHGXVWPLWLJDWLRQPHDVXUHVLQDFFRUGDQFHZLWK'LVWULFW5HJXODWLRQ5XOH D$OO YLVLEO\ GU\ GLVWXUEHG VRLO URDG VXUIDFHV VKDOO EH ZDWHUHG WR PLQLPL]H IXJLWLYH GXVW HPLVVLRQV E$OOXQSDYHGVXUIDFHVXQOHVVRWKHUZLVHWUHDWHGZLWKVXLWDEOHFKHPLFDOVRURLOVVKDOOKDYH DSRVWHGVSHHGOLPLWRIPSK F(DUWKRURWKHUPDWHULDOWKDWKDVEHHQWUDQVSRUWHGE\WUXFNLQJRUHDUWKPRYLQJHTXLSPHQW HURVLRQE\ZDWHURURWKHUPHDQVRQWRSDYHGVWUHHWVVKDOOEHSURPSWO\UHPRYHG G$VSKDOWRLOZDWHURUVXLWDEOHFKHPLFDOVVKDOOEHDSSOLHGRQPDWHULDOVVWRFNSLOHVDQGRWKHU VXUIDFHVWKDWFDQJLYHULVHDLUERUQHGXVWV H$OOHDUWKPRYLQJDFWLYLWLHVVKDOOFHDVHZKHQVXVWDLQHGZLQGVH[FHHGPSK I7KH RSHUDWRU VKDOO WDNH UHDVRQDEOH SUHFDXWLRQV WR SUHYHQWWKH HQWU\ RI XQDXWKRUL]HG YHKLFOHVRQWRWKHVLWHGXULQJQRQZRUNKRXUV J7KHRSHUDWRUVKDOONHHSDGDLO\ORJRIDFWLYLWLHVWRFRQWUROIXJLWLYHGXVW K)RUSURMHFWVJUHDWHUWKDQRQHDFUHRURQHPLOHRIURDGQRWORFDWHGZLWKLQD1DWXUDOO\ 2FFXUULQJ$VEHVWRV$UHDSULRUWRVWDUWLQJDQ\FRQVWUXFWLRQWKHDSSOLFDQWLVUHTXLUHGWR 6XEPLWD/DUJH$UHD*UDGLQJSHUPLWDSSOLFDWLRQWRWKH'LVWULFW 2EWDLQDILQDOGHWHUPLQDWLRQIURPWKH$LU4XDOLW\0DQDJHPHQW'LVWULFWDVWRWKH QHHGIRUDQ$VEHVWRV'XVW0LWLJDWLRQ3ODQDQGRU*HRORJLF6XUYH\WRFRPSO\ZLWK &&5VHFWLRQVDQGUHODWLQJWR1DWXUDOO\2FFXUULQJ$VEHVWRV 2EWDLQZULWWHQYHULILFDWLRQIURPWKH'LVWULFWVWDWLQJWKDWWKHSURMHFWLVLQFRPSOLDQFH ZLWK6WDWHDQG/RFDOUHJXODWLRQVUHODWLQJWR1DWXUDOO\2FFXUULQJ$VEHVWRV ,IWKHSURMHFWLVORFDWHGZLWKLQD1DWXUDOO\2FFXUULQJ$VEHVWRV$UHDDGGLWLRQDO PLWLJDWLRQVVKDOOEHUHTXLUHG  $43URSHUW\'HYHORSPHQW3ULRUWRVWDUWLQJDQ\FRQVWUXFWLRQWKHDSSOLFDQWLVUHTXLUHGWR D2EWDLQD3URSHUW\'HYHORSPHQW3HUPLWIURPWKH'LVWULFWIRUDQ\RSHQRXWGRRUEXUQLQJ E2EWDLQD*UDGLQJ3HUPLWLIDSSOLFDEOH F&RQILUPZKHWKHUWKHSURMHFWLVLQD1DWXUDOO\2FFXUULQJ$VEHVWRV$UHDDQGIROORZDGGLWLRQDO 0&$40'UHFRPPHQGDWLRQVLIDSSOLFDEOH G&RQVLGHUDOWHUQDWHPHDQVRIGLVSRVDORWKHUWKDQRSHQEXUQLQJVXFKDVFXWWLQJWKHPDMRULW\ RIWKHODUJHUPDWHULDOXSDVILUHZRRGDQGFKLSSLQJVPDOOHUPDWHULDOLIIHDVLEOHWRPLWLJDWH LPSDFWVIURPRSHQRXWGRRUEXUQLQJ H2EWDLQZULWWHQYHULILFDWLRQIURPWKH0&$40'VWDWLQJWKDWWKHSURMHFWLVLQFRPSOLDQFHZLWK 6WDWHDQG/RFDOUHJXODWLRQV         Page 351 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   %LRORJLFDO5HVRXUFHV  %,2/2*,&$/5(6285&(6:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D +DYHDVXEVWDQWLDODGYHUVHHIIHFWHLWKHUGLUHFWO\RUWKURXJK KDELWDWPRGLILFDWLRQVRQDQ\VSHFLHVLGHQWLILHGDVDFDQGLGDWH VHQVLWLYHRUVSHFLDOVWDWXVVSHFLHVLQORFDORUUHJLRQDOSODQV SROLFLHVRUUHJXODWLRQVRUE\WKH&DOLIRUQLD'HSDUWPHQWRI)LVK DQG:LOGOLIHRU86)LVKDQG:LOGOLIH6HUYLFH"  E +DYHDVXEVWDQWLDODGYHUVHHIIHFWRQDQ\ULSDULDQKDELWDWRU RWKHUVHQVLWLYHQDWXUDOFRPPXQLW\LGHQWLILHGLQORFDORUUHJLRQDO SODQVSROLFLHVUHJXODWLRQVRUE\WKH&DOLIRUQLD'HSDUWPHQWRI )LVKDQG:LOGOLIHRU86)LVKDQG:LOGOLIH6HUYLFH"  F  +DYH D VXEVWDQWLDO DGYHUVH HIIHFW RQ VWDWH RU IHGHUDOO\ SURWHFWHGZHWODQGV LQFOXGLQJEXWQRWOLPLWHGWRPDUVKYHUQDO SRROFRDVWDOHWF WKURXJKGLUHFWUHPRYDOILOOLQJK\GURORJLFDO LQWHUUXSWLRQRURWKHUPHDQV"  G  ,QWHUIHUH VXEVWDQWLDOO\ ZLWK WKH PRYHPHQW RI DQ\ QDWLYH UHVLGHQWRUPLJUDWRU\ILVKRUZLOGOLIHVSHFLHVRUZLWKHVWDEOLVKHG QDWLYHUHVLGHQWRUPLJUDWRU\ZLOGOLIHFRUULGRUVRULPSHGHWKH XVHRIQDWLYHZLOGOLIHQXUVHU\VLWHV"  H  &RQIOLFW ZLWK DQ\ ORFDO SROLFLHV RU RUGLQDQFHV SURWHFWLQJ ELRORJLFDO UHVRXUFHV VXFK DV D WUHH SUHVHUYDWLRQ SROLF\ RU RUGLQDQFH"  I  &RQIOLFW ZLWK WKH SURYLVLRQV RIDQ DGRSWHG +DELWDW &RQVHUYDWLRQ3ODQ1DWXUDO&RPPXQLW\&RQVHUYDWLRQ3ODQRU RWKHUDSSURYHGORFDOUHJLRQDORUVWDWHKDELWDWFRQVHUYDWLRQ SODQ"   6LJQLILFDQFH&ULWHULD3URMHFWLPSDFWVXSRQELRORJLFDOUHVRXUFHVZRXOGEHVLJQLILFDQWLIDQ\RIWKH IROORZLQJ UHVXOWHG VXEVWDQWLDO GLUHFW RU LQGLUHFW HIIHFW RQ DQ\ VSHFLHV LGHQWLILHG DV D FDQGLGDWH VHQVLWLYHRUVSHFLDOVWDWXVVSHFLHVLQORFDOUHJLRQDOSODQVSROLFLHVRUUHJXODWLRQVRUE\WKH&DOLIRUQLD 'HSDUWPHQWRI)LVKDQG:LOGOLIH &'): RU86)LVKDQG:LOGOLIH6HUYLFH 86):6 RUDQ\VSHFLHV SURWHFWHGXQGHUSURYLVLRQVRIWKH0LJUDWRU\%LUGWUHDW\$FW HJEXUURZLQJRZOV VXEVWDQWLDOHIIHFW XSRQULSDULDQKDELWDWRURWKHUVHQVLWLYHQDWXUDOFRPPXQLWLHVLGHQWLILHGLQORFDOUHJLRQDOSODQVSROLFLHV RU UHJXODWLRQV RU E\ WKH DJHQFLHV OLVWHG DERYH VXEVWDQWLDO HIIHFW HJ ILOO UHPRYDO K\GURORJLF LQWHUUXSWLRQ XSRQVWDWHRUIHGHUDOO\SURWHFWHGZHWODQGVVXEVWDQWLDOO\LQWHUIHUHZLWKPRYHPHQWRIQDWLYH UHVLGHQWRUPLJUDWRU\ZLOGOLIHVSHFLHVRUZLWKHVWDEOLVKHGQDWLYHUHVLGHQWRUPLJUDWRU\ZLOGOLIHFRUULGRUV FRQIOLFWZLWKDQ\ORFDOSROLFLHVRUGLQDQFHVWKDWSURWHFWELRORJLFDOUHVRXUFHVRUFRQIOLFWZLWKDKDELWDW FRQVHUYDWLRQSODQ  (QYLURQPHQWDO6HWWLQJ5HJLRQDOO\WKH3URMHFWDUHDKDVKLVWRULFDOO\EHHQXVHGSULPDULO\IRUWLPEHU DQGILUHZRRGSURGXFWLRQUHFUHDWLRQKRPHVLWHGHYHORSPHQWDQGZLOGOLIHKDELWDW7KH3URMHFWDUHDLV FRPSULVHGRIILYHQRQVHQVLWLYHELRORJLFDOFRPPXQLWLHV&LVPRQWDQH:RRGODQG9DOOH\DQGIRRWKLOO JUDVVODQG DQG %URDGOHDYHG XSODQG IRUHVW KDELWDW $FFRUGLQJ WR 86'$ )RUHVW 6HUYLFH &$/9(* PDSSLQJGHOLQHDWLRQWKHUHJLRQDOO\GRPLQDQWYHJHWDWLRQW\SHZLWKLQWKH3URMHFWDUHDLVFRPSULVHGRI Page 352 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  %ODFNRDN2UHJRQZKLWHRDN3DFLILF'RXJODVILU'RXJODVILU3RQGHURVDSLQH,QWHULRUOLYHRDNDQG ,QWHULRUPL[HGKDUGZRRG  $%LRORJLFDO$VVHVVPHQW5HSRUW %5$ ZDVSUHSDUHGIRUWKH3URMHFWE\-DFREV]RRQ $VVRFLDWHV ,QF -DFREV]RRQ LQ0DUFKDQGXSGDWHGLQ$SULO $WWDFKPHQW% 7KH%5$LVGHVLJQHG WR LGHQWLI\ VHQVLWLYH FRPPXQLWLHV ZLWKLQ WKH VWXG\ DUHD DQG GHWHUPLQH WKH H[LVWHQFH RU SRWHQWLDO RFFXUUHQFHIRUVSHFLDOVWDWXVVSHFLHV7KH³VWXG\DUHD´UHIHUUHGWRZLWKLQWKHUHSRUWDQGWKLVDQDO\VLV FRPSULVHVDSSUR[LPDWHO\DFUHVDQGLQFOXGHVH[LVWLQJGLUWDQGJUDYHOURDGVILUHEUHDNVZDWHUWDQN SDGVLWHVDQGDUHDVFOHDUHGIRUSRWHQWLDOKRXVHVLWHV,QDGGLWLRQVXUYH\VH[WHQGHGRXWIHHWIURP WKHURDGZD\7KH%5$LQFOXGHVWKHDQDO\VLVDQGFRPSDULVRQRIH[LVWLQJKDELWDWFRQGLWLRQVZLWKLQWKH VWXG\DUHDDQGWKHGRFXPHQWHGUDQJHDQGKDELWDWUHTXLUHPHQWVRIVHQVLWLYHSODQWDQGZLOGOLIHVSHFLHV GHVFULEHGLQ&'):¶V&DOLIRUQLD:LOGOLIH+DELWDW5HODWLRQVKLSV6\VWHP &:+5   -DFREV]RRQFRQGXFWHGDILHOGVXUYH\RIWKH3URMHFW DUHDRQ)HEUXDU\WRGRFXPHQW  WKH RQVLWHSODQWFRPPXQLWLHV  H[LVWLQJFRQGLWLRQVDQGWKHLUDELOLW\WRSURYLGHVXLWDEOHKDELWDWIRUDQ\ VSHFLDOVWDWXVSODQWRUZLOGOLIHVSHFLHVDQG  LIVHQVLWLYHELRORJLFDOFRPPXQLWLHV HJZHWODQGV YHUQDOSRROV DUHSUHVHQW3ULRUWRWKHILHOGVXUYH\ELRORJLFDOLQIRUPDWLRQGDWDEDVHVZHUHDFFHVVHG WRGHWHUPLQHZKHWKHUVHQVLWLYHELRORJLFDOFRPPXQLWLHVVSHFLDOVWDWXVVSHFLHVRURWKHUVHQVLWLYHDUHDV ZHUHGRFXPHQWHGZLWKLQWKHYLFLQLW\RIWKHVWXG\DUHD([LVWLQJYHJHWDWLYHFRPPXQLWLHVZHUHUHYLHZHG XVLQJWKH&'):9HJHWDWLRQ&ODVVLILFDWLRQDQG0DSSLQJ3URJUDP 9HJ&$03 'DWDEDVHVTXHULHGIRU WKH RFFXUUHQFH RI VSHFLDOVWDWXV VSHFLHV LQFOXGH WKH 86):6 ,QIRUPDWLRQ IRU 3ODQQLQJ DQG &RQVXOWDWLRQ ,3D&  &DOLIRUQLD 1DWLYH 3ODQW 6RFLHW\ &136  ,QYHQWRU\ RI 5DUH DQG (QGDQJHUHG 3ODQWVDQGWKH&'):¶V&DOLIRUQLD1DWXUDO'LYHUVLW\'DWDEDVH &1''% 6SRWWHG2ZO'DWD9LHZHU 5DUH)LQGDQG4XLFN9LHZHUZKLFKFRQVLVWRIPDSSHGRYHUOD\VRIDOONQRZQSRSXODWLRQVRIVHQVLWLYH SODQWVDQGZLOGOLIH,QDGGLWLRQD86):6SURWRFROOHYHOERWDQLFDOVXUYH\ZDVFRPSOHWHGRQ0DUFK 0D\DQG-XO\  'LVFXVVLRQ D /HVV WKDQ VLJQLILFDQW LPSDFWZLWK PLWLJDWLRQ LQFRUSRUDWHG%DVHG RQ WKH GDWDEDVHUHVHDUFKPHQWLRQHGDERYHWKHVWXG\DUHDGRHVQRWFRQWDLQDQGLVQRWDGMDFHQWWRFULWLFDO KDELWDWIRUDQ\)HGHUDORU6WDWHOLVWHG6SHFLHV+RZHYHUEDVHGRQH[LVWLQJYHJHWDWLRQDQGNQRZQ KDELWDWUDQJHVHYHQWHHQ  VSHFLDOVWDWXVSODQWVSHFLHVDQGWKLUWHHQ  VSHFLDOVWDWXVZLOGOLIH VSHFLHVKDYHDPRGHUDWHRUKLJKSRWHQWLDOWRRFFXUZLWKLQWKHVWXG\DUHD+RZHYHUGXULQJWKHILHOG VXUYH\QRQHZHUHREVHUYHGRQVLWH%HFDXVHQRVSHFLDOVWDWXVSODQWVSHFLHVZHUHREVHUYHGGXULQJ WKHILHOGVXUYH\WKH3URMHFWLVQRWDQWLFLSDWHGWRUHVXOWLQVLJQLILFDQWLPSDFWVWRWKHP+RZHYHUWKLV GRHVQRWSUHFOXGHWKHSRVVLELOLW\RIZLOGOLIHVSHFLHVEHLQJSUHVHQWDWWKHWLPHRIFRQVWUXFWLRQRUEHLQJ LPSDFWHGIURPYHJHWDWLRQUHPRYDOJUDGLQJDQGRWKHUJURXQGGLVWXUELQJDFWLYLWLHVIRUXWLOLW\H[WHQVLRQ URDGLPSURYHPHQWVZDWHUWDQNFRQVWUXFWLRQDQGIXWXUHUHVLGHQWLDOGHYHORSPHQW,QDGGLWLRQWZR VHQVLWLYHZRRGODQGWUHHKDELWDWVZHUHLGHQWLILHGLQWKH3URMHFW$UHD$VGHVFULEHGEHORZWKH3URMHFW GRHVQRWSURSRVHUHPRYDORIWUHHVEXWLIIXWXUHUHVLGHQWLDOGHYHORSPHQWGRHVSUHFRQVWUXFWLRQVXUYH\V DQGFRRUGLQDWLRQZLWKWKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIHZLOOEHUHTXLUHG7KHUHIRUHDV VXPPDUL]HGEHORZ0LWLJDWLRQ0HDVXUHV%,2WKURXJK%,2DUHSURSRVHGWRHQVXUHLPSDFWVWR VHQVLWLYHVSHFLHVDUHUHGXFHGWROHVVWKDQVLJQLILFDQW7KHUHIRUHLPSDFWVWRVSHFLDOVWDWXVVSHFLHV ZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLQFRUSRUDWHG3OHDVHUHIHUWRWKHFRPSOHWH%5$LQ $WWDFKPHQW%IRUPRUHLQIRUPDWLRQLQFOXGLQJDFRPSOHWHDQDO\VLVRILPSDFWVWRHDFKRIWKHVHVSHFLHV  Plants.6HYHQWHHQ  VSHFLDOVWDWXVSODQWVSHFLHVKDYHDPRGHUDWHWRKLJKSRWHQWLDOWRRFFXUZLWKLQ WKHVWXG\DUHDEDVHGRQKDELWDWUHTXLUHPHQWV7KHVHLQFOXGHPRXQWDLQODG\¶VVOLSSHU.RFK¶VFRUG PRVVVWLQNEHOOV5RGHULFN¶VIULWLOODU\0HQGRFLQRWDUSODQWFRQJHVWHGKHDGHGKD\ILHOGWDUSODQW&RQWUD &RVWDJROGVILHOGVEULVWO\OHSWRVLSKRQEURDGOREHGOHSWRVLSKRQUHGZRRGOLO\JUHHQPRQDUGHOODZKLWH Page 353 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  IORZHUHGUHLQRUFKLGPD\DFDPDVSRSFRUQIORZHUEHDNHGWUDF\LQDVKRZ\,QGLDQFORYHU0HWKXVHODK¶V EHDUGOLFKHQDQGRYDOOHDYHGYLEXQXP+RZHYHUDVGHVFULEHGLQWKH%5$ 6HFWLRQ QRVSHFLDO VWDWXVSODQWVSHFLHVZHUHREVHUYHGZLWKLQWKHVWXG\DUHDGXULQJWKHILHOGVXUYH\%HFDXVHQRVSHFLDO VWDWXVSODQWVSHFLHVZHUHREVHUYHGGXULQJWKHILHOGVXUYH\WKH3URMHFWLVQRWDQWLFLSDWHGWRUHVXOWLQ VLJQLILFDQWLPSDFWVWRWKHP%RWDQLFDOVXUYH\VZHUHFRPSOHWHGSHU86):6SURWRFROVRQ0DUFK 0D\DQG-XO\DQGIRXQGQRVHQVLWLYHSODQWVSHFLHV7KHUHIRUHWKH3URMHFW ZRXOGQRWLPSDFWVHQVLWLYHSODQWV7KH%LRORJLFDO5HVRXUFHV$VVHVVPHQW$GGHQGXPIRUWKH5DUH 3ODQW$VVHVVPHQWDQG%RWDQLFDO6XUYH\DUHLQFOXGHGDV$WWDFKPHQW%  Trees.7KH%5$LGHQWLILHVWKHIROORZLQJWZRVHQVLWLYHWUHHFRPPXQLWLHVLQWKH6WXG\$UHD4XHUFXV JDUU\DQD )RUHVW :RRGODQG $OOLDQFH 2UHJRQ ZKLWH RDN IRUHVW DQG ZRRGODQG DQG 8PEHOOXODULD FDOLIRUQLFD)RUHVW :RRGODQG$OOLDQFH&DOLIRUQLDED\IRUHVWDQGZRRGODQG%RWKFRPPXQLWLHVDUH FODVVLILHGDVKDYLQJD&DOLIRUQLD'HSDUWPHQWRI:LOGOLIH6WDWH5DULW\5DQNRI6 9XOQHUDEOH 1RWUHHV DUHSURSRVHGIRUUHPRYDO+RZHYHULIIXWXUHGHYHORSPHQWSURSRVHVUHPRYDORIWUHHV0LWLJDWLRQ 0HDVXUH%,2UHTXLUHVSUHFRQVWUXFWLRQVXUYH\VWREHFRPSOHWHGLQRUGHUWRLGHQWLI\VSHFLHVDQG HQVXUHWKDWUHPRYDORIWKHPLVGRQHLQDFFRUGDQFHZLWKWKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIH UHJXODWLRQV  Amphibians.2QHVSHFLDOVWDWXVDPSKLELDQUHGEHOOLHGQHZW 7DULFKDULYXODULV KDVDPRGHUDWHRU KLJKSRWHQWLDOWRRFFXUZLWKLQWKHVWXG\DUHD:KLOHQRQHZHUHREVHUYHGGXULQJWKHILHOGVXUYH\ LPSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUH%,2UHTXLULQJSUHFRQVWUXFWLRQVXUYH\VDQGD%LRORJLVWWREH SUHVHQWGXULQJDQ\GHZDWHULQJDFWLYLWLHV LISURSRVHGLQWKHIXWXUH ZRXOGUHGXFHSRWHQWLDOLPSDFWVWR VSHFLDOVWDWXVDPSKLELDQVSHFLHVWROHVVWKDQVLJQLILFDQW  Fish.7KH6WXG\$UHDGRHVQRWFRQWDLQDQ\VSHFLDOVWDWXVILVKVSHFLHVRUILVKEHDULQJZDWHUFRXUVHV RUZDWHUERGLHV1RVSHFLDOVWDWXVILVKZHUHREVHUYHGGXULQJWKHELRORJLFDOVLWHDVVHVVPHQW)XWXUH GHYHORSPHQWZLWKLQWKHVWXG\DUHDGRHVQRWKDYHWKHSRWHQWLDOWRLPSDFWVSHFLDOVWDWXVILVKVSHFLHV QRLPSDFW  Birds.$OWKRXJKQRQHZHUHREVHUYHGGXULQJWKHILHOGVXUYH\ILYHVSHFLDOVWDWXVDYLDQVSHFLHVKDYH PRGHUDWHRUKLJKSRWHQWLDOWRRFFXUZLWKLQWKHVWXG\DUHDQRUWKHUQJRVKDZN Accipiter gentilis JROGHQ HDJOH Aquilachrysaetos), RVSUH\ Pandion haliaetus \HOORZZDUEOHU Setophaga petechia DQG QRUWKHUQ VSRWWHG RZO Strix occidentalis caurina $GGLWLRQDOO\ PRVW QRQJDPH ELUG VSHFLHV LQ &DOLIRUQLDDUHSURWHFWHGXQGHUWKH0LJUDWRU\%LUG7UHDW\$FW 0%7$ ZKLFKSURKLELWVWKHGHOLEHUDWH GHVWUXFWLRQRIDFWLYHQHVWVEHORQJLQJWRSURWHFWHGVSHFLHV:KLOHQRQHZHUHREVHUYHGLQWKHILHOG VXUYH\JURXQGEUHDNLQJDFWLYLWLHVVSHFLILFDOO\YHJHWDWLRQUHPRYDOZLWKLQWKHVWXG\DUHDGXULQJDYLDQ EUHHGLQJSHULRGVKDYHWKHSRWHQWLDOWRVLJQLILFDQWO\LPSDFWQHVWLQJPLJUDWRU\ELUGVSHFLHV7KHUHIRUH 0LWLJDWLRQ0HDVXUH%,2UHTXLULQJSUHFRQVWUXFWLRQVXUYH\VDQGSURWHFWLRQRIQHVWV LIIRXQG ZRXOG EHLPSOHPHQWHGWRUHGXFHDQ\SRWHQWLDOLPSDFWVWROHVVWKDQVLJQLILFDQW  Insects$OWKRXJKQRQHZHUHREVHUYHGGXULQJWKHILHOGVXUYH\WZRVSHFLDOVWDWXVLQVHFWVSHFLHVKDYH PRGHUDWH RU KLJK SRWHQWLDO WR RFFXU ZLWKLQ WKH VWXG\ DUHD WKH REVFXUH EXPEOH EHH %RPEXV FDOLJLQRVXV DQGZHVWHUQEXPEOHEHH %RPEXVRFFLGHQWDOLV ,PSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUH %,2UHTXLULQJSUHFRQVWUXFWLRQVXUYH\VDQGSURWHFWLRQRIQHVWV LIIRXQG ZRXOGUHGXFHSRWHQWLDO LPSDFWVWROHVVWKDQVLJQLILFDQW  Mammals)LYHVSHFLDOVWDWXVPDPPDOVSHFLHVKDYHPRGHUDWHRUKLJKSRWHQWLDOWRRFFXUZLWKLQWKH VWXG\DUHD6RQRPDWUHHYROH Arborimus pomo 1RUWK$PHULFDQSRUFXSLQH Erethizon dorsatum  ZHVWHUQUHGEDW Lasiurus blossevillii KRDU\EDW Lasiurus cinereus DQGILVKHU>:HVW&RDVW'36@ Page 354 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  Pekania pennanti :KLOHQRQHZHUHREVHUYHGGXULQJWKHILHOGVXUYH\LPSOHPHQWDWLRQRI0LWLJDWLRQ 0HDVXUH %,2 UHTXLULQJ SUHFRQVWUXFWLRQ VXUYH\V ZRXOG UHGXFH SRWHQWLDO LPSDFWV WR OHVV WKDQ VLJQLILFDQW  EF /HVVWKDQVLJQLILFDQWLPSDFW1RVHQVLWLYHELRORJLFDOFRPPXQLWLHVLQFOXGLQJULSDULDQKDELWDW DUH SURSRVHG IRU UHPRYDO 6HH 'LVFXVVLRQ D  DERYH IRU PRUH LQIRUPDWLRQ1RZHWODQGVZHUH REVHUYHGZLWKLQRULPPHGLDWHO\DGMDFHQWWRWKHVWXG\DUHD7KHVWXG\DUHDGRHVQRWFRQWDLQDQ\ VSHFLDOVWDWXVILVKVSHFLHVRUILVKEHDULQJZDWHUFRXUVHVRUZDWHUERGLHV7KH6WXG\$UHDFRQWDLQVWZR  &ODVV,,ZDWHUFRXUVHVDQGIRXU  &ODVV,,,ZDWHUFRXUVHVWKDWZHUHREVHUYHGDQGPDSSHGRQVLWH 7KHFORVHVWZDWHUFRXUVHLVD&ODVV,,ZDWHUFRXUVHORFDWHGRQ$31 H[LVWLQJ3DUFHODQG SURSRVHG3DUFHO RIWKHVWXG\DUHD7KLV&ODVV,,ZDWHUFRXUVHLVPDSSHGRQWKH86):61DWLRQDO :HWODQG,QYHQWRU\DVDULYHULQHKDELWDWFODVVLILHGDV56%&56%&LVDULYHULQHLQWHUPLWWHQWV\VWHP ZLWKDVWUHDPEHGDQGLVVHDVRQDOO\IORRGHG5LYHULQHV\VWHPVDUHFRQVLGHUHGZDWHUFRXUVHVIRUWKH SXUSRVHVRIWKLVDVVHVVPHQW7KH3URSRVHG3URMHFWZLOOQRWLPSDFWWKLVZDWHUFRXUVHDVLWZRXOGEH LQFOXGHGLQSURSRVHG3DUFHOZKLFKZLOOEHSUHVHUYHGDVRSHQVSDFH)RUWKHUHDVRQVGLVFXVVHG DERYHWKH3URMHFWZRXOGQRWUHVXOWLQDVLJQLILFDQWLPSDFWWRVHQVLWLYHELRORJLFDOFRPPXQLWLHVRU ZHWODQGV,IIXWXUHZRUNLQRUDGMDFHQWWRDQ\RIWKHRWKHUZDWHUFRXUVHVDUHSURSRVHGWKH'HYHORSHU LVUHTXLUHGWRREWDLQQHFHVVDU\UHJXODWRU\SHUPLWVIURPWKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIH DQGWKH5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUGDVQHFHVVDU\,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  G /HVVWKDQVLJQLILFDQWLPSDFW7KHUHDUHQRHVWDEOLVKHGQDWLYHUHVLGHQWRUPLJUDWRU\ZLOGOLIH FRUULGRUV RU QDWLYH ZLOGOLIH QXUVHU\ VLWHV ZLWKLQ WKH 3URMHFW DUHD%HFDXVH WKH3URMHFWLQFOXGHV SUHVHUYDWLRQRIDSSUR[LPDWHO\DFUHVWKH3URMHFWZLOOSUHVHUYHH[LVWLQJKDELWDWIRUZLOGOLIHVSHFLHV 7KHSRWHQWLDOIRUORZGHQVLW\UHVLGHQWLDOGHYHORSPHQWPD\LQFOXGHVRPHPLQRUYHJHWDWLRQUHPRYDO EXWLWZRXOGQRWVXEVWDQWLDOO\FKDQJHIRUDJLQJRUZLQWHULQJKDELWDWIRUPLJUDWRU\ELUGV$GGLWLRQDOO\QR VLJQLILFDQW LPSDFWV WR PLJUDWRU\ FRUULGRUV IRU DPSKLELDQDTXDWLF DYLDQ PDPPDOLDQ RU UHSWLOLDQ VSHFLHVLVH[SHFWHGDVDUHVXOWRIWKH3URSRVHG3URMHFW,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  HI /HVVWKDQVLJQLILFDQWLPSDFW7KHUHDUHQRDGRSWHG+DELWDW&RQVHUYDWLRQ3ODQVIRUWKH&LW\RI 8NLDKQRUWKHODUJHU8NLDK9DOOH\WKDWDSSO\WRWKHVLWH7KH3URMHFWSURSRVHVDSSUR[LPDWHO\DFUHV RIRSHQVSDFHIRUZLOGOLIHKDELWDW,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  0LWLJDWLRQ0HDVXUHV  %,26HQVLWLYH7UHHV ,IWUHHVDUHSURSRVHGIRUUHPRYDOSUHFRQVWUXFWLRQVXUYH\VVKDOOEHFRQGXFWHGE\DTXDOLILHGELRORJLVW WRLGHQWLI\2UHJRQZKLWHRDNIRUHVWDQGZRRGODQGDVZHOODV&DOLIRUQLDED\IRUHVWDQGZRRGODQG KDELWDWUHPRYDORIVHQVLWLYHKDELWDWVKDOOEHFRQGXFWHGLQDFFRUGDQFHZLWK&DOLIRUQLD'HSDUWPHQWRI )LVKDQG:LOGOLIH &'): UHJXODWLRQV  %,26HQVLWLYH $PSKLELDQ 6SHFLHV $ TXDOLILHG ELRORJLVW VKDOO VXUYH\ WKH DUHD SULRU WR DQ\ JURXQGEUHDNLQJDFWLYLWLHVWRGHWHUPLQHWKHSUHVHQFHRI5HGEHOO\QHZWRURWKHUVHQVLWLYHDPSKLELDQ VSHFLHVDQGLGHQWLI\DGGLWLRQDODYRLGDQFHPHDVXUHVLIQHHGHG$TXDOLILHGELRORJLVWVKDOOEHRQVLWH IRUDQ\GHZDWHULQJHYHQWWRDGGUHVVWKHSRWHQWLDOIRUWKHSUHVHQFHRIVHQVLWLYHDPSKLELDQVSHFLHV VXFKDVIRRWKLOO\HOORZOHJJHGIURJ 5DQDER\OLL   %,21HVWLQJ%LUGV3UHFRQVWUXFWLRQVXUYH\VVKDOOEHFRQGXFWHGSULRUWRDQ\YHJHWDWLRQUHPRYDO RUJURXQGGLVWXUELQJDFWLYLWLHVRFFXUULQJEHWZHHQ0DUFKDQG$XJXVWRIDQ\\HDU$OODFWLYHELUG Page 355 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  QHVWVVKDOOQRWEHUHPRYHGUHORFDWHGRURWKHUZLVHGLVWXUEHGIRUDQ\SXUSRVHXQWLODOOIOHGJOLQJVKDYH OHIWWKHQHVW  %,26SHFLDO6WDWXV,QVHFWV$TXDOLILHGELRORJLVWVKDOOVXUYH\WKHDUHDSULRUWRDQ\JURXQGEUHDNLQJ DFWLYLWLHVWRGHWHUPLQHWKHSUHVHQFHRIVSHFLDOVWDWXVLQVHFWVSHFLHVDQGLGHQWLI\DGGLWLRQDODYRLGDQFH PHDVXUHVLIQHHGHG,IDVSHFLDOVWDWXVLQVHFWQHVWVDUHREVHUYHGDFWLYHQHVWVVKDOOQRWEHUHPRYHG UHORFDWHGRURWKHUZLVHGLVWXUEHGXQWLOWKHQHVWEHFRPHVLQDFWLYH  %,2 6SHFLDO6WDWXV 0DPPDOV3UHFRQVWUXFWLRQ VXUYH\V VKDOO EH FRQGXFWHG SULRU WR DQ\ YHJHWDWLRQUHPRYDORUJURXQGGLVWXUELQJDFWLYLWLHV,IHYLGHQFHRIEDWURRVWVLVREVHUYHG LHEDWJXDQR DPPRQLDRGRUJUHDVHVWDLQHGFDYLWLHV DURXQGWUHHVRUVWUXFWXUHVSUHFRQVWUXFWLRQEDWVXUYH\VVKDOO EHFRQGXFWHGE\DTXDOLILHGELRORJLVWIRUDFWLYLWLHVWKDWPD\DIIHFWEDWURRVWLQJKDELWDWDQGGHQVLWHV  &XOWXUDO5HVRXUFHV &8/785$/5(6285&(6:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D &DXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKHVLJQLILFDQFHRID KLVWRULFDOUHVRXUFHDVGHILQHGLQ†" E &DXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKHVLJQLILFDQFHRI DQDUFKDHRORJLFDOUHVRXUFHSXUVXDQWWR†" F 'LVWXUEDQ\KXPDQUHPDLQVLQFOXGLQJWKRVHLQWHUUHGRXWVLGH RIGHGLFDWHGFHPHWHULHV"  6LJQLILFDQFH &ULWHULD7KH SURSRVHG3URMHFWZRXOGVLJQLILFDQWO\LPSDFW FXOWXUDO UHVRXUFHVLI WKH VLJQLILFDQFHRIDKLVWRULFDORUDUFKDHRORJLFDOUHVRXUFHZHUHVXEVWDQWLDOO\FKDQJHGRULIKXPDQUHPDLQV ZHUHGLVWXUEHG 8QGHU&(4$FXOWXUDOUHVRXUFHVPXVWEHHYDOXDWHGWRGHWHUPLQHWKHLUHOLJLELOLW\IRUOLVWLQJLQWKH &DOLIRUQLD5HJLVWHURI+LVWRULF5HVRXUFHV &5+5 ,IDFXOWXUDOUHVRXUFHLVGHWHUPLQHGLQHOLJLEOHIRU OLVWLQJRQWKH&5+5WKHUHVRXUFHLVUHOHDVHGIURPPDQDJHPHQWUHVSRQVLELOLWLHVDQGDSURMHFWFDQ SURFHHGZLWKRXWIXUWKHUFXOWXUDOUHVRXUFHFRQVLGHUDWLRQV $VVHWIRUWKLQ6HFWLRQ F RIWKH3XEOLF5HVRXUFHV&RGHIRUDFXOWXUDOUHVRXUFHWREHGHHPHG ³LPSRUWDQW´XQGHU&(4$DQGWKXVHOLJLEOHIRUOLVWLQJRQWKH&DOLIRUQLD5HJLVWHURI+LVWRULF5HVRXUFHV &5+5 LWPXVWPHHWDWOHDVWRQHRIWKHIROORZLQJFULWHULD  ,VDVVRFLDWHGZLWKHYHQWVWKDWKDYHPDGHDVLJQLILFDQWFRQWULEXWLRQWRWKHEURDGSDWWHUQVRI &DOLIRUQLD+LVWRU\DQGFXOWXUDOKHULWDJHRU  ,VDVVRFLDWHGZLWKWKHOLYHVRISHUVRQVLPSRUWDQWWRRXUSDVWRU  (PERGLHVWKHGLVWLQFWLYHFKDUDFWHULVWLFVRIDW\SHSHULRGUHJLRQRUPHWKRGRIFRQVWUXFWLRQRU UHSUHVHQWVWKHZRUNRIDQLPSRUWDQWFUHDWLYHLQGLYLGXDORUSRVVHVVKLJKDUWLVWLFYDOXHRU  +DV\LHOGHGRULVOLNHO\WR\LHOGLQIRUPDWLRQLPSRUWDQWWRSUHKLVWRU\RUKLVWRU\  $UFKDHRORJLFDO UHVRXUFHV DUH FRPPRQO\ HYDOXDWHG ZLWK UHJDUG WR &ULWHULD  UHVHDUFK SRWHQWLDO  +LVWRULFHUDVWUXFWXUHVROGHUWKDQ\HDUVDUHPRVWFRPPRQO\HYDOXDWHGLQUHIHUHQFHWR&ULWHULD LPSRUWDQWHYHQWV &ULWHULD LPSRUWDQWSHUVRQV RU&ULWHULD DUFKLWHFWXUDOYDOXH 7REHFRQVLGHUHG Page 356 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  HOLJLEOHXQGHUWKHVHFULWHULDWKHSURSHUW\PXVWUHWDLQVXIILFLHQWLQWHJULW\WRFRQYH\LWVLPSRUWDQWTXDOLWLHV ,QWHJULW\ LV MXGJHG LQ UHODWLRQ WR VHYHQ DVSHFWV LQFOXGLQJ ORFDWLRQ GHVLJQ VHWWLQJ PDWHULDOV ZRUNPDQVKLSIHHOLQJDQGDVVRFLDWLRQ  *XLGHOLQHVIRUWKHLPSOHPHQWDWLRQRI&(4$GHILQHSURFHGXUHVW\SHVRIDFWLYLWLHVSHUVRQVDQGSXEOLF DJHQFLHVUHTXLUHGWRFRPSO\ZLWK&(4$6HFWLRQ E SUHVFULEHVWKDWSURMHFWHIIHFWVWKDWZRXOG ³FDXVHDVXEVWDQWLDODGYHUVHFKDQJHLQWKHVLJQLILFDQFHRIDQKLVWRULFDOUHVRXUFH´DUHVLJQLILFDQWHIIHFWV RQWKHHQYLURQPHQW6XEVWDQWLDODGYHUVHFKDQJHVLQFOXGHERWKSK\VLFDOFKDQJHVWRWKHKLVWRULFDO UHVRXUFHRUWRLWVLPPHGLDWHVXUURXQGLQJV  3XEOLF5HVRXUFHV&RGH6HFWLRQDOVRGHILQHV³XQLTXHDUFKDHRORJLFDOUHVRXUFHV´DV³DQ\ DUFKDHRORJLFDODUWLIDFWREMHFWRUVLWHDERXWZKLFKLWFDQEHFOHDUO\GHPRQVWUDWHGWKDWZLWKRXWPHUHO\ DGGLQJWRWKHFXUUHQWERG\RINQRZOHGJHWKHUHLVDKLJKSUREDELOLW\WKDWLWPHHWVDQ\RIWKHIROORZLQJ FULWHULD •&RQWDLQVLQIRUPDWLRQQHHGHGWRDQVZHULPSRUWDQWVFLHQWLILFUHVHDUFKTXHVWLRQVDQGVKRZWKDW WKHUHLVDGHPRQVWUDEOHSXEOLFLQWHUHVWLQWKDWLQIRUPDWLRQ •+DVDVSHFLDODQGSDUWLFXODUTXDOLW\VXFKDVEHLQJWKHROGHVWRILWVW\SHRUWKHEHVWDYDLODEOH  H[DPSOHRILWVW\SH •,VGLUHFWO\DVVRFLDWHGZLWKDVFLHQWLILFDOO\UHFRJQL]HGLPSRUWDQWSUHKLVWRULFRUKLVWRULFHYHQWRU SHUVRQ  7KLVGHILQLWLRQLVHTXDOO\DSSOLFDEOHWRUHFRJQL]LQJ³DXQLTXHSDOHRQWRORJLFDOUHVRXUFHRUVLWH´&(4$ 6HFWLRQ D  ' ZKLFKLQGLFDWHV³JHQHUDOO\DUHVRXUFHVKDOOEHFRQVLGHUHGKLVWRULFDOO\ VLJQLILFDQWLILWKDV\LHOGHGRUPD\EHOLNHO\WR\LHOGLQIRUPDWLRQLPSRUWDQWLQSUHKLVWRU\RUKLVWRU\´ SURYLGHVDGGLWLRQDOJXLGDQFH  $VVHPEO\%LOO HIIHFWLYHRQ-XO\ UHTXLUHVWKDWEHIRUHDQHJDWLYHGHFODUDWLRQPLWLJDWHG QHJDWLYHGHFODUDWLRQRUHQYLURQPHQWDOLPSDFWUHSRUWIRUDSURMHFWLVSUHSDUHGWKHOHDGDJHQF\IRUWKH SURMHFWPXVWVHHNFRQVXOWDWLRQZLWKWULEHVDVVRFLDWHGZLWKWKHORFDWLRQRIWKHSURMHFW7RUHFHLYH UHIHUUDOVHDFKWULEHPXVWKDYHSUHYLRXVO\PDGHDZULWWHQUHTXHVWWRWKHOHDGDJHQF\LQRUGHUWREH FRQVXOWHGRQSURMHFWVRFFXUULQJLQWKHLUJHRJUDSKLFDUHDVRILQWHUHVW)RUDOOSURMHFWVQHFHVVLWDWLQJ UHIHUUDOVWDIIDOVRH[WHQGVUHYLHZRSSRUWXQLW\RIDQ\GLVFUHWLRQDU\SURMHFWWRUHOHYDQWRUQHDUE\HQWLWLHV LGHQWLILHGE\WKH1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ 1$+&   (QYLURQPHQWDO6HWWLQJ7KH8NLDK7RZQVKLSOLHVLQDYDOOH\RIWKH5XVVLDQ5LYHUERXQGHGRQWKH QRUWKE\&DOSHOOD7RZQVKLSRQWKHHDVWE\/DNH&RXQW\RQWKHVRXWKE\6DQHO7RZQVKLSDQGRQWKH ZHVWE\$QGHUVRQ7RZQVKLS7KH&LW\RI8NLDKZDVILUVWVHWWOHGLQE\6DPXHO/RZU\,QLWLDOO\ LQFRUSRUDWHGLQWR6RQRPD&RXQW\DQLQGHSHQGHQW0HQGRFLQR&RXQW\JRYHUQPHQWZDVHVWDEOLVKHG LQZLWK8NLDKDVWKHFKRVHQFRXQW\VHDW/RJJLQJFDWWOHDQGDJULFXOWXUDOYHQWXUHVFRQWULEXWHG WRWKHHDUO\VHWWOHPHQWDQGJURZWKRI8NLDKWKURXJKRXWWKHUHPDLQGHURIWKHWKFHQWXU\DQGHDUO\WK FHQWXU\LVWKHGDWHUHFRUGHGIRUWKHILUVWDUULYDORIWKHWUDLQWR8NLDKTXLFNO\UHVXOWLQJLQLQFUHDVHG VHWWOHPHQWRIWKH&LW\DQGLWVHQYLURQV7KH&LW\RI8NLDKLVZLWKLQWKHWHUULWRU\RIWKH1RUWKHUQ3RPR 3HUPDQHQWYLOODJHVZHUHRIWHQHVWDEOLVKHGLQDUHDVZLWKDFFHVVWRVWDSOHIRRGVRIWHQWLPHVDORQJHFR WRQHV WUDQVLWLRQVEHWZHHQYDU\LQJHQYLURQPHQWV ZLWKDFFHVVWRJRRGZDWHUDQGJHQHUDOO\IODWODQG (QYLURQPHQWDO6FLHQFH$VVRFLDWHV $UHDVWKDWDUHPRVWW\SLFDOO\FXOWXUDOO\VHQVLWLYHLQFOXGH WKRVHDGMDFHQWWRVWUHDPVVSULQJVDQGPLGVORSHEHQFKHVDERYHZDWHUFRXUVHVEHFDXVH1DWLYH $PHULFDQVDQGVHWWOHUVIDYRUHGHDV\DFFHVVWRSRWDEOHZDWHU Page 357 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  7KHQDPH8NLDKLVDPRGLILFDWLRQRIWKH,QGLDQZRUG<2.,$RU<2.$<2ZKLFKVLJQLILHG³GHHS YDOOH\´'LVWULEXWHGRYHUWKHODQGVRI0HQGRFLQR/DNHDQG6RQRPD&RXQWLHVDUHPDQ\LQGHSHQGHQW EDQGVRI3RPR,QGLDQV6HYHQGLVWLQFWDQGPXWXDOO\XQLQWHOOLJLEOHODQJXDJHVDUHUHFRJQL]HGXQGHUWKH UXEULFRI3RPR7KHVHODQJXDJHVDUHGHOLQHDWHGE\JHRJUDSKLFGLYLVLRQVZKLFKLQFOXGH1RUWKHUQ &HQWUDO6RXWKHUQ(DVWHUQ6RXWKHDVWHUQ1RUWKHDVWHUQDQG6RXWKZHVWHUQ7KHODQGWKDWFRQWDLQV WKHSURMHFWDUHDLVHWKQRJUDSKLFDOO\DWWULEXWHGWRVSHDNHUVRIWKH&HQWUDO3RPRODQJXDJH (DUO\VHWWOHUVLQ0HQGRFLQR&RXQW\IRXQGWKHLQWHULRUFRDVWYDOOH\VLGHDOIRUIDUPLQJDQGUDQFKLQJ 3UREOHPVTXLFNO\GHYHORSHGEHWZHHQ$QJORVHWWHUVDQGORFDO1DWLYH$PHULFDQVLQYROYLQJVWUXJJOHV RYHUWHUULWRU\DQGFRPSHWLWLRQRYHUIRRGEHWZHHQOLYHVWRFNDQGSHRSOH,QWZR,QGLDQUHVHUYDWLRQV ZHUHHVWDEOLVKHGLQ0HQGRFLQR&RXQW\IRUWKHSXUSRVHRI³FROOHFWLQJUHPRYLQJDQGVXEVLVWLQJ´ORFDO WULEHV7KH0HQGRFLQR5HVHUYDWLRQZDVHVWDEOLVKHGRQWKHFRDVWQHDU)RUW%UDJJDQGWKH1RPH&XOW )DUPLQ5RXQG9DOOH\$IWHUVRPH\HDUVRQWKH1RPH&XOW)DUP&DSWDLQ-DFNDQGDJURXSRI3RWWHU 9DOOH\,QGLDQVOHIWWKHUHVHUYDWLRQDQGUHWXUQHGKRPH,QWKH\SXUFKDVHGODQGQHDU8NLDKZKLFK ODWHUEHFDPHNQRZQDV3LQROHYLOOHDQGLVWKH3LQROHYLOOH5DQFKHULDWRGD\ORFDWHGQRUWKRIWKH&LW\ OLPLWV7ZRXQQDPHGFUHHNGUDLQDJHVIORZWKURXJKWZRRIWKHSDUFHOVDWWKHERWWRPRIVWHHSFDQ\RQV 7KHWHUUDLQLVYHU\UXJJHGDQGVWHHSYHU\IHZDUHDVRIIODWWHUUDLQDUHSUHVHQW7ZRSHUHQQLDOVWUHDPV IORZDERXWIHHWWRWKHQRUWKDQGVRXWK²*LEVRQ&UHHNDQG'RRODQ&UHHNUHVSHFWLYHO\7KHVRLOV DUHFKDUDFWHUL]HGDVERWK+RSODQGZKLFKFRQVLVWRIIYHU\GHHSZHOOGUDLQHGVRLOVIRUPHGLQFROOXYLXP DQGUHVLGXXPZHDWKHUHGIURPVDQGVWRQHRUVKDOHRQVWHHSKLOOVDQGVORSHVDQG0D\PHQVRLOVWKDW DUHVKDOORZVRPHZKDWH[FHVVLYHO\GUDLQHGVRLOVWKDWIRUPHGLQUHVLGXXPZHDWKHUHGIURPVKDOH VFKLVWJUHHQVWRQHVDQGVWRQHDQGFRQJORPHUDWH7KHVHVRLOVKDYHDVKDOORZGHSWKWREHGURFN 'LVFXVVLRQ DF /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG$Q$UFKHRORJLFDO 6XUYH\5HSRUW $65RPLWWHGIRUFRQILGHQWLDOLW\ ZDVSUHSDUHGE\$OWD$UFKHRORJLFDO&RQVXOWLQJ $OWD  LQ 0DUFK  7KH SXUSRVH RI WKH $65 LV WR LGHQWLI\ DQ\ DUFKDHRORJLFDO KLVWRULFDO RU FXOWXUDO UHVRXUFHVORFDWHGZLWKLQWKHDFUHV $31V  LQFOXGHGLQWKH'HYHORSPHQW$JUHHPHQWWREHGHYHORSHGZLWKVLQJOHIDPLO\KRPHVDWVRPH SRLQWLQWKHIXWXUH 2Q-DQXDU\$OWDUHTXHVWHGDUHFRUGVVHDUFKDWWKH1RUWKZHVW,QIRUPDWLRQ&HQWHU 1:,&  ORFDWHGRQWKHFDPSXVRI6RQRPD6WDWH8QLYHUVLW\ )LOH1R 7KH1:,&DQDIILOLDWHRIWKH 6WDWHRI&DOLIRUQLD2IILFHRI+LVWRULF3UHVHUYDWLRQLVWKHRIILFLDOVWDWHUHSRVLWRU\RIDUFKDHRORJLFDODQG KLVWRULFDOUHFRUGVDQGUHSRUWVIRUDQFRXQW\DUHDWKDWLQFOXGHV0HQGRFLQR&RXQW\7KHUHFRUGV VHDUFKLQFOXGHGDUHYLHZRIDOOVWXG\UHSRUWVRQILOHZLWKLQDRQHKDOIPLOHUDGLXVRIWKH3URMHFW$UHD $ VHDUFK RI FXOWXUDO UHVRXUFHV LQFOXGHG D RQHTXDUWHUPLOH UDGLXV 6RXUFHV FRQVXOWHG LQFOXGH DUFKDHRORJLFDOVLWHDQGVXUYH\EDVHPDSVVXUYH\UHSRUWVVLWHUHFRUGVDQGKLVWRULF*HQHUDO/DQG 2IILFH */2  PDSV WKH 1DWLRQDO 5HJLVWHU RI +LVWRULF 3ODFHV &DOLIRUQLD +LVWRULFDO /DQGPDUNV &DOLIRUQLD5HJLVWHURI+LVWRULFDO5HVRXUFHVDQGWKH&DOLIRUQLD3RLQWVRI+LVWRULFDO,QWHUHVWDVXSGDWHG E\WKH2IILFHRI+LVWRULF3UHVHUYDWLRQ 2+3 +LVWRU\3URSHUW\'LUHFWRU\ 2+3 7KH2+3%XLOW (QYLURQPHQW5HVRXUFH'LUHFWRU\ %(5' ZDVDOVRUHYLHZHGIRUWKH&LW\RI8NLDK$UHYLHZRIKLVWRULF UHJLVWHUVDQGLQYHQWRULHVLQGLFDWHWKDWQRKLVWRULFDOODQGPDUNVRUSRLQWVRILQWHUHVWDUHSUHVHQWLQWKH 3URMHFWDUHD1R1DWLRQDO5HJLVWHUOLVWHGRUHOLJLEOHSURSHUWLHVDUHORFDWHGZLWKLQWKHPLOHYLVXDO DUHDRIWKH3URMHFWDUHD $UHYLHZRIDUFKDHRORJLFDOVLWHDQGVXUYH\PDSVUHYHDOHGWKDWWKUHHFXOWXUDOUHVRXUFHVWXGLHVKDYH EHHQSUHYLRXVO\SHUIRUPHGZLWKLQDRQHKDOIPLOHUDGLXVRIWKHFXUUHQW3URMHFWDUHDDQGRQHVWXG\KDV EHHQFRQGXFWHGZLWKLQWKH3URMHFWDUHDWKHVWXGLHVIRXQGWKDWQRFXOWXUDOUHVRXUFHVDUHGRFXPHQWHG ZLWKLQTXDUWHUPLOHUDGLXVRIWKH3URMHFWDUHDQRUZLWKLQWKH3URMHFWDUHLWVHOI  $ILHOGVXUYH\ZDVFRQGXFWHGE\$OWDRQ)HEUXDU\'XHWRYHU\VWHHSWHUUDLQ VRPHDUHDV FRQWDLQ VORSHV JUHDWHU WKDQ  DQG YHJHWDWLRQ FRYHU WKH ILHOG VXUYH\ ZDV FRQGXFWHG RQ Page 358 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  DSSUR[LPDWHO\DFUHV DUHDVZLWKOHVVWKDQRUDSSUR[LPDWHO\VORSH LQFOXGLQJDUHDVDORQJ URDGZD\VDQGZDONDEOHVORSHVDQGIODWDUHDVZLWKH[SRVHGVRLOVWRLQYHVWLJDWHIRUHYLGHQFHRIFXOWXUDO PDWHULDOV6XUYH\DUHDVLQFOXGHGSRWHQWLDOKRXVHVLWHVWKHSURSRVHGZDWHUWDQNVLWHDQGDUHDVWREH LPSURYHG ZLWKXWLOLWLHVDQG SDYHPHQW DORQJ WKH DFFHVV URDG7KHVH DUHDV ZHUH VXUYH\HG XVLQJ LQWHQVLYHVXUYH\FRYHUDJHZLWKWUDQVHFWVQRJUHDWHUWKDQPHWHULQWHUYDOV$VGHVFULEHGLQWKH$65 DUHDVFRQWDLQLQJVWHHSVORSHVWKDWZHUHQRWDEOHWREHVXUYH\HGDUHQRWFRQVLGHUHGKLJKSUREDELOLW\ DUHDVIRU\LHOGLQJDUFKDHRORJLFDOUHVRXUFHV+RZHYHUWKHVHDUHDVZHUHREVHUYHGXVLQJDFXUVRU\ LQVSHFWLRQRIWKHWHUUDLQDQGODQGVFDSH 1RFXOWXUDOUHVRXUFHVZHUHLGHQWLILHGZLWKLQWKH3URMHFWDUHDDVDUHVXOWRIWKHUHFRUGVVHDUFKOLWHUDWXUH UHYLHZRUDUFKDHRORJLFDOILHOGVXUYH\,QDGGLWLRQJLYHQWKHVWHHSWHUUDLQWKHSRWHQWLDOIRUVXEVWDQWLDO SUHKLVWRULFRUKLVWRULFVHWWOHPHQWLVFRQVLGHUHGORZ7KHUHIRUHWKH3URMHFWDFWLYLWLHVDUHQRWDQWLFLSDWHG WR FDXVH D VXEVWDQWLDODGYHUVH FKDQJH LQ WKHVLJQLILFDQFH RI D KLVWRULFDO UHVRXUFH DV GHILQHG LQ † $OWKRXJK QR WULEHV KDYH FRQWDFWHG WKH &LW\ RI 8NLDK WR UHTXHVW QRWLILFDWLRQ XQGHU $% WULEDO QRWLILFDWLRQV RIIHULQJ WKH RSSRUWXQLW\ WR UHTXHVW IRUPDO FRQVXOWDWLRQ ZHUH VHQW WR ORFDO WULEHV RQ 'HFHPEHU,QDGGLWLRQDUHTXHVWVHHNLQJDOLVWRIWULEHVWKDWVKRXOGEHFRQWDFWHGZDVVHQW WRWKH1$+&1RWLFHVZHUHVHQWWRWKHDGGLWLRQDOWULEHVLGHQWLILHGE\WKH1$+&RQ-DQXDU\ 2Q-DQXDU\DUHTXHVWIRUIRUPDOFRQVXOWDWLRQE\WKH3LQROHYLOOH3RPR1DWLRQZDVUHFHLYHG $%FRQVXOWDWLRQZDVFRQFOXGHGZLWKWKHWULEHRQ0D\&RUUHVSRQGHQFHZLWK3LQROHYLOOH 3RPR 1DWLRQ KDV EHHQ RPLWWHG IRU FRQILGHQWLDOLW\ 7KH OLVW RI WULEHV FRQWDFWHG DUH LQFOXGHG LQ $WWDFKPHQW& 'HVSLWHWKHQHJDWLYHILQGLQJVDQGWKHORZSRWHQWLDOIRUEXULHGGHSRVLWVLQWKHDUHDLWLVSRVVLEOH XQDQWLFLSDWHGGLVFRYHULHVRIFXOWXUDODQGDUFKDHRORJLFDOUHVRXUFHVFDQRFFXUGXULQJJURXQGGLVWXUELQJ DFWLYLWLHVLQDUHDVFRQVLGHUHGWREHRIORZVHQVLWLYLW\7KHUHIRUHWKHIROORZLQJPLWLJDWLRQPHDVXUHV WKDWZLOOEHLQFRUSRUDWHGDV&RQGLWLRQVRI$SSURYDOIRUIXWXUHGHYHORSPHQW DUHSURSRVHGWRHQVXUH WKDW XQNQRZQ FXOWXUDO UHVRXUFHV DUH QRW DGYHUVHO\ DIIHFWHG E\ WKH 3URSRVHG 3URMHFW,PSDFWVWR FXOWXUDO DUFKHRORJLFDO DQG KLVWRULFDO UHVRXUFHV ZRXOG EHOHVV WKDQ VLJQLILFDQW ZLWK PLWLJDWLRQ LQFRUSRUDWHG  0LWLJDWLRQ0HDVXUHV  &8/8QDQWLFLSDWHG 'LVFRYHU\ ,I SUHYLRXVO\ XQLGHQWLILHG FXOWXUDO KLVWRULF SDOHQWRORJLF RU DUFKHRORJLFUHVRXUFHVDUHHQFRXQWHUHGGXULQJSURMHFWLPSOHPHQWDWLRQDOWHULQJWKHPDWHULDOVDQGWKHLU VWUDWLJUDSKLF FRQWH[WVKDOO EH DYRLGHG DQG ZRUN VKDOO KDOW LPPHGLDWHO\ $ TXDOLILHG SURIHVVLRQDO DUFKDHRORJLVWVKDOOEHFRQWDFWHGWRHYDOXDWHWKHUHVRXUFHDQGPHWKRGVQHFHVVDU\WRSURWHFWLW3URMHFW SHUVRQQHOVKDOOQRWFROOHFWPRYHRUGLVWXUEFXOWXUDOUHVRXUFHV3UHKLVWRULFUHVRXUFHVLQFOXGHEXWDUH QRW OLPLWHG WR FKHUW RU REVLGLDQ IODNHV SURMHFWLOH SRLQWV PRUWDUV SHVWOHV DQG GDUN IULDEOH VRLO FRQWDLQLQJVKHOODQGERQHGLHWDU\GHEULVKHDWDIIHFWHGURFNRUKXPDQEXULDOV+LVWRULFUHVRXUFHV LQFOXGHVWRQHRUDERGHIRXQGDWLRQVRUZDOOVVWUXFWXUHVDQGUHPDLQVZLWKVTXDUHQDLOVDQGUHIXVH GHSRVLWVRUERWWOHGXPSVRIWHQORFDWHGLQROGZHOOVRUSULYLHV  &8/(QFRXQWHULQJ1DWLYH$PHULFDQ5HPDLQV,IKXPDQUHPDLQVDUHHQFRXQWHUHGGXULQJJURXQG GLVWXUELQJDFWLYLWLHVDOOZRUNVKDOOVWRSLQWKHLPPHGLDWHYLFLQLW\RIWKHGLVFRYHUHGUHPDLQVDQGWKH &RXQW\&RURQHUDQGDTXDOLILHGDUFKDHRORJLVWVKDOOEHQRWLILHGLPPHGLDWHO\VRWKDWDQHYDOXDWLRQFDQ EHSHUIRUPHG,IWKHUHPDLQVDUHGHHPHGWREH1DWLYH$PHULFDQDQGSUHKLVWRULFWKH1DWLYH$PHULFDQ +HULWDJH&RPPLVVLRQPXVWEHFRQWDFWHGE\WKH&RURQHUVRWKDWD³0RVW/LNHO\'HVFHQGDQW´FDQEH GHVLJQDWHGDQGIXUWKHUUHFRPPHQGDWLRQVUHJDUGLQJWUHDWPHQWRIWKHUHPDLQVZLOOEHSURYLGHG  Page 359 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   (QHUJ\ (1(5*<:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 5HVXOWLQSRWHQWLDOO\VLJQLILFDQWHQYLURQPHQWDOLPSDFWGXHWR ZDVWHIXOLQHIILFLHQWRUXQQHFHVVDU\FRQVXPSWLRQRIHQHUJ\ UHVRXUFHVGXULQJSURMHFWFRQVWUXFWLRQRURSHUDWLRQ"  E &RQIOLFWZLWKRUREVWUXFWDVWDWHRUORFDOSODQIRUUHQHZDEOH HQHUJ\RUHQHUJ\HIILFLHQF\"  6LJQLILFDQFH&ULWHULD7KH 3URSRVHG3URMHFWZRXOGVLJQLILFDQWO\LPSDFWHQHUJ\LIFRQVWUXFWLRQRU RSHUDWLRQRIWKH3URMHFWZRXOGUHVXOWLQZDVWHIXOLQHIILFLHQWRUXQQHFHVVDU\FRQVXPSWLRQRIHQHUJ\ UHVRXUFHVRULIWKH3URMHFWZRXOGFRQIOLFWZLWKDVWDWHRUORFDOSODQIRUUHQHZDEOHHQHUJ\RUHQHUJ\ HIILFLHQF\  (QYLURQPHQWDO6HWWLQJ&XUUHQWEXLOGLQJFRGHVUHTXLUHHQHUJ\HIILFLHQF\V\VWHPVWREHLQFOXGHGLQ WKHLUSODQVIRUSHUPLWUHYLHZ7KHVHEXLOGLQJFRGHVDUHUHJXODUO\XSGDWHGVWDWHZLGHWKURXJK&DOLIRUQLD %XLOGLQJ(QHUJ\(IILFLHQF\6WDQGDUGVIRU5HVLGHQWLDODQG1RQUHVLGHQWLDO%XLOGLQJV &DOLIRUQLD&RGHRI 5HJXODWLRQV7LWOH3DUW FRPPRQO\UHIHUUHGWRDV³7LWOH´,QJHQHUDO7LWOHUHTXLUHVWKH GHVLJQRIEXLOGLQJVKHOOVDQGEXLOGLQJFRPSRQHQWVWRFRQVHUYHHQHUJ\ZLWKVWDQGDUGVWRSURPRWH EHWWHU ZLQGRZV LQVXODWLRQ OLJKWLQJ YHQWLODWLRQ V\VWHPV DQG RWKHU IHDWXUHV WKDW UHGXFH HQHUJ\ FRQVXPSWLRQLQKRPHVDQGEXVLQHVVHV7KHVWDQGDUGVDUHXSGDWHGSHULRGLFDOO\WRDOORZFRQVLGHUDWLRQ DQGSRVVLEOHLQFRUSRUDWLRQRIQHZHQHUJ\HIILFLHQF\WHFKQRORJLHVDQGPHWKRGV7KHFXUUHQW7LWOH UHJXODWLRQV DQG%XLOGLQJ (QHUJ\ (IILFLHQF\ 6WDQGDUGVSURPRWH SKRWRYROWDLF V\VWHPVLQ QHZO\ FRQVWUXFWHGUHVLGHQWLDOEXLOGLQJV7KH&LW\¶V(OHFWULF8WLOLW\'HSDUWPHQWKDVDVRODUUHEDWHSURJUDPIRU UHVLGHQWVDQGEXVLQHVVRZQHUVWRHQFRXUDJHGORFDOFRQVXPHUVWRLQFUHDVLQJO\UHO\RQUHQHZDEOH UHVRXUFHVIRUWKHLUGLUHFWSRZHUQHHGV  'LVFXVVLRQ DE /HVVWKDQVLJQLILFDQWLPSDFW7KH3URSRVHG3URMHFWLQFOXGLQJWKH'HYHORSPHQW $JUHHPHQW GRHV QRW LQFOXGH VSHFLILF GHYHORSPHQW GHVLJQV RU SURSRVDOV QRU GRHV LW JUDQW DQ\ HQWLWOHPHQWVIRUGHYHORSPHQW)XWXUHKRXVLQJSURMHFWVZLOOEHDQDO\]HGRQDSURMHFWOHYHOEDVLVVXEMHFW WRWKH&RXQW\¶VDQG&LW\¶VEXLOGLQJDQGVDIHW\FRGHVDVZHOODV7LWOHUHJXODWLRQV DQGRWKHUV WR SURPRWHHQHUJ\HIILFLHQF\  *HQHUDOO\VSHDNLQJIXWXUHSURMHFWFRQVWUXFWLRQZRXOGFRQVXPHHQHUJ\LQWZRJHQHUDOIRUPV  WKH IXHOHQHUJ\FRQVXPHGE\FRQVWUXFWLRQYHKLFOHVDQGHTXLSPHQWDQG  ERXQGHQHUJ\LQFRQVWUXFWLRQ PDWHULDOVVXFKDVDVSKDOWVWHHOFRQFUHWHSLSHVDQGPDQXIDFWXUHGRUSURFHVVHGPDWHULDOVVXFKDV OXPEHUDQGJODVV)RVVLOIXHOVIRUFRQVWUXFWLRQYHKLFOHVDQGRWKHUHQHUJ\FRQVXPLQJHTXLSPHQWZRXOG EHXVHGGXULQJVLWHFOHDULQJJUDGLQJDQGFRQVWUXFWLRQ)XHOHQHUJ\FRQVXPHGGXULQJFRQVWUXFWLRQ ZRXOGEHWHPSRUDU\DQGZRXOGQRWUHSUHVHQWDVLJQLILFDQWGHPDQGRQHQHUJ\UHVRXUFHV3URMHFW FRQVWUXFWLRQHTXLSPHQWZRXOGDOVREHUHTXLUHGWRFRPSO\ZLWKWKHODWHVW&DOLIRUQLD$LU5HVRXUFHV %RDUG &$5% DQG(QYLURQPHQWDO3URWHFWLRQ$JHQF\ (3$ HQJLQHHPLVVLRQVVWDQGDUGVZKLFKUHTXLUH KLJKO\ HIILFLHQW FRPEXVWLRQ V\VWHPV WKDW PD[LPL]H IXHO HIILFLHQF\ DQG UHGXFH XQQHFHVVDU\ IXHO FRQVXPSWLRQ  2QFHFRQVWUXFWHGIXWXUHUHVLGHQWLDOXVHVZRXOGFRQVXPHHQHUJ\IRULQWHULRUDQGH[WHULRUOLJKWLQJ +9$&V\VWHPVUHIULJHUDWLRQHOHFWURQLFVV\VWHPVDSSOLDQFHVDQGVHFXULW\V\VWHPVDPRQJRWKHU Page 360 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  FRPPRQKRXVHKROGIHDWXUHV+RZHYHUHDFKUHVLGHQFHZRXOGEHUHTXLUHGWRFRPSO\ZLWK7LWOH %XLOGLQJ(QHUJ\(IILFLHQF\6WDQGDUGVZKLFKSURYLGHPLQLPXPHIILFLHQF\VWDQGDUGVUHODWHGWRYDULRXV EXLOGLQJIHDWXUHVLQFOXGLQJDSSOLDQFHVZDWHUDQGVSDFHKHDWLQJDQGFRROLQJHTXLSPHQWEXLOGLQJ LQVXODWLRQDQGURRILQJDQGOLJKWLQJ,PSOHPHQWDWLRQRIWKH7LWOHVWDQGDUGVVLJQLILFDQWO\UHGXFHV HQHUJ\ XVDJH ,Q DGGLWLRQ UHVLGHQWV ZRXOG KDYH DFFHVV WR WKH &LW\¶V VRODU UHEDWH SURJUDP WR LQFHQWLYL]HWKHXVHRIUHQHZDOHQHUJ\  :LWK DGKHUHQFH WR WKH DIRUHPHQWLRQHG UHJXODWLRQV DQG RWKHUV LQWHQGHG WR UHGXFH HQHUJ\ FRQVXPSWLRQLPSDFWVIURPWKH3URSRVHG3URMHFWUHODWHGWRHQHUJ\FRQVXPSWLRQZRXOGEHOHVVWKDQ VLJQLILFDQW  *HRORJ\DQG6RLOV *(2/2*<$1'62,/6:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 'LUHFWO\ RU LQGLUHFWO\ FDXVH SRWHQWLDO VXEVWDQWLDO DGYHUVH HIIHFWVLQFOXGLQJWKHULVNRIORVVLQMXU\RUGHDWKLQYROYLQJ L 5XSWXUHRIDNQRZQHDUWKTXDNHIDXOWDVGHOLQHDWHGRQWKH PRVW UHFHQW $OTXLVW3ULROR (DUWKTXDNH )DXOW =RQLQJ 0DS LVVXHGE\WKH6WDWH*HRORJLVWIRUWKHDUHDRUEDVHGRQRWKHU VXEVWDQWLDOHYLGHQFHRIDNQRZQIDXOW"5HIHUWR'LYLVLRQRI 0LQHVDQG*HRORJ\6SHFLDO3XEOLFDWLRQ"  LL 6WURQJVHLVPLFJURXQGVKDNLQJ" LLL 6HLVPLFUHODWHGJURXQGIDLOXUHLQFOXGLQJOLTXHIDFWLRQ" LY /DQGVOLGHV" E 5HVXOWLQVXEVWDQWLDOVRLOHURVLRQRUWKHORVVRIWRSVRLO" F %HORFDWHGRQDJHRORJLFXQLWRUVRLOWKDWLVXQVWDEOHRUWKDW ZRXOG EHFRPH XQVWDEOH DV D UHVXOW RI WKH SURMHFW DQG SRWHQWLDOO\UHVXOWLQRQRURIIVLWHODQGVOLGHODWHUDOVSUHDGLQJ VXEVLGHQFHOLTXHIDFWLRQRUFROODSVH"  G %HORFDWHGRQH[SDQVLYHVRLODVGHILQHGLQ7DEOH%RI WKH8QLIRUP%XLOGLQJ&RGH  FUHDWLQJVXEVWDQWLDOGLUHFW RULQGLUHFWULVNVWROLIHRUSURSHUW\"  H +DYHVRLOVLQFDSDEOHRIDGHTXDWHO\VXSSRUWLQJWKHXVHRI VHSWLF WDQNV RU DOWHUQDWLYH ZDVWH ZDWHU GLVSRVDO V\VWHPV ZKHUH VHZHUV DUH QRW DYDLODEOH IRU WKH GLVSRVDO RI ZDVWH ZDWHU"  I  'LUHFWO\ RU LQGLUHFWO\ GHVWUR\ D XQLTXH SDOHRQWRORJLFDO UHVRXUFHRUVLWHRUXQLTXHJHRORJLFIHDWXUH"  6LJQLILFDQFH&ULWHULD7KH3URSRVHG3URMHFWZRXOGUHVXOWLQDVLJQLILFDQWLPSDFWWRJHRORJLFDORUVRLO UHVRXUFHVLILWH[SRVHGSHRSOHRUVWUXFWXUHVWRVHLVPLFULVNUXSWXUHGDNQRZQIDXOWSURGXFHGVWURQJ Page 361 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  VHLVPLFJURXQGVKDNLQJJURXQGIDLOXUHOLTXHIDFWLRQODQGVOLGHVRUVXEVWDQWLDOVRLOHURVLRQLVORFDWHG RQH[SDQVLYH VRLO RUXQVWDEOH JURXQGRU ZRXOG FUHDWH XQVWDEOH JURXQGRU GHVWUR\HG D XQLTXH SDOHRQWRORJLFDOUHVRXUFHRUJHRORJLFIHDWXUH  (QYLURQPHQWDO 6HWWLQJ7KH 8NLDK 9DOOH\ LV SDUW RI DQ DFWLYH VHLVPLF UHJLRQ WKDW FRQWDLQV WKH 0D\DFDPD)DXOWZKLFKWUDYHUVHVWKHYDOOH\LQDJHQHUDOO\QRUWKZHVWVRXWKHDVWGLUHFWLRQHDVWRIWKH 3URMHFWDUHD%DVHGRQ&DOLIRUQLD*HRORJLFDO6XUYH\PDSVDQGWKH%DFNJURXQG5HSRUWIRUWKH&RXQW\ RI0HQGRFLQR*HQHUDO3ODQ8SGDWH SUHSDUHGE\30& ODQGVZLWKLQWKH:HVWHUQ+LOOVDUH LGHQWLILHGDVEHLQJORFDWHGRQDVRPHZKDWXQVWDEOHJHRORJLFIRUPDWLRQEXWDUHQRWORFDWHGZLWKLQWKH $OTXLVW3ULROR)DXOW=RQHRULQDODQGVOLGHRUOLTXHIDFWLRQ]RQH+RZHYHUGXHWRVWHHSVORSHV LQ PDQ\DUHDV LQWKH:HVWHUQ+LOOVWKHUHLVVRPHULVNRIKD]DUGVUHODWHGWRVORSHLQVWDELOLW\GHSHQGLQJ RQWKHORFDWLRQLQWHQVLW\DQGGHVLJQRIGHYHORSPHQW  7KH3URMHFWDUHDLVVLWXDWHGZLWKLQWKH&RDVW5DQJHJHRORJLFSURYLQFH7KH1RUWK&RDVW5DQJHLV FRPSULVHGRIDJHRORJLFIHDWXUHXQLTXHWR&DOLIRUQLDWKH)UDQFLVFDQ)RUPDWLRQZKLFKGLFWDWHVWKH YHJHWDWLYHFRPPXQLWLHV7KH)UDQFLVFDQ)RUPDWLRQLVFRPSULVHGRIVHUSHQWLQHVDQGVWRQHDQGRWKHU VHGLPHQWDU\URFNV7KHVRLOVZLWKLQWKH3URMHFWVLWHDUHFKDUDFWHUL]HGDVERWK+RSODQGZKLFKFRQVLVW RI FRQVLVWV RI YHU\ GHHS ZHOO GUDLQHG VRLOV IRUPHG LQ FROOXYLXP DQG UHVLGXXP ZHDWKHUHG IURP VDQGVWRQH RU VKDOH RQ VWHHS KLOOV DQG VORSHV DQG 0D\PHQ VRLOV WKDW DUH VKDOORZ VRPHZKDW H[FHVVLYHO\ GUDLQHG VRLOV WKDW IRUPHG LQ UHVLGXXP ZHDWKHUHG IURP VKDOH VFKLVW JUHHQVWRQH VDQGVWRQHDQGFRQJORPHUDWH7KHVHVRLOVKDYHDVKDOORZGHSWKWREHGURFN  'LVFXVVLRQ DLLLL /HVVWKDQVLJQLILFDQWLPSDFW$VQRWHGDERYHWKH3URMHFWVLWHLVQRWLQD &DOLIRUQLD(DUWKTXDNH)DXOW=RQHDQGLVQRWVXVFHSWLEOHWROLTXHIDFWLRQRUVWURQJVHLVPLFJURXQG VKDNLQJ$OOIXWXUHGHYHORSPHQWZLOOEHUHTXLUHGWRDGKHUHWRVDIHW\DQGVHLVPLFUHJXODWLRQV7KH 3URMHFWGRHVQRWLQFOXGHDSSURYDORIDQ\HQWLWOHPHQWVIRUGHYHORSPHQWRIKRPHV$IWHUWKHSDUFHOVDUH DQQH[HGLQWRWKH&LW\'HYHORSPHQW3DUFHOVZRXOGQRWEHGHYHORSHGXQWLODQDSSOLFDQWVXEPLWVD SURMHFWVSHFLILFVLWHSODQZLWKD8VH3HUPLWDSSOLFDWLRQDQGUHFHLYHV3ODQQLQJ&RPPLVVLRQDSSURYDO IRUGHYHORSPHQWRIDKRPHLQDFFRUGDQFHZLWKWKH+LOOVLGH2YHUOD\=RQLQJ'LVWULFWUHJXODWLRQV$V RXWOLQHG LQ WKH +LOOVLGH 2YHUOD\ 'LVWULFW UHJXODWLRQV 8&& † F  D VRLOV HQJLQHHULQJ UHSRUW FRPSOHWHGE\DSURIHVVLRQDOHQJLQHHUUHJLVWHUHGLQWKHVWDWHRI&DOLIRUQLDLVUHTXLUHGWREHVXEPLWWHG GXULQJWKHGLVFUHWLRQDU\UHYLHZSHULRGIRUGHYHORSPHQWLQFOXGLQJIXWXUHVLQJOHIDPLO\UHVLGHQWLDOZLWKLQ WKH+LOOVLGH2YHUOD\'LVWULFW$OWKRXJK'HYHORSPHQW3DUFHOVPD\EHGHYHORSHGZLWKLQWKH&RXQW\¶V MXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWWKH\ZLOOEHUHTXLUHGWREHGHYHORSHGWR5+VWDQGDUGV WKURXJK&& 5V,QDGGLWLRQDOOPLWLJDWLRQPHDVXUHVLGHQWLILHGIRUUHVLGHQWLDOGHYHORSPHQWLQWKH ,601'ZLOOEHDSSOLHGWR'HYHORSPHQW3DUFHOV$VVXFKLPSDFWVWRJHRORJ\DQGVRLOVUHODWHGWR WKHVHLVVXHVZRXOGEHOHVVWKDQVLJQLILFDQW  DLY EF /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG,PSURYHPHQWRIURDGZD\V LQVWDOODWLRQRIXWLOLWLHVDQGFRQVWUXFWLRQRIWKHZDWHUWDQNVZRXOGEHZLWKLQSUHYLRXVO\GLVWXUEHGDUHDV EXWPD\LQFOXGHDGGLWLRQDOJUDGLQJWUHQFKLQJDQGYHJHWDWLRQUHPRYDO)XWXUHSRWHQWLDOFRQVWUXFWLRQRI VLQJOHIDPLO\KRPHVFRXOGDOVRUHTXLUHYHJHWDWLRQUHPRYDODQGJUDGLQJWKHVHDFWLYLWLHVFRXOGUHVXOWLQ LPSDFWVDVVRFLDWHGZLWKHURVLRQWKHORVVRIWRSVRLODQGODQGVOLGHVLIQRWSURSHUO\GHVLJQHG  +RZHYHUWKHDIRUHPHQWLRQHGDFWLYLWLHVPXVWEHFRPSOHWHGLQDFFRUGDQFHZLWKDSSOLFDEOHVDIHW\FRGHV DQGWKHEHORZVWDQGDUGPLWLJDWLRQPHDVXUHUHTXLUHVVHGLPHQWDQGHURVLRQSODQVLGHQWLI\LQJ%03VWR UHGXFHVRLOHURVLRQDQGZDWHUUXQRIIWRUHGXFHRUDYRLGLPSDFWVWRJHRORJ\DQGVRLOVWREHVXEPLWWHG SULRUWRDQ\JURXQGGLVWXUEDQFHLQDFFRUGDQFHZLWK8NLDK&LW\&RGH ³8&&´ 'LYLVLRQ&KDSWHU (URVLRQDQG6HGLPHQW&RQWURO,QDGGLWLRQ5+GHYHORSPHQWVWDQGDUGV ZKLFKZLOOEHDSSOLHGWRDOO Page 362 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  'HYHORSPHQW3DUFHOV UHTXLUHVXEPLWWDORI*HRWHFKQLFDO5HSRUWV*UDGLQJ3ODQV+\GURORJ\5HSRUWV HWFWRHQVXUHGHYHORSPHQWLVEHLQJSURSHUO\GHVLJQHGDQGZLOOLQFOXGHDVHWRIVLWHSURMHFWVSHFLILF UHFRPPHQGHG %HVW 0DQDJHPHQW 3UDFWLFHV DQG 0LWLJDWLRQ 0HDVXUHV LI QHHGHG  IRU IXWXUH GHYHORSPHQWSURMHFWVWRDYRLGLPSDFWVWRJHRORJ\DQGVRLOV  /DVWO\WKH&LW\¶V+LOOVLGH2YHUOD\'LVWULFWUHTXLUHVGLVFUHWLRQDU\DQGHQYLURQPHQWDOUHYLHZIRUQHZ FRQVWUXFWLRQDQGJUDGLQJDFWLYLWLHVZLWKLQWKH:HVWHUQ+LOOV 'HYHORSPHQW3DUFHOV 6SHFLILFDOO\ DQ\SDUFHORIODQGRUVXEGLYLVLRQKDYLQJDQDYHUDJHJURXQGJUDGLHQWDFURVVDQ\SRUWLRQRIWKHSURSHUW\ LQH[FHVVRIILIWHHQSHUFHQW  UHTXLUHVD8VH3HUPLWLVVXDEOHE\WKH3ODQQLQJ&RPPLVVLRQZLWKD ULJKWRIDSSHDOWRWKH&LW\&RXQFLO7KHUHYLHZSURFHVVZLOOLQFOXGHUHYLHZRIVLWHSODQVE\LQWHUQDODQG H[WHUQDOGHSDUWPHQWVDQGDJHQFLHVWRHQVXUHFRPSOLDQFHZLWKDOODSSOLFDEOHORFDOVWDWHDQGIHGHUDO VDIHW\ VWDQGDUGV'HYHORSPHQW 3DUFHOV  ZRXOG EH UHTXLUHG WR DGKHUH WR 5+ GHYHORSPHQW VWDQGDUGV DQGWKHEHORZPLWLJDWLRQPHDVXUHV DQGZRXOGEHUHYLHZHGIRUVHLVPLFVDIHW\GXULQJWKH &RXQW\¶V%XLOGLQJ3HUPLWSURFHVV  )RUWKHDERYHUHDVRQVLPSDFWVWRJHRORJ\IURPWKHORVVRIWRSVRLOHURVLRQDQGODQGVOLGHVZRXOGEH OHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLQFRUSRUDWHG  GH /HVVWKDQVLJQLILFDQWLPSDFW$QRQVLWHFRPPXQLW\VHZHUV\VWHP KROGLQJWDQN ZLWKDVHZHU OLQHUDWKHUWKDQDOHDFKILHOGZLOOEHFRQVWUXFWHGIRUGLVFKDUJLQJZDVWHZDWHU HIIOXHQWRQO\ WRDVHZHU PDLQDWWKHHQGRI5HGZRRG$YHQXH7KHVRLOVDWWKH3URMHFW VLWHDUHQRWLGHQWLILHGDVEHLQJH[SDQVLYH DQGFRXOGDGHTXDWHO\VXSSRUWWKHVHZHUV\VWHP,QDGGLWLRQEXLOGLQJFRGH0HQGRFLQR&RXQW\RI (QYLURQPHQWDO+HDOWKDQG3XEOLF:RUNV¶UHTXLUHPHQWVZLOOHQVXUHWKDWWKHVHZHUV\VWHPLVDGHTXDWHO\ LQVWDOOHGLQDFFRUGDQFHZLWKDOOVWDQGDUGVUHODWHGWRVDIHW\,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  I /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG$VGHVFULEHGLQ6HFWLRQ&XOWXUDO 5HVRXUFHVRIWKLV,QLWLDO6WXG\DOWKRXJKQRWDQWLFLSDWHGWKHSRWHQWLDOH[LVWVIRUXQLTXHSDOHRQWRORJLFDO UHVRXUFHVRUVLWHRUXQLTXHJHRORJLFDOIHDWXUHVWREHHQFRXQWHUHGZLWKLQWKH3URMHFWDUHDGXULQJ JURXQGGLVWXUELQJFRQVWUXFWLRQDFWLYLWLHV+RZHYHULQWKHHYHQWWKDWUHVRXUFHVDUHGLVFRYHUHGGXULQJ FRQVWUXFWLRQ0LWLJDWLRQ0HDVXUH&8/UHTXLUHVWKHSURWHFWLRQRIWKHUHVRXUFHV,PSDFWVZRXOGEH OHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLQFRUSRUDWHG  0LWLJDWLRQ0HDVXUHV  ,PSOHPHQWDWLRQRI&8/  *(27KH3URMHFWVKDOOFRPSO\ZLWKWKHHURVLRQDQGGHVLJQVWDQGDUGVRXWOLQHGLQ&KDSWHURIWKH 8NLDK &LW\ &RGH3ULRU WR DQ\ JURXQG GLVWXUEDQFH HURVLRQ DQG VHGLPHQW FRQWURO SODQV VKDOO EH VXEPLWWHGWRWKH3XEOLF:RUNVDQG&RPPXQLW\'HYHORSPHQW'HSDUWPHQWVIRUUHYLHZDQGDSSURYDO 6DLGSODQVVKDOOSURWHFWDJDLQVWVRLOHURVLRQDQGUXQRIIWKURXJKWKHLPSOHPHQWDWLRQRIDSSURSULDWH%HVW 0DQDJHPHQW3UDFWLFHV %03V 7\SLFDO%03VLQFOXGHWKHSODFHPHQWRIVWUDZPXOFKVHHGLQJVWUDZ ZDWWOHVVLOWIHQFLQJHWF1RVLOWVHGLPHQWRURWKHUPDWHULDOVVKDOOEHDOORZHGWRIORZIURPWKHSURMHFW DUHD Page 363 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   *UHHQKRXVH*DV(PLVVLRQV *5((1+286(*$6(0,66,216:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D *HQHUDWH JUHHQKRXVH JDV HPLVVLRQV HLWKHU GLUHFWO\ RU LQGLUHFWO\ WKDW PD\ KDYH D VLJQLILFDQW LPSDFW RQ WKH HQYLURQPHQW"  E &RQIOLFWZLWKDQDSSOLFDEOHSODQSROLF\RUUHJXODWLRQDGRSWHG IRU WKH SXUSRVH RI UHGXFLQJ WKH HPLVVLRQV RI JUHHQKRXVH JDVHV"   6LJQLILFDQFH&ULWHULD7KH3URMHFWZRXOGKDYHDVLJQLILFDQWHIIHFWRQJUHHQKRXVHJDVHPLVVLRQVLILW ZRXOG JHQHUDWH JUHHQKRXVH JDV HPLVVLRQV *+*  HLWKHU GLUHFWO\ RU LQGLUHFWO\ WKDW PD\ KDYH D VLJQLILFDQWLPSDFWRQWKHHQYLURQPHQWRUFRQIOLFWZLWKDQDSSOLFDEOHSODQSROLF\RUUHJXODWLRQDGRSWHG IRUWKHSXUSRVHRIUHGXFLQJWKHHPLVVLRQVRI*+*V  (QYLURQPHQWDO6HWWLQJ&OLPDWHFKDQJHLVFDXVHGE\JUHHQKRXVHJDVHV *+*V HPLWWHGLQWRWKH DWPRVSKHUHDURXQGWKHZRUOGIURPDYDULHW\RIVRXUFHVLQFOXGLQJWKHFRPEXVWLRQRIIXHOIRUHQHUJ\ DQGWUDQVSRUWDWLRQFHPHQWPDQXIDFWXULQJDQGUHIULJHUDQWHPLVVLRQV*+*VDUHWKRVHJDVHVWKDW KDYHWKHDELOLW\WRWUDSKHDWLQWKHDWPRVSKHUHDSURFHVVWKDWLVDQDORJRXVWRWKHZD\DJUHHQKRXVH WUDSVKHDW*+*VPD\EHHPLWWHGDUHVXOWRIKXPDQDFWLYLWLHVDVZHOODVWKURXJKQDWXUDOSURFHVVHV ,QFUHDVLQJ*+*FRQFHQWUDWLRQVLQWKHDWPRVSKHUHDUHOHDGLQJWRJOREDOFOLPDWHFKDQJH  &DUERQGLR[LGH &2  LVWKHPRVWLPSRUWDQWDQWKURSRJHQLF*+*EHFDXVHLWFRPSULVHVWKHPDMRULW\RI WRWDO*+*HPLVVLRQVHPLWWHGSHU\HDUDQGLWLVYHU\ORQJOLYHGLQWKHDWPRVSKHUH7\SLFDOO\ZKHQ HYDOXDWLQJ*+*HPLVVLRQVWKH\DUHH[SUHVVHGDVFDUERQGLR[LGHHTXLYDOHQWVRU&2 HZKLFKLVD PHDQVRIZHLJKWLQJWKHJOREDOZDUPLQJSRWHQWLDO *:3 RIWKHGLIIHUHQWJDVHVUHODWLYHWRWKHJOREDO ZDUPLQJHIIHFWRI&2 ZKLFKKDVD*:3YDOXHRIRQH,QWKH8QLWHG6WDWHV&2 HPLVVLRQVDFFRXQW IRUDERXWSHUFHQWRIWKH&2 HHPLVVLRQVIROORZHGE\PHWKDQHDWDERXWHLJKWSHUFHQWDQGQLWURXV R[LGHDWDERXWILYHSHUFHQW  7KHVWDWHRI&DOLIRUQLDKDVDGRSWHGYDULRXVDGPLQLVWUDWLYHLQLWLDWLYHVDQGOHJLVODWLRQUHODWLQJWRFOLPDWH FKDQJHPXFKRIZKLFKVHWDJJUHVVLYHJRDOVIRU*+*HPLVVLRQVUHGXFWLRQVVWDWHZLGH$OWKRXJKOHDG DJHQFLHVPXVWHYDOXDWHFOLPDWHFKDQJHDQG*+*HPLVVLRQVRISURMHFWVVXEMHFWWR&(4$WKH&(4$ *XLGHOLQHVGRQRWUHTXLUHRUVXJJHVWVSHFLILFPHWKRGRORJLHVIRUSHUIRUPLQJDQDVVHVVPHQWRUVSHFLILF WKUHVKROGVRIVLJQLILFDQFHDQGGRQRWVSHFLI\*+*UHGXFWLRQPLWLJDWLRQPHDVXUHV1RVWDWHDJHQF\ KDVGHYHORSHGELQGLQJUHJXODWLRQVIRUDQDO\]LQJ*+*HPLVVLRQVGHWHUPLQLQJWKHLUVLJQLILFDQFHRU PLWLJDWLQJVLJQLILFDQWHIIHFWVLQ&(4$GRFXPHQWV7KXVOHDGDJHQFLHVH[HUFLVHWKHLUGLVFUHWLRQLQ GHWHUPLQLQJKRZWRDQDO\]H*+*V%HFDXVHWKHUHDUHQRDGRSWHG*+*WKUHVKROGVDSSOLFDEOHWRWKH 3URMHFWDQGWKHSURSRVHGGHYHORSPHQWLVFRQVLGHUHG³VPDOOVFDOH´WKHEHORZTXDOLWDWLYHDQDO\VLVLV DSSURSULDWH  'LVFXVVLRQ DE /HVVWKDQVLJQLILFDQWLPSDFW$FWLYLWLHVDWWKHVLWHZRXOGEHVXEMHFWWRUHJXODWLRQV RI WKH 0HQGRFLQR &RXQW\ $LU 4XDOLW\0DQDJHPHQW 'LVWULFW 0&$40'  ZKLFK LV UHVSRQVLEOH IRU HQIRUFLQJWKHVWDWHDQGIHGHUDO&OHDQ$LU$FWVDVZHOODVORFDODLUTXDOLW\SURWHFWLRQUHJXODWLRQV$V QRWHGLQ&KDSWHU 5HVRXUFH0DQDJHPHQW(OHPHQW RIWKH0HQGRFLQR&RXQW\*HQHUDO3ODQ   EHFDXVH0HQGRFLQR&RXQW\LVSULPDULO\UXUDOWKHDPRXQWRI*+*JHQHUDWHGE\KXPDQDFWLYLWLHV SULPDULO\WKHEXUQLQJRIIRVVLOIXHOVIRUYHKLFOHVKHDWLQJDQGRWKHUXVHV LVVPDOOLQWRWDOFRPSDUHGWR Page 364 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  RWKHUPRUHXUEDQFRXQWLHV DOWKRXJKKLJKHUSHUFDSLWDGXHWRWKHGLVWDQFHVLQYROYHGLQWUDYHOLQJ DURXQGWKHFRXQW\ DQGPLQLVFXOHLQVWDWHZLGHRUJOREDOWHUPV  &RQVWUXFWLRQDFWLYLWLHVDVVRFLDWHGZLWKWKH3URMHFWDQGIXWXUHKRXVLQJGHYHORSPHQWFRXOGUHVXOWLQ GLUHFWDQGLQGLUHFWHPLVVLRQVRI*+*HPLVVLRQV'LUHFW SURMHFWUHODWHG*+*HPLVVLRQVJHQHUDOO\ LQFOXGH HPLVVLRQV IURP FRQVWUXFWLRQ DFWLYLWLHV DUHD VRXUFHV DQG PRELOH VRXUFHV ZKLOH LQGLUHFW VRXUFHVLQFOXGHHPLVVLRQVIURPHOHFWULFLW\FRQVXPSWLRQZDWHUGHPDQGDQGVROLGZDVWHJHQHUDWLRQ 2SHUDWLRQDO *+* HPLVVLRQV ZRXOG UHVXOW IURP HQHUJ\ HPLVVLRQV IURP QDWXUDO JDV XVDJH DQG DXWRPRELOHHPLVVLRQV  $VGLVFXVVHGLQ6HFWLRQ$LU4XDOLW\RIWKLV,QLWLDO6WXG\WKH3URMHFW ERWKFRQVWUXFWLRQDQGRSHUDWLRQ  ZRXOGQRWUHVXOWLQDVLJQLILFDQWQHJDWLYHLPSDFWWRDLUTXDOLW\6LPLODUO\DVGLVFXVVHGLQ6HFWLRQ 7UDQVSRUWDWLRQWKH3URMHFWZRXOGQRWSURGXFHVLJQLILFDQWDPRXQWVRIWUDIILFRUYHKLFOHPLOHVWUDYHOHG WKDWZRXOGLQWXUQUHVXOWLQDVLJQLILFDQWLQFUHDVHLQ*+*HPLVVLRQV,QGLYLGXDOUHVLGHQWLDOGHYHORSPHQW SURMHFWVFRQVWUXFWHGXQGHUWKH'HYHORSPHQW$JUHHPHQWZLOOEHUHYLHZHGRQDSURMHFWE\SURMHFWEDVLV WRDQDO\]H*+*HPLVVLRQVDQGZLOOEHUHTXLUHGWRIROORZDOOEXLOGLQJFRGHVDQGSROLFLHVLQFOXGLQJWKRVH LQWHQGHGWRUHGXFHHPLVVLRQV6SHFLILFDOO\IXWXUHUHVLGHQWLDOXVHVFRQVWUXFWHGRQDOO'HYHORSPHQW 3DUFHOVZRXOGEHUHTXLUHGWRDGKHUHWRDOOIHGHUDOVWDWHDQGORFDOUHTXLUHPHQWVIRUHQHUJ\HIILFLHQF\ LQFOXGLQJWKH7LWOHVWDQGDUGV&RPSOLDQFHZLWK7LWOH%XLOGLQJ(QHUJ\(IILFLHQF\6WDQGDUGVZRXOG SURYLGHPLQLPXPHIILFLHQF\VWDQGDUGVUHODWHGWRYDULRXVEXLOGLQJIHDWXUHVLQFOXGLQJDSSOLDQFHVZDWHU DQG VSDFH KHDWLQJ DQG FRROLQJ HTXLSPHQW EXLOGLQJ LQVXODWLRQ DQG URRILQJ DQG OLJKWLQJ ,PSOHPHQWDWLRQ RI WKH 7LWOH  VWDQGDUGV VLJQLILFDQWO\ UHGXFHV HQHUJ\ XVDJH DV ZHOO DV *+* HPLVVLRQV  /DVWO\WKH3URMHFWLQFOXGHVDQQH[DWLRQDQGFRQVHUYDWLRQRIDSSUR[LPDWHO\DFUHVZKLFKZLOOKDYH QRLPSDFW RUDEHQHILFLDOLPSDFW RQ*+*JLYHQWKDWWKH3URMHFWLVORFDWHGZLWKLQDQRQDWWDLQPHQW DUHDWKHUXUDOQDWXUHRIWKHVLWHDQGVPDOOGHYHORSPHQWIRRWSULQWWKH3URMHFWLQFOXGLQJLQIUDVWUXFWXUH LPSURYHPHQWVDQGRWKHUWHPSRUDU\FRQVWUXFWLRQDFWLYLWLHVLVQRWH[SHFWHGWRVLJQLILFDQWO\LQFUHDVH *+*LQWKHDUHD:LWKLPSOHPHQWDWLRQRIWKHDIRUHPHQWLRQHGUHJXODWLRQVLPSDFWVWR*+*HPLVVLRQV ZRXOGEHOHVVWKDQVLJQLILFDQW  +D]DUGVDQG+D]DUGRXV0DWHULDOV +$=$5'6 $1' +$=$5'286 0$7(5,$/6 :RXOG WKH SURMHFW 3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D &UHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQW WKURXJKWKHURXWLQHWUDQVSRUWXVHRUGLVSRVDORIKD]DUGRXV PDWHULDOV"  E &UHDWHDVLJQLILFDQWKD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQW WKURXJKUHDVRQDEO\IRUHVHHDEOHXSVHWDQGDFFLGHQWFRQGLWLRQV LQYROYLQJ WKH UHOHDVH RI KD]DUGRXV PDWHULDOV LQWR WKH HQYLURQPHQW"  F (PLWKD]DUGRXVHPLVVLRQVRUKDQGOHKD]DUGRXVRUDFXWHO\ KD]DUGRXVPDWHULDOVVXEVWDQFHVRUZDVWHZLWKLQRQHTXDUWHU PLOHRIDQH[LVWLQJRUSURSRVHGVFKRRO"  Page 365 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  +$=$5'6 $1' +$=$5'286 0$7(5,$/6 :RXOG WKH SURMHFW 3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW G %HORFDWHGRQDVLWHZKLFKLVLQFOXGHGRQDOLVWRIKD]DUGRXV PDWHULDOV VLWHV FRPSLOHG SXUVXDQW WR *RYHUQPHQW &RGH 6HFWLRQDQGDVDUHVXOWZRXOGLWFUHDWHDVLJQLILFDQW KD]DUGWRWKHSXEOLFRUWKHHQYLURQPHQW"  H )RUDSURMHFWORFDWHGZLWKLQDQDLUSRUWODQGXVHSODQRU ZKHUHVXFKDSODQKDVQRWEHHQDGRSWHGZLWKLQWZRPLOHVRI DSXEOLFDLUSRUWRUSXEOLFXVHDLUSRUWZRXOGWKHSURMHFWUHVXOWLQ D VDIHW\ KD]DUG RU H[FHVVLYH QRLVHIRU SHRSOH UHVLGLQJ RU ZRUNLQJLQWKHSURMHFWDUHD"  I  ,PSDLU LPSOHPHQWDWLRQ RI RU SK\VLFDOO\ LQWHUIHUH ZLWK DQ DGRSWHGHPHUJHQF\UHVSRQVHSODQRUHPHUJHQF\HYDFXDWLRQ SODQ"  J ([SRVHSHRSOHRUVWUXFWXUHVHLWKHUGLUHFWO\RULQGLUHFWO\WR D VLJQLILFDQW ULVN RI ORVV LQMXU\ RU GHDWK LQYROYLQJ ZLOGODQG ILUHV"   6LJQLILFDQFH&ULWHULD7KH3URMHFWZRXOGUHVXOWLQVLJQLILFDQWKD]DUGVRUKD]DUGRXVPDWHULDOVLPSDFWV LILWH[SRVHGSHRSOHWRKD]DUGRXVPDWHULDOVRUSODFHGWKHPLQWRKD]DUGRXVVLWXDWLRQVLILWUHOHDVHG KD]DUGRXVPDWHULDOVRUHPLVVLRQVLQWRWKHHQYLURQPHQWRUZLWKLQPLOHVRIDVFKRROLILWLVORFDWHG RQDOLVWHGKD]DUGRXVPDWHULDOVVLWHLILWZRXOGFUHDWHDKD]DUGGXHWRLWVSUR[LPLW\WRDSXEOLFDLUSRUW RUSULYDWHDLUVWULSLILWZRXOGFUHDWHH[FHVVLYHQRLVHIRUSHRSOHLQWKHDUHDLILWZRXOGLQWHUIHUHZLWKDQ HPHUJHQF\UHVSRQVHRUHYDFXDWLRQSODQRULILWZRXOGH[SRVHSHRSOHRUVWUXFWXUHVWRVLJQLILFDQWULVNV GXHWRZLOGODQGILUH (QYLURQPHQWDO 6HWWLQJ0HQGRFLQR &RXQW\ KDV DGRSWHG QXPHURXV SODQV UHODWHG WR KD]DUG PDQDJHPHQW DQG PLWLJDWLRQ LQFOXGLQJ EXW QRW OLPLWHG WR &RPPXQLW\ :LOGILUH 3URWHFWLRQ 3ODQ +D]DUGRXV:DVWH0DQDJHPHQW3ODQ2SHUDWLRQDO$UHD(PHUJHQF\3ODQHWF7KHPRVWUHFHQWSODQ WKH 0HQGRFLQR &RXQW\ 0XOWL-XULVGLFWLRQDO +D]DUG 0LWLJDWLRQ 3ODQ 0-+03  ZDV DGRSWHG E\ WKH &RXQW\LQ'HFHPEHU7KH0-+03SURYLGHVDQH[SODQDWLRQRISUHYDOHQWKD]DUGVZLWKLQWKH &RXQW\LGHQWLILHVULVNVWRYXOQHUDEOHDVVHWVERWKSHRSOHDQGSURSHUW\DQGSURYLGHVDPLWLJDWLRQ VWUDWHJ\WRDFKLHYHWKHJUHDWHVWULVNUHGXFWLRQEDVHGXSRQDYDLODEOHUHVRXUFHV7KHIRXUFLWLHVZLWKLQ 0HQGRFLQR&RXQW\LQFOXGLQJWKH&LW\RI8NLDKSDUWLFLSDWHGLQSUHSDUDWLRQRIWKH0-+03WRLQGLYLGXDOO\ DVVHVVKD]DUGVH[SORUHKD]DUGYXOQHUDELOLW\GHYHORSPLWLJDWLRQVWUDWHJLHVDQGFUHDWHWKHLURZQSODQ IRUHDFKUHVSHFWLYHFLW\ UHIHUUHGWRDVD³MXULVGLFWLRQDODQQH[´WRWKH0-+03 7KH&LW\RI 8NLDK DGRSWHGLWVMXULVGLFWLRQDODQQH[FKDSWHURIWKH0-+03RQ1RYHPEHU+D]DUGVLGHQWLILHGIRU WKH&LW\LI8NLDKLQFOXGHHDUWKTXDNHVZLOGILUHGDPIDLOXUHIORRGDQGSDQGHPLF7DEOHRIWKH &LW\¶VMXULVGLFWLRQDODQQH[OLVWVHDFKKD]DUGDQGPLWLJDWLRQDFWLRQIRU&LW\RI8NLDK  7KH8NLDK0XQLFLSDO$LUSRUWLVORFDWHGZLWKLQWKH&LW\RI8NLDKMXULVGLFWLRQDOOLPLWV7KH8NLDK0XQLFLSDO $LUSRUW0DVWHU3ODQDQGWKH0HQGRFLQR&RXQW\$LUSRUW&RPSUHKHQVLYH/DQG8VH3ODQ $&/83  KDVEHHQWKHSODQLGHQWLI\LQJDUHDVZLWKSRWHQWLDOKD]DUGVDQGLPSDFWVWRSHUVRQVUHVLGLQJRUZRUNLQJ ZLWKLQWKH$LUSRUW0DVWHU3ODQDUHDIRUWKHODVWVHYHUDOGHFDGHV+RZHYHULQ)HEUXDU\WKH&LW\ RI8NLDKLQFRRUGLQDWLRQZLWKWKH&RXQW\RI0HQGRFLQRDQGWKH0HQGRFLQR&RXQW\$LUSRUW/DQG8VH &RPPLVVLRQ $/8& LQLWLDWHGDSODQQLQJHIIRUWWRSUHSDUHDQXSGDWHGFRPSDWLELOLW\SODQIRUWKH8NLDK 0XQLFLSDO$LUSRUWWLWOHGWKH8NLDK0XQLFLSDO$LUSRUW/DQG8VH&RPSDWLELOLW\3ODQ 8.,$/8&3 7KH Page 366 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  8.,$/8&3ZDVDGRSWHGE\WKH$/8&RQ0D\DQGDGRSWHGE\WKH8NLDK&LW\&RXQFLORQ -XQH  7KHVLWHGRHVQRWLQFOXGHDQ\NQRZQKD]DUGRXVZDVWHVLWHVDVPDSSHGE\WKH6WDWH:DWHU5HVRXUFHV &RQWURO%RDUG 6:5&% RUWKH&DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFHV&RQWURO '76& RQWKH *HR7UDFNHUDQG(QYLUR6WRUGDWDEDVHVUHVSHFWLYHO\QRUDUHWKHUHDQ\OLVWHGVLWHVZLWKLQWKHYLFLQLW\ RIWKHVLWH  $OOODQGVZLWKLQWKH&LW\RI8NLDKDUHZLWKLQWKHMXULVGLFWLRQRIWKH8NLDK9DOOH\)LUH$XWKRULW\1RQHRI WKHODQGVZLWKLQWKH&LW\RI8NLDKDUHORFDWHGZLWKLQD&DOLIRUQLD'HSDUWPHQWRI)RUHVWU\DQG)LUH 3URWHFWLRQ &DO)LUH 6WDWH5HVSRQVLELOLW\$UHD 65$ +RZHYHUWKH&LW\RI8NLDK 8&&† KDV DGRSWHGWKH65$UHJXODWLRQVUHODWLQJWRUHVLGHQWLDOFRQVWUXFWLRQDQGDFFHVVIRUODQGVZLWKLQWKH&LW\ ORFDWHGLQ+LJKRU9HU\+LJKILUHDUHDV&RXQW\ODQGVLPPHGLDWHO\ZHVWRIWKH&LW\ LQFOXGLQJWKH PDMRULW\RIWKH3URMHFWVLWH V DUHORFDWHGZLWKLQWKH65$DQGDUHFODVVLILHGDVKDYLQJD³9HU\+LJK´ ILUHKD]DUGVHYHULW\  'LVFXVVLRQ DE /HVV WKDQ VLJQLILFDQWLPSDFWZLWK PLWLJDWLRQ LQFRUSRUDWHG&RQVWUXFWLRQ DFWLYLWLHVDQGIXWXUHUHVLGHQWLDOXVHVDVVRFLDWHGZLWKWKH3URMHFWZRXOGUHTXLUHWKHURXWLQHWUDQVSRUW XVHVWRUDJHDQGGLVSRVDORIVPDOOTXDQWLWLHVRIKD]DUGRXVPDWHULDOVFRPPRQIRUHTXLSPHQWDQG SURSHUW\PDLQWHQDQFHDQGRSHUDWLRQVXFKDVJDVROLQHGLHVHOIXHOK\GUDXOLFIOXLGVRLOVOXEULFDQWV FOHDQLQJVROYHQWVDQGVXSSOLHVSHVWLFLGHVIHUWLOL]HUVSDLQWHWF+RZHYHUWKHW\SHVDQGTXDQWLWLHVRI PDWHULDOVWREHXVHGDUHQRWH[SHFWHGWRSRVHDVLJQLILFDQWULVNWRWKHSXEOLFDQGRUHQYLURQPHQWDQG ZRXOGEHPDQDJHGLQDFFRUGDQFHZLWKIHGHUDOVWDWHDQGORFDOUHJXODWLRQV,QDGGLWLRQ0LWLJDWLRQ 0HDVXUH+$=ZRXOGHQVXUHWKDWPDWHULDOVZRXOGEHWUDQVSRUWHGDQGVWRUHGLQDPDQQHUWRUHGXFH SRWHQWLDOLPSDFWVWROHVVWKDQVLJQLILFDQW,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQ LQFRUSRUDWHG  F /HVVWKDQVLJQLILFDQWLPSDFW1RNRPLV(OHPHQWDU\6FKRROLVDSSUR[LPDWHO\PLOHIURPWKH DFFHVV SRLQW  5HGZRRG $YHQXH  IRU WKH3URMHFW+RZHYHU FRQVWUXFWLRQ DFWLYLWLHV ZRXOG EH UHTXLUHG WR WUDQVSRUW DQG XVHURXWLQHKD]DUGRXV PDWHULDOV LQ DFFRUGDQFH ZLWK DOO DSSOLFDEOH UHJXODWLRQV$GKHUHQFHWRWKHVHUHJXODWLRQVZRXOGHQVXUHWKDWLPSDFWVWRWKHHOHPHQWDU\VFKRRODUH OHVVWKDQVLJQLILFDQW  G 1RLPSDFW$VSUHYLRXVO\QRWHGXQGHU*RYHUQPHQW&RGH6HFWLRQERWKWKH6WDWH:DWHU 5HVRXUFHV&RQWURO%RDUGDQGWKH&DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFHV&RQWURODUHUHTXLUHGWR PDLQWDLQGDWDEDVHVRIVLWHVNQRZQWRKDYHKD]DUGRXVVXEVWDQFHVSUHVHQWLQWKHHQYLURQPHQW%RWK DJHQFLHVPDLQWDLQ VXFK GDWDEDVHV RQ WKHLU ZHEVLWHV NQRZQ DV *HR7UDFNHU DQG (QYLUR6WRU $FFRUGLQJWRWKHVHGDWDEDVHVWKH3URMHFWVLWH V GRQRWFRQWDLQDQ\OLVWHGKD]DUGRXVVLWHVQRLPSDFW ZRXOGRFFXU  H /HVVWKDQVLJQLILFDQWLPSDFW8QGHUWKHQHZ8.,$/8&3WKH3URMHFWLVORFDWHGZLWKLQWKH2WKHU $LUSRUW(QYLURQV 2$( &RPSDWLELOLW\=RQH:LWKLQWKLVDLUSRUWLQIOXHQFHGDUHDQROLPLWVDUHSUHVFULEHG ZLWKUHJDUGWRLQWHQVLW\RIXVHGHQVLW\RIGZHOOLQJXQLWVQRUDUHWKHUHDQ\RSHQODQGUHTXLUHPHQWV VSHFLILFWRDLUSRUWVDIHW\FRQVLGHUDWLRQV1RLVHDQGRYHUIOLJKWIDFWRUVDUHFRQVLGHUHGPLQLPDOEXWWKHUH PD\EHRFFDVLRQDORYHUIOLJKWVZKLFKPD\EHLQWUXVLYHWRVRPHRXWGRRUDFWLYLWLHV,QJHQHUDOWKHULVN OHYHOIRUWKLV]RQHLVORZDQGQRVSHFLILFVDIHW\RUDLUVSDFHSURWHFWLRQIDFWRUVDUHLGHQWLILHG  $FFRUGLQJWR7DEOH$RIWKH8.,$/8&3PRVWODQGXVHFDWHJRULHVZRXOGEHFRQVLGHUHGQRUPDOO\ FRPSDWLEOH:KHQXVHVDUHLGHQWLILHGDVFRQGLWLRQDOO\FRPSDWLEOHIRUWKH2$(FRQFHUQVDUHW\SLFDOO\ Page 367 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  DVVRFLDWHGZLWKSRWHQWLDOIOLJKWKD]DUGVVXFKDVODQGXVHVWKDWPD\DWWUDFWELUGVJHQHUDWHGXVW SURGXFH VPRNH RU VWHDP SOXPHV FUHDWH HOHFWURQLF LQWHUIHUHQFH RU RWKHUZLVH EH FRQVLGHUHG KD]DUGRXV7KHSURMHFWDUHDLVORFDWHGZLWKLQDQ$LUVSDFH+LJK7HUUDLQ=RQHZKLFKZRXOGUHTXLUHWKDW DQ\SURSRVHGVWUXFWXUHVRUREMHFWVKDYLQJDKHLJKWRIPRUHWKDQIHHWEHUHIHUUHGWRWKH$/8&IRU UHYLHZ  3HUVHFWLRQRIWKH8.,$/8&3KRZHYHUUHIHUUDORIWKHSURSRVHGSUH]RQLQJDVVRFLDWHGZLWK DQQH[DWLRQ GRHV QRW UHTXLUH UHYLHZ RI WKH $/8& DV RQO\ ODQG XVH DFWLRQV RFFXUULQJ ZLWKLQ &RPSDWLELOLW\ =RQHV  UHTXLUH UHYLHZ SJ   $V GHVFULEHG WKH SURSRVHG SURMHFW ZRXOG QRW HQJHQGHUDLUSRUWVDIHW\FRQFHUQVXQGHUWKH8.,$/8&3DQGDUHYLHZRIDVVRFLDWHGUHVLGHQWLDOXVHV DUHLQGLFDWHGDVµ1RUPDOO\&RPSDWLEOH¶  %DVHGRQWKLVLQIRUPDWLRQWKH3URMHFWZRXOGQRWUHVXOWLQDVDIHW\KD]DUGRUH[FHVVLYHQRLVHIRUSHRSOH UHVLGLQJRUZRUNLQJLQWKH3URMHFWDUHD,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  I /HVVWKDQVLJQLILFDQWLPSDFW7KHUHDUHQRFRPSRQHQWVRIWKH3URMHFWWKDWZRXOGLPSDLURU LQWHUIHUHZLWKHPHUJHQF\UHVSRQVHRUHYDFXDWLRQ6LQFHWKH3URMHFWVSHFLILFDOO\DFFHVVLPSURYHPHQWV DQGUHVLGHQWLDOGHYHORSPHQWZRXOGEHUHTXLUHGWREHGHVLJQHGLQDFFRUGDQFHZLWKVWDWHDQGORFDO VWDQGDUGVLQFOXGLQJVDIHW\DQGHPHUJHQF\DFFHVVUHTXLUHPHQWVWKHUHDUHQRFRPSRQHQWVRIWKH 3URMHFWWKDWZRXOGLPSDLULPSOHPHQWDWLRQRIRUSK\VLFDOO\LQWHUIHUHZLWKWKHDGRSWHG0-+03RURWKHU HPHUJHQF\UHVSRQVHSODQRUHYDFXDWLRQSODQ,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  J /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG$VSUHYLRXVO\QRWHGQRQHRIWKH ODQGVZLWKLQWKH&LW\RI8NLDKDUHORFDWHGZLWKLQD&DOLIRUQLD'HSDUWPHQWRI)RUHVWU\ &DO)LUH 6WDWH 5HVSRQVLELOLW\$UHD 65$ +RZHYHU&RXQW\ODQGVLPPHGLDWHO\ZHVWRIWKH&LW\ LQFOXGLQJWKHPDMRULW\ RIWKH3URMHFWVLWH V DUHORFDWHGZLWKLQWKH65$DQGDUHFODVVLILHGDVKDYLQJD³9HU\+LJK´ILUHKD]DUG VHYHULW\7KH3URMHFWVLWHLVGHYHORSHGZLWK&DO)LUHIXHOEUHDNVDQGKDVEHHQVXEMHFWWRYHJHWDWLRQ PDQDJHPHQW SUDFWLFHV LQ RUGHU WR UHGXFH ILUH ULVN LQ WKH:HVWHUQ +LOOV $GGLWLRQDOO\ WKH3URMHFW LQFOXGHVLQVWDOODWLRQRIDQDSSUR[LPDWHO\JDOORQZDWHUWDQNWRDGGQHZZDWHUVWRUDJHDQGILUH SURWHFWLRQIDFLOLWLHVLQWKH:HVWHUQ+LOOV7KHDFFHVVURDGDQGIXWXUHUHVLGHQWLDOGHYHORSPHQWDUH UHTXLUHG WR DGKHUH WR DOO ILUH VDIHW\ VWDQGDUGV 5HJDUGOHVV RI WKH DIRUHPHQWLRQHG FRQVWUXFWLRQ DFWLYLWLHVLQYROYLQJWKHXVHRIJDVROLQHSRZHUHGWRROVDQGHTXLSPHQWFRXOGLQWURGXFHQHZWHPSRUDU\ VRXUFHVRILJQLWLRQWKDWFRXOGLQFUHDVHILUHULVN+RZHYHUZLWKLPSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUH +$=LPSDFWVZRXOGEHUHGXFHGWROHVVWKDQVLJQLILFDQW)RUWKHUHDVRQVVWDWHGWKH3URMHFWZRXOG QRWH[SRVHSHRSOHRUVWUXFWXUHVWRDVLJQLILFDQWULVNRIORVVLQMXU\RUGHDWKLQYROYLQJZLOGODQGILUHV6HH 6HFWLRQ:LOGILUHIRUPRUHLQIRUPDWLRQ,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQ LQFRUSRUDWHG  0LWLJDWLRQ0HDVXUHV  +$=7KHGHYHORSHUVKDOOHVWDEOLVKDQGLPSOHPHQWFRQVWUXFWLRQVLWHPDQDJHPHQWSUDFWLFHVWKDW ZLOOSUHYHQWWR[LFPDWHULDOVDQGRWKHUGHEULVIURPHQWHULQJWKH&LW\¶VVWRUPGUDLQDJHDQGZDWHUZD\ V\VWHPVLQFOXGLQJ D7KHUHVKDOOEHQRVWRUDJHRIKD]DUGRXVPDWHULDOVDWWKH3URMHFW6LWH E7KHGHYHORSHUVKDOOSURYLGHDGHTXDWHPDWHULDOVPDQDJHPHQWLQFOXGLQJFRYHULQJVHFXULQJ DQGVHJUHJDWLQJSRWHQWLDOO\WR[LFPDWHULDOV JUHDVHRLOVIXHOVROYHQWVHWF DQG F7KHGHYHORSHUVKDOOPDLQWDLQVXSSOLHVRQKDQGWRFRQWDLQVSLOOVRIRLODQGDQ\RWKHUKD]DUGRXV PDWHULDOVXVHGRQVLWH  Page 368 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  F)XHOWKHHTXLSPHQWLQDVDIHSODFHZKHUHVSLOOVFDQEHFRQWDLQHGDQGDILUHH[WLQJXLVKHULV QHDUE\8VHWKHUHFRPPHQGHGJDVRLOPL[WXUHDQGGRQRWWRSRII8VHDIXQQHORUVSRXWIRU SRXULQJ:LSHRIIDQ\VSLOOV G'RQRWUHIXHOUXQQLQJRUKRWHTXLSPHQW'LVSHQVHIXHODWOHDVWIHHWIURPVRXUFHVRILJQLWLRQ H'RQRWXVHHTXLSPHQWLQDUHDVRIGU\YHJHWDWLRQ.HHSOHDYHVDQGGU\PDWHULDOVDZD\IURPD KRWPXIIOHU I1RVPRNLQJRURSHQIODPHDOORZHGQHDUJDVROLQHSRZHUHGHTXLSPHQW   +\GURORJ\DQG:DWHU4XDOLW\ +<'52/2*<$1':$7(548$/,7<:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D  9LRODWH DQ\ ZDWHU TXDOLW\ VWDQGDUGV RU ZDVWH GLVFKDUJH UHTXLUHPHQWV RU RWKHUZLVH VXEVWDQWLDOO\ GHJUDGH VXUIDFH RU JURXQGZDWHUTXDOLW\"  E 6XEVWDQWLDOO\GHFUHDVHJURXQGZDWHUVXSSOLHVRULQWHUIHUH VXEVWDQWLDOO\ZLWKJURXQGZDWHUUHFKDUJHVXFKWKDWWKHSURMHFW PD\ LPSHGH VXVWDLQDEOH JURXQGZDWHU PDQDJHPHQW RI WKH EDVLQ"  F 6XEVWDQWLDOO\DOWHUWKHH[LVWLQJGUDLQDJHSDWWHUQRIWKHVLWH RUDUHDLQFOXGLQJWKURXJKWKHDOWHUDWLRQRIWKHFRXUVHRID VWUHDPRUULYHURUWKURXJKWKHDGGLWLRQRILPSHUYLRXVVXUIDFHV LQDPDQQHUZKLFKZRXOG  L UHVXOWLQDVXEVWDQWLDOHURVLRQRUVLOWDWLRQRQRURIIVLWH LL VXEVWDQWLDOO\LQFUHDVHWKHUDWHRUDPRXQWRIVXUIDFHUXQRIILQ DPDQQHUZKLFKZRXOGUHVXOWLQIORRGLQJRQRURIIVLWH LLL FUHDWHRUFRQWULEXWHUXQRIIZDWHUZKLFKZRXOGH[FHHGWKH FDSDFLW\RIH[LVWLQJRUSODQQHGVWRUPZDWHUGUDLQDJHV\VWHPV RUSURYLGHVXEVWDQWLDODGGLWLRQDOVRXUFHVRISROOXWHGUXQRIIRU  G ,QIORRGKD]DUGWVXQDPLRUVHLFKH]RQHVULVNUHOHDVHRI SROOXWDQWVGXHWRSURMHFWLQXQGDWLRQ" H &RQIOLFWZLWKRUREVWUXFWLPSOHPHQWDWLRQRIDZDWHUTXDOLW\ FRQWUROSODQRUVXVWDLQDEOHJURXQGZDWHUPDQDJHPHQWSODQ"  6LJQLILFDQFH&ULWHULD7KH3URMHFWZRXOGVLJQLILFDQWO\LPSDFWK\GURORJ\DQGZDWHUTXDOLW\LILWYLRODWHG ZDWHU TXDOLW\ VWDQGDUGVRU ZDVWH GLVFKDUJH UHTXLUHPHQWV RU VXEVWDQWLDOO\ GHJUDGHG VXUIDFH RU JURXQGZDWHU TXDOLW\ VXEVWDQWLDOO\ GHFUHDVHG JURXQGZDWHU VXSSOLHV RU LPSHGHG VXVWDLQDEOH JURXQGZDWHUPDQDJHPHQWDOWHUHGGUDLQDJHSDWWHUQVLQDPDQQHUWKDWZRXOGFDXVHVXEVWDQWLDORQRU +$=6KRXOG SRUWDEOH JDVROLQHSRZHUHG HTXLSPHQW EH XVHG RQ VLWH WKH IROORZLQJ ILUHVDIH SUHFDXWLRQVVKDOOEHWDNHQ D6SDUNDUUHVWHUVDUHUHTXLUHGRQDOOSRUWDEOHJDVROLQHSRZHUHGHTXLSPHQW E(TXLSPHQWVKDOOEHPDLQWDLQHGLQJRRGZRUNLQJFRQGLWLRQZLWKH[KDXVWV\VWHPVDQGVSDUN DUUHVWHUVLQSURSHUZRUNLQJRUGHUDQGIUHHRIFDUERQEXLOGXS Page 369 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  RIIVLWHHURVLRQSROOXWHGUXQRIIRUH[FHVVLYHUXQRIIWKDWFDXVHGIORRGLQJLPSHGHGRUUHGLUHFWHGIORRG IORZVULVNHGDUHOHDVHRISROOXWDQWVGXHWRLQXQGDWLRQLILQDIORRGKD]DUGWVXQDPLRUVHLFKH]RQHRU FRQIOLFWHGZLWKDZDWHUTXDOLW\SODQRUVXVWDLQDEOHJURXQGZDWHUPDQDJHPHQWSODQ  (QYLURQPHQWDO 6HWWLQJ$YHUDJH UDLQIDOO LQ 8NLDK LV VOLJKWO\ OHVV WKDQ  LQFKHV 0RVW RI WKH SUHFLSLWDWLRQIDOOVGXULQJWKHZLQWHU5DLQIDOOLVRIWHQIURPEULHILQWHQVHVWRUPVZKLFKPRYHLQIURPWKH QRUWKZHVW9LUWXDOO\QRUDLQIDOORFFXUVGXULQJWKHVXPPHUPRQWKV  7KH3URMHFWDUHDLQFOXGHVWKH5XVVLDQ5LYHU+\GURORJLF8QLW8SSHU5XVVLDQ5LYHU+\GURORJLF$UHD 8NLDK+\GURORJLF6XEDUHD7KH5XVVLDQ5LYHULVRQWKH6WDWH:DWHU5HVRXUFHV&RQWURO%RDUG¶V 6:5&%  G OLVWRILPSDLUHGZDWHUERGLHVIRUZDWHUWHPSHUDWXUHDQGVHGLPHQWDWLRQVLOWDWLRQ 6HGLPHQWLPSDLUPHQWVLQWULEXWDULHVOHGWROLVWLQJWKHHQWLUH5XVVLDQ5LYHU:DWHUVKHGIRUVHGLPHQW 6XUIDFHZDWHUVXSSOLHVIRUWKH8NLDK9DOOH\LQFOXGHWKH(HO5LYHUIURPZKLFKZDWHULVGLYHUWHGLQWRWKH 5XVVLDQ5LYHUZDWHUVKHGWKURXJKWKH3RWWHU9DOOH\3URMHFW/DNH0HQGRFLQRDQGWKH5XVVLDQ5LYHU *URXQGZDWHULVGUDZQIURPWKH8NLDK9DOOH\JURXQGZDWHUEDVLQ7KH8NLDK9DOOH\JURXQGZDWHUEDVLQ LVWKHQRUWKHUQPRVWEDVLQLQWKH5XVVLDQ5LYHUZDWHUV\VWHPDQGXQGHUOLHVDQDUHDRIDSSUR[LPDWHO\ VTXDUHPLOHV:DWHUHQWHUVWKHJURXQGZDWHUV\VWHPYLDSHUFRODWLRQRIVXUIDFHZDWHUVDQGWKURXJK WKHVRLO7KHFUHHNVDQGVWUHDPVLQWKH8NLDK9DOOH\SURYLGHGUDLQDJHFKDQQHOVIRUJURXQGZDWHU UHFKDUJHDVZHOODVGRPHVWLFDQGDJULFXOWXUDOZDWHUVXSSO\7KH&LW\RI8NLDK8UEDQ:DWHU 0DQDJHPHQW3ODQ 8:03 ZDVDGRSWHGE\&LW\&RXQFLORQ-XQH7KH8:03FRQVLGHUV VHYHUDO JURZWK VFHQDULRV LQFOXGLQJ DQ DGGLWLRQDO  DQG QHZKRRNXS VFHQDULRV DQG GHWHUPLQHGWKDWWKHUHLVFDSDFLW\WKURXJKWKHSODQQLQJKRUL]RQWRVHUYHWKHVHJURZWKSURMHFWLRQV  7ZRXQQDPHGFUHHNGUDLQDJHVIORZWKURXJKWZRRIWKHSDUFHOVDWWKHERWWRPRIVWHHSFDQ\RQV7KH WHUUDLQLVYHU\UXJJHGDQGVWHHSYHU\IHZDUHDVRIIODWWHUUDLQDUHSUHVHQW7ZRSHUHQQLDOVWUHDPVIORZ DERXWIHHWWRWKHQRUWKDQGVRXWK²*LEVRQ&UHHNDQG'RRODQ&UHHNUHVSHFWLYHO\$VGHVFULEHG LQ6HFWLRQ%LRORJLFDO5HVRXUFHVWKH6WXG\$UHDFRQWDLQVWZR  &ODVV,,ZDWHUFRXUVHVDQGIRXU   &ODVV,,,ZDWHUFRXUVHVWKDWZHUHREVHUYHGDQGPDSSHGRQVLWH7KHFORVHVWZDWHUFRXUVHLVD&ODVV,, ZDWHUFRXUVHORFDWHGRQ$31 H[LVWLQJ3DUFHODQGSURSRVHG3DUFHO RIWKHVWXG\DUHD 7KH3URMHFWVLWHLVQRWORFDWHGZLWKLQDWVXQDPLKD]DUG]RQHQRULVLWORFDWHGZLWKLQDIORRG]RQH  'LVFXVVLRQ DE H /HVVWKDQVLJQLILFDQWLPSDFW)XWXUHGHYHORSPHQWZRXOGDGKHUHWRDOO DSSOLFDEOHZDVWHGLVFKDUJHUHTXLUHPHQWV7KHUHIRUHWKH3URMHFWZRXOGQRWYLRODWHDQ\ZDWHUTXDOLW\ VWDQGDUGV:DWHUXWLOLWLHVZLOOEHGHYHORSHGE\WKHSURSHUW\RZQHURQVLWHWRVXSSRUWWKH'HYHORSPHQW 3DUFHOVDSSUR[LPDWHO\JDOORQVRIVWRUDJHZLOOEHSURYLGHGE\WZRJDOORQWDQNV IW LQGLDPHWHUDQGIWKLJK WKDWZLOOEHSODFHGZLWKLQWKHH[LVWLQJZDWHUWDQNSDGVLWH LGHQWLILHGE\D EOXHGRWRQ)LJXUH $FFRUGLQJWRWKHZDWHUWDQNSODQQLQJVWXG\PHPRUDQGXPSUHSDUHGE\*+' 'HFHPEHU   WKH H[LVWLQJ ZHOOV SURGXFH DSSUR[LPDWHO\ JDOORQV SHU GD\ DQGDUH ORFDWHGDGMDFHQWWRWKHSURSRVHGWDQN$VDUHVXOWWKHGHYHORSHUSURSRVHVWRVXSSO\WKHWDQNVZLWK ZDWHUIURPWKHZHOOVUDWKHUWKDQFRQVWUXFWLQJQHZERRVWHUSXPSVWDWLRQVWRSXPSZDWHUXSWRWKHWDQNV IURPWKH&LW\¶VH[LVWLQJZHOOV7KHUHIRUHWKH3URMHFWZRXOGQRWVXEVWDQWLDOO\GHSOHWHJURXQGZDWHU UHVRXUFHVDQGLPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  FLLLL /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG$VGLVFXVVHGLQ6HFWLRQ %LRORJLFDO5HVRXUFHVWKH6WXG\$UHDFRQWDLQVWZR  &ODVV,,ZDWHUFRXUVHVDQGIRXU  &ODVV,,, ZDWHUFRXUVHV WKDW ZHUH REVHUYHG DQG PDSSHG RQVLWH 7KH 3URMHFW GRHV QRW SURSRVH DQ\ PRGLILFDWLRQVWRH[LVWLQJFXOYHUWVRUZDWHUFRXUVHV+RZHYHUWKHSURMHFWLQFOXGLQJLPSURYHPHQWRIWKH DFFHVV URDG DQG IXWXUH UHVLGHQWLDO FRQVWUXFWLRQ RQ DOO 'HYHORSPHQW 3DUFHOV  ZRXOG UHVXOW LQ LPSHUYLRXVVXUIDFHVWKDWFRXOGUHVXOWLQDQLPSDFWWRZDWHUTXDOLW\+RZHYHUDVQRWHGLQ0LWLJDWLRQ Page 370 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  0HDVXUHV*(2DQG+$=SULRUWRDQ\JURXQGGLVWXUEDQFHHURVLRQDQGVHGLPHQWFRQWUROSODQV VKDOOEHVXEPLWWHGWRWKH3XEOLF:RUNVDQG&RPPXQLW\'HYHORSPHQW'HSDUWPHQWVIRUUHYLHZDQG DSSURYDO DQG VKDOO LQFOXGH %03V WR DGGUHVV VRLO HURVLRQ DQG VWRUPZDWHU UXQRII $GGLWLRQDOO\ FRQVWUXFWLRQ SURMHFWV WKDW ZRXOG GLVWXUE PRUH WKDQ RQH DFUH RI ODQG ZRXOG EH VXEMHFW WR WKH UHTXLUHPHQWVRI*HQHUDO&RQVWUXFWLRQ$FWLYLW\6WRUPZDWHU3HUPLW &RQVWUXFWLRQ*HQHUDO3HUPLW2UGHU ':4DOVRNQRZQDVWKH&*3 ZKLFKUHTXLUHVRSHUDWRUVRIVXFKFRQVWUXFWLRQVLWHVWR LPSOHPHQW VWRUPZDWHU FRQWUROV DQG GHYHORS D 6WRUPZDWHU 3ROOXWLRQ 3UHYHQWLRQ 3ODQ 6:333  LGHQWLI\LQJVSHFLILF%03VWREHLPSOHPHQWHGWRUHGXFHWKHDPRXQWRIVHGLPHQWDQGRWKHUSROOXWDQWV DVVRFLDWHG ZLWK FRQVWUXFWLRQ VLWHV IURP EHLQJ GLVFKDUJHG LQ VWRUPZDWHU UXQRII7KHSURSRVHG 'HYHORSPHQW$JUHHPHQWGRHVQRWLQFOXGHVSHFLILFGHYHORSPHQWGHVLJQVRUSURSRVDOVQRUGRHVLW JUDQWDQ\HQWLWOHPHQWVIRUGHYHORSPHQW)XWXUHKRXVLQJSURMHFWVZLOOEHVXEMHFWWR&RXQW\DQG&LW\¶V GHYHORSPHQW VWDQGDUGV EXLOGLQJ DQG VDIHW\ FRGHV LQFOXGLQJ UHYLHZ RI VWRUPZDWHU PDQDJHPHQW SUDFWLFHVZKHUHDSSOLFDEOH,IIXWXUHZRUNLQRUDGMDFHQWWRDQ\RIWKHRWKHUZDWHUFRXUVHVRUFXOYHUWV DUHSURSRVHGWKH'HYHORSHULVUHTXLUHGWRREWDLQQHFHVVDU\UHJXODWRU\SHUPLWVIRUPWKH&DOLIRUQLD 'HSDUWPHQWRI)LVKDQG:LOGOLIHDQGWKH5HJLRQDO:DWHU4XDOLW\&RQWURO%RDUGDVQHFHVVDU\,PSDFWV DVVRFLDWHG ZLWK HURVLRQ DQG VWURPZDWHU UXQRII ZRXOG EHOHVV WKDQ VLJQLILFDQWZLWK PLWLJDWLRQ LQFRUSRUDWHG  G 1RLPSDFW$VGHVFULEHGDERYHWKH3URMHFWLVQRWORFDWHGZLWKLQDWVXQDPLKD]DUG]RQHQRUD IORRG]RQHDVLGHQWLILHGE\WKH)HGHUDO(PHUJHQF\0DQDJHPHQW$JHQF\1RLPSDFWZRXOGRFFXU  0LWLJDWLRQ0HDVXUHV ,PSOHPHQWDWLRQRI*(2DQG+$=  /DQG8VHDQG3ODQQLQJ /$1'86($1'3/$11,1*:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 3K\VLFDOO\GLYLGHDQHVWDEOLVKHGFRPPXQLW\" E &DXVHDVLJQLILFDQWHQYLURQPHQWDOLPSDFWGXHWRDFRQIOLFW ZLWKDQ\ODQGXVHSODQSROLF\RUUHJXODWLRQDGRSWHGIRUWKH SXUSRVHRIDYRLGLQJRUPLWLJDWLQJDQHQYLURQPHQWDOHIIHFW"   6LJQLILFDQFH &ULWHULD7KH 3URMHFW ZRXOG VLJQLILFDQWO\ LPSDFW ODQG XVH LI LW SK\VLFDOO\ GLYLGHG DQ HVWDEOLVKHGFRPPXQLW\RUFRQIOLFWHGZLWKDODQGXVHSODQSROLF\RUUHJXODWLRQLQWHQGHGWRDYRLGRU PLWLJDWHDQHQYLURQPHQWDOLPSDFWVXFKDVWKHJHQHUDOSODQRU]RQLQJFRGH  (QYLURQPHQWDO6HWWLQJ7KH&LW\RI8NLDKLQFOXGHVDSSUR[LPDWHO\VTXDUHPLOHV,WVHUYHVDVWKH &RXQW\6HDWRI0HQGRFLQR&RXQW\DVZHOODVWKHFRXQW\¶VFRPPHUFLDOKXE3UHGRPLQDQWODQGXVHV LQWKH&LW\LQFOXGHVLQJOHIDPLO\UHVLGHQWLDOPXOWLIDPLO\UHVLGHQWLDODQGFRPPHUFLDOXVHVUDQJLQJIURP ORFDOFRPPHUFLDOWRVHUYLFHFRPPHUFLDODVZHOOPDQXIDFWXULQJLQGXVWULDODQGSXEOLFIDFLOLWLHV7KH &LW\¶VILUVW*HQHUDO3ODQZDVRULJLQDOO\DGRSWHGLQXSGDWHGLQDQGZDVODVWDPHQGHGLQ ZLWKDGRSWLRQRIWKH+RXVLQJ(OHPHQW7KH*HQHUDO3ODQVHUYHVDVDEOXHSULQWIRU IXWXUHGHYHORSPHQWDQGJURZWKRIWKHFRPPXQLW\7KH&LW\LVFXUUHQWO\LQWKHSURFHVVRIFRPSOHWLQJD *HQHUDO3ODQ8SGDWH WKH³*HQHUDO3ODQ´ WKDWZLOOPDSRXWWKHYLVLRQIRUFRPPXQLW\GHYHORSPHQW WKURXJKXQWLOWKHQHZ*HQHUDO3ODQLVDGRSWHGWKH*HQHUDO3ODQ DVDPHQGHGLQ LV Page 371 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  FRQVLGHUHGWKHDSSOLFDEOHSODQ=RQLQJDQGODQGXVHDUHJRYHUQHGE\WKH&LW\¶V=RQLQJ2UGLQDQFHDV RXWOLQHGLQ'LYLVLRQ&KDSWHURIWKH8NLDK&LW\&RGH7KHSXUSRVHRIWKH8NLDK=RQLQJ&RGHLVWR SURPRWHWKHJURZWKRIWKH&LW\LQDQRUGHUO\PDQQHUDQGWRSURPRWHDQGSURWHFWWKHSXEOLFKHDOWK VDIHW\SHDFHFRPIRUWDQGJHQHUDOZHOIDUH+RXVLQJGHYHORSPHQWRIYDU\LQJLQWHQVLW\LVDOORZHGLQDOO ]RQLQJGLVWULFWVRIWKH8NLDK=RQLQJ&RGHZLWKWKHH[FHSWLRQRIWKH0DQXIDFWXULQJDQG,QGXVWULDO=RQLQJ 'LVWULFWV  )XUWKHUZHVW LQFOXGLQJWKH3URMHFWVLWH LVXQGHYHORSHGRSHQVSDFHDQGVWHHSGHQVHO\YHJHWDWHG DUHDVLQWHUVSHUVHGZLWKUXUDOUHVLGHQWLDOORWVZLWKLQ&RXQW\MXULVGLFWLRQ7KH&LW\RI8NLDKLVJRYHUQHG E\WKH&LW\¶V*HQHUDO3ODQ DGRSWHGLQODVWUHYLVHGLQ DQG8NLDK&LW\&RGH 8&& 7KH ODUJHU8NLDK 9DOOH\ LV JRYHUQHG E\ WKH 8NLDK 9DOOH\ $UHD 3ODQ 89$3   ZKLFK LV D FRPSUHKHQVLYHDQGORQJUDQJHLQWHUMXULVGLFWLRQDOSODQQLQJGRFXPHQWWKDWUHSUHVHQWVWKHYLVLRQDQG IRUHVLJKW RI WKH SHRSOHZKR OLYH DQG ZRUN LQWKH 8NLDK 9DOOH\7KLV SODQ JRYHUQV ODQG XVH DQG GHYHORSPHQWRQWKHXQLQFRUSRUDWHGODQGVLQWKH8NLDK9DOOH\  7KHFXUUHQW8NLDK9DOOH\$UHD3ODQODQGXVHGHVLJQDWLRQLV5HPRWH5HVLGHQWLDO$FUH0LQLPXP ³505´ DQGWKHH[LVWLQJ]RQLQJLV8SODQG5HVLGHQWLDODFUHPLQLPXP ³85´ 7KH&RXQW\¶V FXUUHQW 505 FODVVLILFDWLRQ LV LQWHQGHG WR EH DSSOLHG WR ODQGV KDYLQJ FRQVWUDLQWV IRU FRPPHUFLDO DJULFXOWXUHWLPEHUSURGXFWLRQRUJUD]LQJZKLFKDUHZHOOVXLWHGIRUVPDOOVFDOHIDUPLQJDQGORZGHQVLW\ DJULFXOWXUDOUHVLGHQWLDOXVHVE\WKHDEVHQFHRIVXFKOLPLWDWLRQVDVLQDGHTXDWHDFFHVVXQDFFHSWDEOH KD]DUGH[SRVXUHRULQFRPSDWLELOLW\ZLWKDGMRLQLQJUHVRXUFHODQGXVHV7KH505ODQGXVHGHVLJQDWLRQ DOORZVDGHQVLW\RIRQHGZHOOLQJXQLWSHUDFUHV7KH85]RQLQJGLVWULFWLVLQWHQGHGWRFUHDWHDQG HQKDQFHIDUPLQJDQGORZGHQVLW\DJULFXOWXUDOUHVLGHQWLDOXVHV7\SLFDOO\WKH85]RQLQJGLVWULFWZRXOG EHDSSOLHGWRQRQSULPHSURGXFWLRQODQGVZKLFKKDYHFRQVWUDLQWVWRFRPPHUFLDODJULFXOWXUHWLPEHU SURGXFWLRQRUJUD]LQJEXWZKLFKDUHDEVHQWRIVXFKOLPLWDWLRQVDVLQDGHTXDWHDFFHVVXQDFFHSWDEOH KD]DUGH[SRVXUHRULQFRPSDWLELOLW\ZLWKDGMRLQLQJUHVRXUFHODQGV7KH85]RQLQJGLVWULFWDOORZVIRURQH GZHOOLQJXQLWSHUDFUHV,QDGGLWLRQDQ$'8LVSHUPLWWHGRQHDFKSDUFHO%RWKWKHH[LVWLQJ505 ODQGXVHGHVLJQDWLRQDQG85]RQLQJGHVLJQDWLRQDOORZIRURQHGZHOOLQJXQLWSHUDFUHV  'LVFXVVLRQ D /HVVWKDQVLJQLILFDQWLPSDFW3K\VLFDOGLYLVLRQRIDQH[LVWLQJFRPPXQLW\ZRXOG W\SLFDOO\EHDVVRFLDWHGZLWKFRQVWUXFWLRQRIDQHZKLJKZD\UDLOURDGSDUNRURWKHUOLQHDUIHDWXUH7KH 3URMHFWDUHDLVXQGHYHORSHGZLWKWKHH[FHSWLRQRIDQH[LVWLQJDFFHVVURDGILUHEUHDNVDQGSUHYLRXV ODQGLPSURYHPHQWVIRUSRWHQWLDOIXWXUHKRXVLQJGHYHORSPHQW:KLOHWKH3URMHFWZRXOGLPSURYHWKH H[LVWLQJDFFHVVURDGDQGDOORZIRUSRWHQWLDOIXWXUHORZGHQVLW\UHVLGHQWLDOGHYHORSPHQWLWGRHVQRW SURSRVHQHZOLQHDUIHDWXUHVWKDWZRXOGUHVXOWLQWKHGLYLVLRQRIDQHVWDEOLVKHGFRPPXQLW\,PSDFWV ZRXOGEHOHVVWKDQVLJQLILFDQW  E /HVVWKDQVLJQLILFDQWLPSDFW7KH3URMHFWLQFOXGHVDFTXLVLWLRQDQGDQQH[DWLRQRIDSSUR[LPDWHO\ DFUHVLQWRWKH&LW\¶VMXULVGLFWLRQ,QDGGLWLRQWKH1RJXHUD3URSHUWLHV $31V   WRWDOLQJDSSUR[LPDWHO\DFUHVZLOOEHLQFOXGHGLQWKHDQQH[DWLRQSURSRVDOIRUDFFHVVRQO\ 7KH$QQH[DWLRQSDUFHOVZRXOGEHSUH]RQHGLQWRWKH&LW\RI8NLDKSULRUWRDQQH[DWLRQLQDFFRUGDQFH ZLWK8&&6HFWLRQ*RYHUQPHQW&RGH6HFWLRQDQG/$)&RSROLFLHV8QGHUWKHSURYLVLRQV RIWKH*RYHUQPHQW&RGHWKH]RQLQJGLVWULFWDGRSWHGE\WKH&LW\GRHVQRWEHFRPHHIIHFWLYHXQOHVV DQGXQWLOWKHODQGLVDQQH[HGLQWRWKH&LW\2QFHWKHSDUFHOVDUHDQQH[HGLQWRWKH&LW\WKHVLWH V  ZRXOG QRW EH GHYHORSHG XQWLO DQ DSSOLFDQW VXEPLWV D SURMHFW VLWH SODQ IRU GHYHORSPHQW RQ WKH 'HYHORSPHQW3DUFHOV  DQGREWDLQV3ODQQLQJ&RPPLVVLRQDSSURYDORID8VH3HUPLWWRFRQVWUXFW WKHLUKRPH8QWLOWKHSURSHUW\LVDQQH[HGLWLVVXEMHFWWRH[LVWLQJ]RQLQJXQGHU0HQGRFLQR&RXQW\¶V =RQLQJ 2UGLQDQFH+RZHYHU +XOO 3URSHUWLHVLVFKRRVLQJ WR UHWDLQWKHULJKW WR VHOO DQG GHYHORS 'HYHORSPHQW3DUFHOVSULRUWRDQQH[DWLRQ7KH'HYHORSPHQW3DUFHOVDUHORFDWHGZLWKLQWKH&RXQW\ Page 372 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  RI0HQGRFLQR¶VMXULVGLFWLRQZLWKLQWKH8SODQG5HVLGHQWLDODFUHPLQLPXP 85 ]RQLQJGLVWULFW &RQVWUXFWLRQRIWKHVLQJOHIDPLO\KRPHVZLWKLQWKH&RXQW\¶VMXULVGLFWLRQZRXOGEHE\ULJKWDQGQRW UHTXLUHGLVFUHWLRQDU\DSSURYDOHQYLURQPHQWDOUHYLHZQRUWKHGHYHORSPHQWVWDQGDUGVFRQWDLQHGZLWKLQ WKH&LW\¶V5+]RQLQJGLVWULFW+RZHYHU+XOO3URSHUWLHVLVFKRRVLQJWRUHTXLUHWKHVLQJOHIDPLO\KRPHV WREHFRQVWUXFWHGWR5+VWDQGDUGVE\LQFOXGLQJWKHPLQWKH'HFODUDWLRQRI&RYHQDQWV&RQGLWLRQV DQG 5HVWULFWLRQV && 5V  IRU 'HYHORSPHQW 3DUFHOV  ,Q DGGLWLRQ DOWKRXJK QRW UHTXLUHG WKH PLWLJDWLRQPHDVXUHVFRQWDLQHGZLWKLQWKH,601'IRUUHVLGHQWLDOGHYHORSPHQWZLOODOVREHLQFOXGHGLQ WKH&& 5V  7KH&LW\SURSRVHVWRDQQH[DSSUR[LPDWHO\DFUHVWRWDOFROOHFWLYHO\UHIHUUHGWRDVWKH³&RQVHUYDWLRQ 3DUFHOV´IRURSHQVSDFHDQGFRQVHUYDWLRQ$OWKRXJKWKH&LW\GRHVQRWFXUUHQWO\KDYHDVWDQGDORQH 2SHQ 6SDFH ]RQLQJ GHVLJQDWLRQ WKH &LW\¶V H[LVWLQJ 3XEOLF )DFLOLWLHV 3)  ]RQLQJ GHVLJQDWLRQ HQFRPSDVVHVODQGVZLWKLQWKH&LW\WKDWFRQWDLQRSHQVSDFHDQGSDUNVDVZHOODVRWKHUSXEOLFIDFLOLWLHV $FFRUGLQJO\WKH&RQVHUYDWLRQ3DUFHOV LQFOXGLQJDSSUR[LPDWHO\DFUHVORFDWHGRXWVLGHRIWKH62,  DUHSURSRVHGWREHSUH]RQHG3) ZLWKD³3XEOLF´*HQHUDO3ODQODQGXVHGHVLJQDWLRQ ZKLFKVSHFLILFDOO\ LGHQWLILHVSXEOLFRUTXDVLSXEOLFXVHVLQFOXGLQJEXWQRWOLPLWHGWRQDWXUDOUHVRXUFHFRQVHUYDWLRQDUHDV DQGSDUNVDQGUHFUHDWLRQ7KH/DQG8VH(OHPHQWRIWKH&LW\RI8NLDK*HQHUDO3ODQVWDWHVWKDW WKH 3XEOLF 3  ODQG XVH GHVLJQDWLRQ LV LQWHQGHG IRU SXEOLF IDFLOLWLHV DV ZHOO DV RSHQ VSDFH DQG FRQVHUYDWLRQDUHDVDQGPD\EHDSSOLHGWRODQGVZLWKLQWKH&LW\WKH62,UXUDOFRPPXQLWLHV LGHQWLILHG DV &DOSHOOD 7DOPDJH DQG WKH )RUNV  PDVWHU SODQ DUHDV DQG DUHDV ZLWKLQ WKH *HQHUDO 3ODQ¶V 8QLQFRUSRUDWHG3ODQQLQJ$UHD FXUUHQWO\WKHVDPHERXQGDU\DVWKH89$3DQGWKH&LW\¶VDGRSWHG 62, %HFDXVHWKHSDUFHOVLQWHQGHGIRURSHQVSDFH ZLWKLQWKH&LW\¶VFXUUHQW62, DVDSDUWRIWKH 3URSRVHG3URMHFWDUHZLWKLQWKH¶*HQHUDO3ODQ¶V8QLQFRUSRUDWHG3ODQQLQJ$UHDWKHSURSRVHG DQQH[DWLRQDQGSUH]RQLQJRIWKHSDUFHOVWR3) ZLWKD3*HQHUDO3ODQODQGXVHGHVLJQDWLRQ DUH FRQVLVWHQWZLWKWKHLQWHQWDQGODQGXVHVLGHQWLILHGZLWKLQWKH¶*HQHUDO3ODQ,QDGGLWLRQWKH&LW\FDQ XWLOL]HLWVSDUNVRUGLQDQFH 'LYLVLRQ&KDSWHURIWKH8NLDK&LW\&RGH WRSURYLGHUXOHVJRYHUQLQJ &LW\DQGSXEOLFXVHRI3)]RQHGSURSHUW\8QGHU*RYHUQPHQW&RGH6HFWLRQFLW\RZQHGSDUFHOV DUHQRWUHTXLUHGWREHORFDWHGZLWKLQWKH&LW\ V62,3DUFHOVFDQEHORFDWHGDQ\ZKHUHLQWKH&RXQW\ DVORQJDVWKH\DUHOHVVWKDQDFUHVRZQHGE\WKH&LW\DQGXVHGIRUPXQLFLSDOSXUSRVHVDWWKH WLPHRIWKHDQQH[DWLRQDSSOLFDWLRQ%HFDXVHWKHSRUWLRQRIWKH&RQVHUYDWLRQ3DUFHOVSURSRVHGIRU DQQH[DWLRQWRWDOVDSSUR[LPDWHO\DFUHVDQGZLOOEHXQGHUFLW\RZQHUVKLSIRURSHQVSDFHWKLV SRUWLRQRIWKH3URMHFWLVFRQVLVWHQWZLWKWKH*RYHUQPHQW&RGH  $OO'HYHORSPHQW 3DUFHOV WRWDOLQJ DSSUR[LPDWHO\DFUHV ZRXOG EH SUH]RQHG WR 6LQJOH)DPLO\ 5HVLGHQWLDO+LOOVLGH 2YHUOD\ 'LVWULFW 5+  ZLWK D *HQHUDO 3ODQ 'HVLJQDWLRQ RI /RZ 'HQVLW\ 5HVLGHQWLDO /'5 FRQVLVWHQWZLWKDGMDFHQW&LW\]RQLQJDQGGHYHORSPHQWSDWWHUQVLQWKH:HVWHUQ+LOOV 7KHVHSDUFHOVDUHORFDWHGZLWKLQWKH¶*HQHUDO3ODQ¶V8QLQFRUSRUDWHG3ODQQLQJ$UHDDVZHOODVWKH FXUUHQW89$362,ERXQGDU\DQGDUHFRQVLVWHQWZLWKWKHGHQVLW\DQGLQWHQWRIWKH/'5ODQGXVH GHVLJQDWLRQDQG5+]RQLQJ$OWKRXJKWKH1RJXHUD3URSHUWLHVZLOOEHSUH]RQHG5+IRUFRQVLVWHQF\ ZLWKVXUURXQGLQJ]RQLQJDQGODQGXVHVWKH\DUHQRWLQFOXGHGLQWKH'HYHORSPHQW$JUHHPHQWDQGQR GHYHORSPHQWLVSURSRVHGWKHSDUFHOVZLOOFRQWLQXHWREHXVHGIRUDFFHVVRQO\)RUWKHVHUHDVRQV WKHVH SDUFHOV DUH QRW LQFOXGHG DV 'HYHORSPHQW 3DUFHOV DQG KDYH QRW EHHQ LQFOXGHG LQ WKH GHYHORSPHQWDVVXPSWLRQV  7KH±+2YHUOD\'LVWULFWLVLQWHQGHGWRHQFRXUDJHSODQQLQJGHVLJQDQGGHYHORSPHQWZKLOHSUHVHUYLQJ QDWXUDOSK\VLFDOIHDWXUHVDQGPLQLPL]LQJSRWHQWLDOVDIHW\ZDWHUUXQRIIDQGVRLOHURVLRQFRQFHUQV DVVRFLDWHGZLWKWKHQDWXUDOWHUUDLQ7KH&LW\RI8NLDK¶V*HQHUDO3ODQODQGXVHGHVLJQDWLRQRI/RZ 'HQVLW\5HVLGHQWLDO /'5 DOORZVIRUDGHQVLW\RIVL[GZHOOLQJXQLWVSHUDFUH8QGHUWKHVHUHJXODWLRQV WKH DFUHV IRU UHVLGHQWLDOGHYHORSPHQW FRXOG FRQFHLYDEO\ EH GHYHORSHG ZLWK XS WR  XQLWV Page 373 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  +RZHYHUWKHSURSRVHG'HYHORSPHQW$JUHHPHQWZRXOGUHVWULFWGHYHORSPHQWWRRQHVLQJOHIDPLO\ GZHOOLQJSHUSDUFHODQGRQH$'8 H[FHSWIRULQFDVHVZHUHWKHVORSHH[FHHGVSHUFHQWSHUWKH &LW\¶V+LOOVLGH2YHUOD\2UGLQDQFH IRUDWRWDORIXSWRXQLWV5+]RQLQJUHTXLUHVDPLQLPXPORW VL]HRIVI DFUH IRUSDUFHOVZLWKDVORSHXSWRPLQLPXPORWVL]HLQFUHDVHVDVWKH VORSHRIWKHSDUFHOLQFUHDVHVDVRXWOLQHGLQ8&&6HFWLRQHillside Development Standards &RQVLVWHQWZLWKWKHVHVWDQGDUGVWKHUHVXOWLQJSDUFHOFRQILJXUDWLRQSURSRVHVDFUH'HYHORSPHQW 3DUFHOV WKDW ZRXOG EH SUH]RQHG ³5+´ +XOO 3URSHUWLHV UHFHQWO\ UHFRUGHG VHTXHQWLDO /RW /LQH $GMXVWPHQWV WKURXJK WKH &RXQW\¶V PLQLVWHULDO SURFHGXUHV DQG ZLOO VXEPLW VHTXHQWLDO /RW /LQH $GMXVWPHQWVWKURXJKWKH&LW\¶VSURFHGXUHVXSRQDSSURYDORIWKHDQQH[DWLRQDSSOLFDWLRQWRDFKLHYHWKH UHVXOWLQJSURSRVHGSDUFHOFRQILJXUDWLRQIRUWKH'HYHORSPHQW3DUFHOV$FRS\RIWKHILQDOUHFRUGHG/RW /LQH$GMXVWPHQWVGHSLFWHGWKH³SURSRVHGFRQILJXUDWLRQ´VKRZQLQ)LJXUHZLOOEHVXEPLWWHGWRWKH &RPPXQLW\'HYHORSPHQW'HSDUWPHQWSULRUWRVXEPLWWDORID8VH3HUPLWIRUVLQJOHIDPLO\KRXVLQJZLWKLQ 'HYHORSPHQW3DUFHOV5HYLHZRIWKH/RW/LQH$GMXVWPHQWVZLOOEHFRQGXFWHGE\WKH&LW\(QJLQHHU SULRUWRUHFRUGDWLRQRIWKHILQDOPDSVWRHQVXUHWKDWDOOGHYHORSPHQWVWDQGDUGVFRQWDLQHGZLWKLQWKH 5+]RQLQJGLVWULFWDUHPHW)XUWKHUWKURXJKWKH8VH3HUPLWSURFHVV IRU3DUFHOV DQG&& 5  UHJXODWLRQV IRU 3DUFHOV  HDFK SURSRVHG KRPH ZRXOG EH VXEMHFW WR DOO 5+ GHYHORSPHQW UHJXODWLRQV LQFOXGLQJVORSHGHQVLW\VHWEDFNVKHLJKWILUHVDIHW\DQGZDWHUUHTXLUHPHQWVDFFHVV UHTXLUHPHQWVHWF FRQWDLQHGZLWKLQWKH+LOOVLGH2YHUOD\'LVWULFW'HYHORSPHQWZLWKLQWKH+LOOVLGH 2YHUOD\ 'LVWULFW LQFOXGHV VXEPLWWDO RI WKH IROORZLQJ VRLO DQG JHRORJLFDO UHSRUWV VXEVXUIDFH LQYHVWLJDWLRQV JUDGLQJ SODQV YHJHWDWLRQ UHSRUWV JUDGLQJ SODQV K\GURORJ\ UHSRUWV DQG VWUXFWXUH HOHYDWLRQV(DFKKRPHZRXOGUHTXLUHDSSURYDORID%XLOGLQJ3HUPLWZKLFKLQFOXGHVDGGLWLRQDOUHYLHZ DQGDSSURYDOE\&RXQW\DQG&LW\GHSDUWPHQWV  3UH]RQLQJRIWKHSDUFHOVZLOOUHTXLUHD=RQLQJ0DSDQG*HQHUDO3ODQ0DS$PHQGPHQWXSRQDSSURYDO RIWKHDQQH[DWLRQDSSOLFDWLRQ$OWKRXJKWKH&LW\¶V*HQHUDO3ODQDQG&RXQW\¶V89$3GRQRWFRQWDLQ VSHFLILF SROLFLHV UHODWHG WR SUH]RQLQJ WKH\ GR FRQWDLQ JRDOV DQG SROLFLHV WKDW VWULYH IRU RUGHUO\ FOXVWHUHGGHYHORSPHQWVXSSRUWLQJWKH&LW\DQG&RXQW\¶V5+1$DQGFRQVHUYDWLRQRIRSHQVSDFH 7KH&LW\¶V+RXVLQJ(OHPHQWLQFOXGHV*RDO+DQG3ROLF\ZKLFKVHHNWRVXSSRUWIXWXUH KRXVLQJQHHGVWKURXJKDQQH[DWLRQHIIRUWVWKDWOHDGWRRUGHUO\H[SDQVLRQRIJURZWK6LPLODUO\WKH &RXQW\¶V+RXVLQJ(OHPHQWLQFOXGHV3ROLF\DQG$FWLRQVDWKURXJKGWKDWVWULYHWR ZRUNFRRSHUDWLYHO\ZLWKFLWLHVZLWKLQWKH&RXQW\RQUHJLRQDOKRXVLQJVXSSRUWDQQH[DWLRQDSSOLFDWLRQV WRWKH0HQGRFLQR/$)&RIURPLQFRUSRUDWHGFLWLHVIRUDQQH[DWLRQVRIFRQWLJXRXVODQGVHWF&RQVLVWHQW ZLWKWKHVHJRDOVDQGSROLFLHVWKH3URSRVHG3URMHFWZLOODOORZWKH&LW\WRDGHTXDWHO\SUHVHUYHDQG SURWHFWWKHFROOHFWLYH&RQVHUYDWLRQ3DUFHOV DFUHVWRWDO ZKLOHDOORZLQJRUGHUO\DQGFOXVWHUHGORZ GHQVLW\UHVLGHQWLDOGHYHORSPHQWZLWKLQWKH'HYHORSPHQW3DUFHOV DFUHV FRQVLVWHQWZLWKODQGXVH SDWWHUQV ZLWKLQ WKH :HVWHUQ +LOOV$GGLWLRQDOO\ WKH  XQLWV WKDW FRXOG EH GHYHORSHG XQGHU WKH 'HYHORSPHQW$JUHHPHQWZRXOGIXOILODSRUWLRQRIWKHDERYHPRGHUDWHLQFRPHXQLWVRIKRXVLQJUHTXLUHG E\ WKH &LW\¶V 5HJLRQDO +RXVLQJ 1HHGV $OORFDWLRQ 5+1$  IRU WKH  +RXVLQJ (OHPHQW 3ODQQLQJ&\FOH VHH6HFWLRQ3RSXODWLRQDQG+RXVLQJRIWKLV,QLWLDO6WXG\IRUPRUHLQIRUPDWLRQ   )RUWKHUHDVRQVPHQWLRQHGDERYHWKH3URMHFWZRXOGEHFRQVLVWHQWZLWKWKH&LW\¶V*HQHUDO3ODQDQG ]RQLQJFRGHWKH&RXQW\¶V89$3DQG+RXVLQJ(OHPHQWDVZHOODVWKH*RYHUQPHQW&RGHDQG/$)&R SROLFLHVUHODWHGWRDQQH[DWLRQ Page 374 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   0LQHUDO5HVRXUFHV 0,1(5$/5(6285&(6:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 5HVXOWLQWKHORVVRIDYDLODELOLW\RIDNQRZQPLQHUDOUHVRXUFH WKDWZRXOGEHRIYDOXHWRWKHUHJLRQDQGWKHUHVLGHQWVRIWKH VWDWH"  E 5HVXOWLQWKHORVVRIDYDLODELOLW\RIDORFDOO\LPSRUWDQWPLQHUDO UHVRXUFH UHFRYHU\ VLWH GHOLQHDWHG RQ D ORFDO JHQHUDO SODQ VSHFLILFSODQRURWKHUODQGXVHSODQ"   6LJQLILFDQFH&ULWHULD,PSDFWVWRPLQHUDOUHVRXUFHVZRXOGEHFRQVLGHUHGVLJQLILFDQWLIWKHSURSRVHG 3URMHFWZHUHWRUHVXOWLQWKHORVVRIDNQRZQPLQHUDOUHVRXUFHWKDWKDVYDOXHWRWKHUHJLRQDQGVWDWH RULVRWKHUZLVHORFDOO\LPSRUWDQWDVGHVLJQDWHGRQDORFDOODQGXVHSODQ  (QYLURQPHQWDO6HWWLQJ7KHPRVWSUHGRPLQDQWRIWKHPLQHUDOVIRXQGLQ0HQGRFLQR&RXQW\DUH DJJUHJDWHUHVRXUFHPLQHUDOVSULPDULO\VDQGDQGJUDYHOIRXQGDORQJPDQ\ULYHUVDQGVWUHDPV7KH )RUG*UDYHO%DUVDUHORFDWHGLQ8NLDKDORQJWKH5XVVLDQ5LYHU  'LVFXVVLRQ DE 1RLPSDFW7KHUHDUHQRLGHQWLILHGPLQHUDOUHVRXUFHVZLWKLQWKH3URMHFWDUHD1R LPSDFWZRXOGRFFXU  1RLVH 12,6(:RXOGWKHSURMHFWUHVXOWLQ3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R ,PSDFW D *HQHUDWLRQ RI D VXEVWDQWLDO WHPSRUDU\ RU SHUPDQHQWLQFUHDVHLQDPELHQWQRLVHOHYHOVLQWKH YLFLQLW\ RI WKH SURMHFW LQ H[FHVV RI VWDQGDUGV HVWDEOLVKHG LQ WKH ORFDO JHQHUDO SODQ RU QRLVH RUGLQDQFH RU DSSOLFDEOH VWDQGDUGV RI RWKHU DJHQFLHV"  E *HQHUDWLRQRIH[FHVVLYHJURXQGERUQHYLEUDWLRQ RUJURXQGERUQHQRLVHOHYHOV"  F )RU D SURMHFW ORFDWHG ZLWKLQ WKH YLFLQLW\ RI D SULYDWHDLUVWULSRUDQDLUSRUWODQGXVHSODQRUZKHUH VXFKDSODQKDVQRWEHHQDGRSWHGZLWKLQWZRPLOHV RIDSXEOLFDLUSRUWRUSXEOLFXVHDLUSRUWZRXOGWKH SURMHFWH[SRVHSHRSOHUHVLGLQJRUZRUNLQJLQWKH SURMHFWDUHDWRH[FHVVLYHQRLVHOHYHOV   6LJQLILFDQFH&ULWHULD7KH3URMHFWZRXOGKDYHDVLJQLILFDQWLPSDFWLILWWHPSRUDULO\RUSHUPDQHQWO\ H[FHHGHGORFDOQRLVHVWDQGDUGVLQWKHYLFLQLW\RIWKH3URMHFWJHQHUDWHGH[FHVVLYHJURXQGERUQHQRLVH RUYLEUDWLRQRUZRXOGH[SRVHSHRSOHUHVLGLQJRUZRUNLQJLQWKHDUHDWRH[FHVVLYHQRLVHOHYHOVIURP SXEOLFDLUSRUWVRUSULYDWHDLUVWULSV Page 375 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   (QYLURQPHQWDO6HWWLQJ7KH8NLDK&LW\&RGHFRQWDLQVD1RLVH2UGLQDQFH 'LYLVLRQ&KDSWHU $UWLFOH WKDWHVWDEOLVKHVDPELHQWEDVHQRLVHOHYHOVWDQGDUGVWKDWDSSO\WRVSHFLILF]RQLQJGLVWULFWV ZLWKLQ WKH &LW\ RI 8NLDK³$PELHQW QRLVH LVWKH DOOHQFRPSDVVLQJ QRLVH DVVRFLDWHG ZLWK DJLYHQ HQYLURQPHQWEHLQJXVXDOO\DFRPSRVLWHRIVRXQGVIURPPDQ\VRXUFHVQHDUDQGIDU)RUWKHSXUSRVH RIWKH1RLVH2UGLQDQFHDPELHQWQRLVHOHYHOLVWKHOHYHOREWDLQHGZKHQWKHQRLVHOHYHOLVDYHUDJHG RYHUDSHULRGRIILIWHHQ  PLQXWHVZLWKRXWLQFOXVLRQRIQRLVHIURPLVRODWHGLGHQWLILDEOHVRXUFHVDWWKH ORFDWLRQDQGWLPHRIGD\QHDUWKDWDWZKLFKDFRPSDULVRQLVWREHPDGH/DQGXVHVH[FHHGLQJWKHVH VWDQGDUGVIRUORQJSHULRGVRIWLPHDUHFRQVLGHUHGWREHVLJQLILFDQW ,QDGGLWLRQ8&&†Construction of Buildings and ProjectsVWDWHVWKDWLWVKDOOEHXQODZIXOIRUDQ\ SHUVRQZLWKLQDUHVLGHQWLDO]RQHRUZLWKLQDUDGLXVRIILYHKXQGUHGIHHW ¶ WKHUHIURPWRRSHUDWH HTXLSPHQWRUSHUIRUPDQ\RXWVLGHFRQVWUXFWLRQRUUHSDLUZRUNRQEXLOGLQJVVWUXFWXUHVRUSURMHFWVRUWR RSHUDWH DQ\ SLOH GULYHU SRZHU VKRYHO SQHXPDWLF KDPPHU GHUULFN SRZHU KRLVW RU DQ\ RWKHU FRQVWUXFWLRQW\SHGHYLFH EHWZHHQWKHKRXUVRISPRIRQHGD\DQGDPRIWKHQH[WGD\ LQ VXFKDPDQQHUWKDWDUHDVRQDEOHSHUVRQRIQRUPDOVHQVLWLYHQHVVUHVLGLQJLQWKHDUHDLVFDXVHG GLVFRPIRUWRUDQQR\DQFHXQOHVVEHIRUHKDQGDSHUPLWWKHUHIRUKDVEHHQGXO\REWDLQHGIURPWKH'LUHFWRU RI3XEOLFZRUNV Table 2. City of Ukiah Ambient Base Noise Levels =RQLQJ'LVWULFWV7LPH3HULRG1RLVH/HYHO6WDQGDUGV G%$  5DQG5 30$0 3030 $030    530$0 $030   &RPPHUFLDO30$0 $030   ,QGXVWULDO  0DQXIDFWXULQJ $Q\WLPH    Source: Ukiah City Code §6048  'LVFXVVLRQ D /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG&RQVWUXFWLRQDFWLYLWLHV DUHJHQHUDOO\WHPSRUDU\UHVXOWLQJLQSHULRGLFLQFUHDVHVLQWKHDPELHQWQRLVHHQYLURQPHQW+RZHYHU WKHVHSKDVHVRIFRQVWUXFWLRQKDYHWKHSRWHQWLDOWRFUHDWHWKHKLJKHVWOHYHOVRIQRLVH7\SLFDOQRLVH OHYHOVJHQHUDWHGE\FRQVWUXFWLRQHTXLSPHQWDUHVKRZQLQ7DEOH,WVKRXOGEHQRWHGWKDWWKHQRLVH OHYHOVLGHQWLILHGLQWKHWDEOHEHORZDUHPD[LPXPVRXQGOHYHOV /PD[ DWIWIURPWKHVRXUFHZKLFK DUHWKHKLJKHVWLQGLYLGXDOVRXQGRFFXUULQJDWDQLQGLYLGXDOWLPHSHULRG7KHOHYHORIQRLVHYDULHVEDVHG RQYDU\LQJGXUDWLRQVRIFRQVWUXFWLRQHTXLSPHQWLQXVHDQGZLWKGLVWDQFHIURPWKHQRLVHVRXUFH 7\SLFDOO\QRLVHGHFUHDVHVDVGLVWDQFHLQFUHDVHV&RQVWUXFWLRQQRLVHLPSDFWVJHQHUDOO\RFFXUZKHQ FRQVWUXFWLRQDFWLYLWLHVRFFXULQDUHDVLPPHGLDWHO\DGMRLQLQJQRLVHVHQVLWLYHODQGXVHVGXULQJQRLVH VHQVLWLYHWLPHVRIWKHGD\RUZKHQFRQVWUXFWLRQDFWLYLW\RFFXUVDWWKHVDPHSUHFLVHORFDWLRQRYHUDQ H[WHQGHGSHULRGRIWLPH HJSLOHGULYLQJLQRQHORFDWLRQIRUKRXUVLQDGD\RURYHUDGXUDWLRQRI VHYHUDOVXFFHVVLYHGD\V    Page 376 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  Table 3. Maximum Noise Levels Associated with Typical Construction Equipment   7\SHRI(TXLSPHQW/PD[DW)HHW G%$  &RQFUHWH6DZ &UDQH &RQFUHWH0L[HU7UXFN %DFNKRH 'R]HU ([FDYDWRU )RUNOLIW 3DYHU 5ROOHU 7UDFWRU :DWHU7UXFN *UDGHU *HQHUDO,QGXVWULDO(TXLSPHQW Source: Federal Highway Administration. 2006. Roadway Construction Noise Model (FHWA-HEP-   &HUWDLQODQGXVHVDUHSDUWLFXODUO\VHQVLWLYHWRQRLVHLQFOXGLQJVFKRROVKRVSLWDOVUHVWKRPHVORQJ WHUPPHGLFDODQGPHQWDOFDUHIDFLOLWLHVDQGSDUNVDQGUHFUHDWLRQDUHDV5HVLGHQWLDODUHDVDUHDOVR FRQVLGHUHG QRLVH VHQVLWLYH HVSHFLDOO\ GXULQJ WKH QLJKWWLPH KRXUV 7KH QHDUHVWH[LVWLQJ VHQVLWLYH UHFHSWRUVDUHUHVLGHQWLDOXVHVDGMRLQLQJWKH3URMHFWVLWHWRWKHHDVWDQGVRXWKDORQJ5HGZRRG$YHQXH WKHFORVHVWUHVLGHQFHEHLQJPRUHWKDQIWDZD\IURPWKHSRWHQWLDOKRXVHVLWHRQSURSRVHG3DUFHO +RZHYHUFRQVWUXFWLRQUHODWHGQRLVHZRXOGEHFRQVLGHUHGWHPSRUDU\,QDGGLWLRQWRUHGXFHSRWHQWLDO QRLVHLPSDFWVWRQHDUE\VHQVLWLYHUHFHSWRUV0LWLJDWLRQ0HDVXUH12,ZRXOGUHTXLUHFRPSOLDQFHZLWK WKH&LW\¶VDOORZHGKRXUVRIFRQVWUXFWLRQ DPWRSP LQFOXGH%HVW0DQDJHPHQW3UDFWLFHV %03V IRUUHGXFLQJFRQVWUXFWLRQQRLVHDQGUHTXLUHFRQVWUXFWLRQHTXLSPHQWWREHHTXLSSHGZLWK SURSHUO\RSHUDWLQJDQGPDLQWDLQHGPXIIOHUVDQGRWKHUVWDWHUHTXLUHGQRLVHDWWHQXDWLRQGHYLFHV1RLVH LPSDFWV DVVRFLDWHG ZLWK FRQVWUXFWLRQ ZRXOG EHWKH3URMHFWZRXOG EHOHVV WKDQ VLJQLILFDQWZLWK PLWLJDWLRQLQFRUSRUDWHG  2SHUDWLRQRIWKH3URSRVHG3URMHFWZRXOGUHVXOWLQVWDWLRQDU\QRLVHVRXUFHVDVVRFLDWHGZLWKW\SLFDO UHVLGHQWLDOODQGXVHV HJPHFKDQLFDOHTXLSPHQWGRJVSHWVODQGVFDSLQJDFWLYLWLHVFDUVSDUNLQJ HWF 7KHVHQRLVHVRXUFHVDUHW\SLFDOO\LQWHUPLWWHQWDQGVKRUWLQGXUDWLRQDQGZRXOGEHFRPSDUDEOH WRH[LVWLQJVRXUFHVRIQRLVHH[SHULHQFHGDWVXUURXQGLQJUHVLGHQWLDOXVHV$VVXFKLPSDFWVIURP RSHUDWLRQRIWKH3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQW  E /HVVWKDQVLJQLILFDQWLPSDFW3URMHFWFRQVWUXFWLRQFDQJHQHUDWHYDU\LQJGHJUHHVRIJURXQGERUQH YLEUDWLRQGHSHQGLQJRQWKHFRQVWUXFWLRQSURFHGXUHDQGWKHFRQVWUXFWLRQHTXLSPHQWXVHG2SHUDWLRQ RI FRQVWUXFWLRQ HTXLSPHQW JHQHUDWHV YLEUDWLRQV WKDW VSUHDG WKURXJK WKH JURXQG DQG GLPLQLVK LQ DPSOLWXGHZLWKGLVWDQFHIURPWKHVRXUFH7KHUHVXOWVIURPYLEUDWLRQFDQUDQJHIURPQRSHUFHSWLEOH HIIHFWVDWWKHORZHVWYLEUDWLRQOHYHOVWRORZUXPEOLQJVRXQGVDQGSHUFHSWLEOHYLEUDWLRQDWPRGHUDWH OHYHOVWRVOLJKWGDPDJHDWWKHKLJKHVWOHYHOV7KH3URMHFWLVDQWLFLSDWHGWRXVHW\SLFDOFRQVWUXFWLRQ HTXLSPHQWIRUWHPSRUDU\SHULRGVRIWLPHWKDWZRXOGQRWEHFRQVLGHUHGH[FHVVLYH7KHUHIRUHLPSDFWV ZRXOGEHOHVVWKDQVLJQLILFDQW Page 377 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   F /HVVWKDQVLJQLILFDQWLPSDFW7KHQHDUHVWDLUSRUWWRWKH3URMHFWVLWHLVWKH8NLDK0XQLFLSDO$LUSRUW ORFDWHGDSSUR[LPDWHO\PLOHHDVWRIWKH3URMHFWVLWH$VGLVFXVVHGLQ6HFWLRQ H RIWKLV,QLWLDO 6WXG\DSRUWLRQRIWKH3URMHFW DOORISURSRVHG3DUFHODQGDSRUWLRQRISURSRVHG3DUFHOVDQG  DUHORFDWHGZLWKLQWKH³'2WKHU$LUSRUW(QYLURQV´FRPSDWLELOLW\]RQHRIWKH$&/83ZKLFKLVGHVFULEHG DVKDYLQJQHJOLJLEOHULVNZLWKWKHSRWHQWLDOIRUSHULRGLFDQQR\DQFHIURPRYHUKHDGIOLJKWV+RZHYHU VLQJOHIDPLO\KRPHVDUHOLVWHGDVDQRUPDOO\DFFHSWDEOHXVHLQWKLVDLUSRUWFRPSDWLELOLW\]RQH7KH UHPDLQGHURIWKH3URMHFWVLUHLVQRWORFDWHGZLWKLQWKH$&/83%DVHGRQWKLVLQIRUPDWLRQWKH3URMHFW ZRXOGQRWH[SRVHSHRSOHUHVLGLQJRUZRUNLQJLQWKH3URMHFWDUHDWRH[FHVVLYHQRLVHOHYHOVDVVRFLDWHG ZLWKDLUFUDIW,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  0LWLJDWLRQ0HDVXUHV  12,3ULRU WR EXLOGLQJ SHUPLW RU JUDGLQJ SHUPLW LVVXDQFH WKHGHYHORSHUVKDOO FRPSO\ ZLWK WKH IROORZLQJ D&RQVWUXFWLRQFRQWUDFWVVKDOOVSHFLI\WKDWDOOFRQVWUXFWLRQHTXLSPHQWIL[HGRUPRELOHVKDOOEH HTXLSSHG ZLWK SURSHUO\ RSHUDWLQJ DQG PDLQWDLQHG PXIIOHUV DQG RWKHU VWDWHUHTXLUHG QRLVH DWWHQXDWLRQGHYLFHV E&RQVWUXFWLRQKDXOURXWHVVKDOOEHGHVLJQHGWRDYRLGRUOHVVHQLPSDFWVWRQRLVHVHQVLWLYHXVHV HJUHVLGHQFHVVFKRROVFRQYDOHVFHQWKRPHV WRWKHH[WHQWIHDVLEOH F'XULQJFRQVWUXFWLRQVWDWLRQDU\FRQVWUXFWLRQHTXLSPHQWVKDOOEHSODFHGVXFKWKDWHPLWWHGQRLVH LVGLUHFWHGDZD\IURPVHQVLWLYHQRLVHUHFHLYHUV G3HUWKH&LW\¶V1RLVH2UGLQDQFHFRQVWUXFWLRQVKDOOQRWWDNHSODFHRXWVLGHRIWKHKRXUVRI DPWRSP  3RSXODWLRQDQG+RXVLQJ 3238/$7,21$1'+286,1*:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D ,QGXFHVXEVWDQWLDOXQSODQQHGSRSXODWLRQJURZWKLQDQDUHD HLWKHU GLUHFWO\ IRU H[DPSOH E\ SURSRVLQJ QHZ KRPHV DQG EXVLQHVVHV RULQGLUHFWO\ IRUH[DPSOHWKURXJKH[WHQVLRQRI URDGVRURWKHULQIUDVWUXFWXUH "  E 'LVSODFHVXEVWDQWLDOQXPEHUVRIH[LVWLQJSHRSOHRUKRXVLQJ QHFHVVLWDWLQJ WKH FRQVWUXFWLRQ RI UHSODFHPHQW KRXVLQJ HOVHZKHUH"   6LJQLILFDQFH&ULWHULD7KHSURSRVHG3URMHFWZRXOGUHVXOWLQVLJQLILFDQWLPSDFWVWRWKHORFDOSRSXODWLRQ RUKRXVLQJVWRFNLILWGLUHFWO\RULQGLUHFWO\LQGXFHGVXEVWDQWLDOXQSODQQHGSRSXODWLRQJURZWKRUGLVSODFHG DVXEVWDQWLDOQXPEHURISHRSOHRUKRXVLQJVXFKWKDWWKHFRQVWUXFWLRQRIUHSODFHPHQWKRXVLQJZRXOG EHUHTXLUHG  (QYLURQPHQWDO6HWWLQJ7KH&LW\RI8NLDKFRPSULVHVRIDSSUR[LPDWHO\VTXDUHPLOHVZLWKLQ 0HQGRFLQR&RXQW\$FFRUGLQJWRWKH&DOLIRUQLD'HSDUWPHQWRI)LQDQFHWKHSRSXODWLRQLQWKH&RXQW\ RI0HQGRFLQRZDVLQDQGLQWKH&LW\RI8NLDK7KH&LW\¶VDQQXDOJURZWKUDWH EHWZHHQDQGDYHUDJHGDSSUR[LPDWHO\%HWZHHQDQGWKH&LW\DGGHG UHVLGHQWVRUWRLWVSRSXODWLRQ2YHUDOOWKH&LW\RI8NLDK¶VSRSXODWLRQKDVLQFUHDVHGPRGHUDWHO\ Page 378 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  RYHUWKHSDVWQHDUO\\HDUVZLWKDPRUHDFFHOHUDWHGLQFUHDVHLQWKHODVWIRXU\HDUV3URMHFWLRQVIURP WKH &DOLIRUQLD 6WDWH 8QLYHUVLW\ &KLFR &HQWHU IRU (FRQRPLF 'HYHORSPHQW0HQGRFLQR &RXQW\ (FRQRPLF'HPRJUDSKLF3URILOHVKRZWKLVWUHQGFRQWLQXLQJ  $VGHVFULEHGLQWKH&LW\¶V+RXVLQJ(OHPHQW  XQGHU&DOLIRUQLDODZHYHU\FLW\DQG FRXQW\KDVDOHJDOREOLJDWLRQWRUHVSRQGWRLWVIDLUVKDUHRIWKHSURMHFWHGIXWXUHKRXVLQJQHHGVLQWKH UHJLRQLQZKLFKLWLVORFDWHG)RU8NLDKDQGRWKHU0HQGRFLQR&RXQW\MXULVGLFWLRQVWKHUHJLRQDOKRXVLQJ QHHGDOORFDWLRQ 5+1$ LVGHWHUPLQHGE\WKH0HQGRFLQR&RXQFLORI*RYHUQPHQWV 0&2* EDVHG XSRQDQRYHUDOOUHJLRQDOQHHGQXPEHUHVWDEOLVKHGE\WKH6WDWH7KHIDLUVKDUHQXPEHUVHVWDEOLVK JRDOVWRJXLGHORFDOSODQQLQJDQGGHYHORSPHQWGHFLVLRQPDNLQJ0&2*LGHQWLILHGWKH&LW\¶V5+1$DV DFFRPPRGDWLQJDGGLWLRQDOXQLWVZLWKLQWKH3ODQQLQJ&\FOH6SHFLILFDOO\WKH&LW\RI 8NLDKLVUHVSRQVLEOHIRULGHQWLI\LQJDGHTXDWHVLWHVZLWKDSSURSULDWH]RQLQJWRVXSSRUWYHU\ORZ LQFRPHKRXVLQJXQLWVDQGORZLQFRPHKRXVLQJXQLWVIRUDWRWDORIORZHULQFRPHKRXVLQJXQLWV DQGPRGHUDWHLQFRPHDQGDERYHPRGHUDWHLQFRPHKRXVLQJXQLWVIRUDWRWDORIPRGHUDWH DQGDERYHPRGHUDWHKRXVLQJXQLWV  'LVFXVVLRQ D /HVVWKDQVLJQLILFDQWLPSDFW$VSUHYLRXVO\GLVFXVVHGLQWKH3URMHFW'HVFULSWLRQ DQG/DQG8VH6HFWLRQ  RIWKLV,QLWLDO6WXG\WKH3URSRVHG3URMHFWZRXOGDQQH[DSSUR[LPDWHO\ DFUHVLQWRWKH&LW\2QFHDQQH[HGDFUHVFRXOGEHGHYHORSHGZLWKXSWRUHVLGHQWLDOXQLWV VHYHQ VLQJOHIDPLO\KRPHVDQGRQHDVVRFLDWHG$'8SHUORW WKURXJKWKHSURSRVHG'HYHORSPHQW$JUHHPHQW $OWKRXJK QR GHYHORSPHQW LV SURSRVHG DW WKLV WLPHIRU WKLV DQDO\VLVLW LV DVVXPHG WKDWIXWXUH GHYHORSPHQWRIDOO'HYHORSPHQW3DUFHOVZRXOGUHVXOWLQFRQVWUXFWLRQDQGGHYHORSPHQWRIUHVLGHQWLDO XVHVRQWKHVLWH  8QGHUWKH&RXQW\¶V*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHWKHHQWLUHW\RIWKHDFUHVKDVWKHSRWHQWLDO WREHGHYHORSHGZLWKXSWRRQHGZHOOLQJSHUDFUHVIRUDWRWDORISULPDU\GZHOOLQJV,QDGGLWLRQ DQ$'8PD\EHFRQVWUXFWHGDVRIULJKWRQHDFKSDUFHOUHVXOWLQJLQWKHSRWHQWLDOIRUXSWRWRWDOXQLWV WREHGHYHORSHG7KH&LW\RI8NLDK¶V*HQHUDO3ODQODQGXVHGHVLJQDWLRQRI/RZ'HQVLW\5HVLGHQWLDO /'5 DOORZVIRUDGHQVLW\RIVL[GZHOOLQJXQLWVSHUDFUH8QGHUWKHVHUHJXODWLRQVWKHDFUHVIRU UHVLGHQWLDOGHYHORSPHQWFRXOGFRQFHLYDEO\EHGHYHORSHGZLWKXSWRXQLWV+RZHYHUWKHSURSRVHG 'HYHORSPHQW$JUHHPHQWZRXOGUHVWULFWGHYHORSPHQWWRRQHVLQJOHIDPLO\GZHOOLQJSHUSDUFHODQGRQH $'8 H[FHSWLQFDVHVZKHUHWKHVORSHH[FHHGVSHUFHQWSHUWKH&LW\¶V+LOOVLGH2YHUOD\2UGLQDQFH  IRUDWRWDORIXSWRXQLWV$OWKRXJK'HYHORSPHQW3DUFHOVPD\EHGHYHORSHGZLWKLQWKH&RXQW\¶V MXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWWKH\ZLOOEHUHTXLUHGWREHGHYHORSHGWR5+VWDQGDUGV WKURXJK&& 5V$OO'HYHORSPHQW3DUFHOVZRXOGEHSUH]RQHGWR5+ ZLWKD/RZ'HQVLW\5HVLGHQWLDO *HQHUDO3ODQODQGXVHGHVLJQDWLRQ DQGDUHORFDWHGZLWKLQWKH¶*HQHUDO3ODQ¶V8QLQFRUSRUDWHG 3ODQQLQJ$UHDDVZHOODVWKHFXUUHQW89$362,ERXQGDU\7KHSURSRVHG'HYHORSPHQW3DUFHOVDUH FRQVLVWHQWZLWKWKHGHQVLW\DQGLQWHQWRIWKH/'5ODQGXVHGHVLJQDWLRQDQG5+]RQLQJ$GGLWLRQDOO\ WKHXQLWVWKDWFRXOGEHGHYHORSHGXQGHUWKH'HYHORSPHQW$JUHHPHQWZRXOGIXOILODSRUWLRQRIWKH PRGHUDWHWRDERYHPRGHUDWHLQFRPHXQLWVUHTXLUHGE\WKH&LW\¶V5+1$IRUWKH3ODQQLQJ &\FOH  $VDSDUWRIWKH3URMHFWXWLOLWLHVZRXOGEHH[WHQGHGWRWKHDUHD+RZHYHUEHFDXVHWKHH[WHQVLRQRI XWLOLWLHVZRXOGEHOLPLWHGWRWKHVHYHQ'HYHORSPHQW3DUFHOVWKDWDUHFXUUHQWO\]RQHGIRUUXUDOUHVLGHQWLDO GHYHORSPHQWWKH3URMHFW LQFOXGLQJ GHYHORSPHQW RI XS WR  XQLWV ZRXOG QRW GLUHFWO\ LQGXFH VXEVWDQWLDOXQSODQQHGGHYHORSPHQWDQGSRSXODWLRQJURZWKLQWKHDUHD7KHUHPDLQLQJDFUHVWKDW ZRXOGEHSUHVHUYHGDVRSHQVSDFHZRXOGQRWEHGHYHORSHGZLWKUHVLGHQWLDOXVHVWKDWFRXOGUHVXOWLQ DQLQFUHDVHLQSRSXODWLRQ)RUWKHDIRUHPHQWLRQHGUHDVRQVWKH3URSRVHG3URMHFWZRXOGQRWLQGXFH Page 379 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  VXEVWDQWLDOXQSODQQHGSRSXODWLRQJURZWKLQDQDUHDHLWKHUGLUHFWO\RULQGLUHFWO\,PSDFWVZRXOGEHOHVV WKDQVLJQLILFDQW  E /HVVWKDQVLJQLILFDQWLPSDFW7KH3URMHFWVLWHLVYDFDQWDQGGRHVQRWLQFOXGHDQ\KRXVLQJWKDW ZRXOGEHGLVSODFHGDVDUHVXOWRIWKH3URMHFW,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW   3XEOLF6HUYLFHV 38%/,&6(59,&(6:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 5HVXOWLQVXEVWDQWLDODGYHUVHSK\VLFDOLPSDFWVDVVRFLDWHG ZLWKWKHSURYLVLRQRIQHZRUSK\VLFDOO\DOWHUHGJRYHUQPHQWDO IDFLOLWLHV QHHG IRU QHZ RU SK\VLFDOO\ DOWHUHG JRYHUQPHQWDO IDFLOLWLHV WKH FRQVWUXFWLRQ RI ZKLFK FRXOG FDXVH VLJQLILFDQW HQYLURQPHQWDOLPSDFWVLQRUGHUWRPDLQWDLQDFFHSWDEOHVHUYLFH UDWLRVUHVSRQVHWLPHVRURWKHUSHUIRUPDQFHREMHFWLYHVIRUDQ\ RIWKHSXEOLFVHUYLFHV  )LUHSURWHFWLRQ" 3ROLFHSURWHFWLRQ" 6FKRROV" 3DUNV" 2WKHUSXEOLFIDFLOLWLHV"  6LJQLILFDQFH&ULWHULD7KH3URMHFWZRXOGUHVXOWLQDVLJQLILFDQWLPSDFWWRSXEOLFVHUYLFHVLILWUHVXOWHG LQDUHTXLUHPHQWIRULQFUHDVHGRUH[SDQGHGSXEOLFVHUYLFHIDFLOLWLHVRUVWDIILQJLQFOXGLQJILUHRUSROLFH SURWHFWLRQVFKRROVDQGSDUNV  (QYLURQPHQWDO6HWWLQJ3ROLFHSURWHFWLRQVHUYLFHVIRUWKHHQWLUH&LW\OLPLWVLVSURYLGHGE\WKH8NLDK 3ROLFH'HSDUWPHQWZKLOHWKH0HQGRFLQR&RXQW\6KHUULII¶V'HSDUWPHQWSURYLGHVSROLFHVHUYLFHVIRU DUHDVRXWVLGHRIWKH&LW\OLPLWV)LUHSURWHFWLRQVHUYLFHVLQWKH8NLDK9DOOH\DUHSURYLGHGE\WKH8NLDK 9DOOH\)LUH$XWKRULW\DQG&DOLIRUQLD'HSDUWPHQWRI)RUHVWU\DQG)LUH3URWHFWLRQ &DO)LUH (GXFDWLRQDO IDFLOLWLHVLQWKH8NLDK9DOOH\DUHDDUHSURYLGHGE\WKH8NLDK8QLILHG6FKRRO'LVWULFW 886' &RXQW\ 2IILFHRI(GXFDWLRQDQGWKH0HQGRFLQR/DNH&RPPXQLW\&ROOHJH'LVWULFW7KHUHDUHDOVRVHYHUDO SULYDWHDQGFKDUWHUVFKRROVVHUYLQJUHVLGHQWVZLWKLQWKH&LW\RI8NLDKDVZHOODVWKHXQLQFRUSRUDWHG SRUWLRQVRI0HQGRFLQR&RXQW\$VPHQWLRQHGEHORZLQ6HFWLRQ5HFUHDWLRQRIWKLV,QLWLDO6WXG\ WKHUHDUH&LW\SDUNVDPXQLFLSDOJROIFRXUVHDQGDVNDWHSDUNPDQDJHGE\WKH&LW\RI8NLDKDV ZHOODVRWKHUUHFUHDWLRQDOIDFLOLWLHVLQWKHDUHD  'LVFXVVLRQ D /HVVWKDQVLJQLILFDQWLPSDFW$OWKRXJKQRGHYHORSPHQWLVSURSRVHGDWWKLVWLPHLW LVDVVXPHGWKDWIXWXUHGHYHORSPHQWZRXOGUHVXOWLQFRQVWUXFWLRQDQGGHYHORSPHQWRIUHVLGHQWLDOXVHV XSWRXQLWV RQWKHVLWH1HZKRPHVLQWKH&LW\¶VMXULVGLFWLRQZRXOGEHVHUYHGE\WKH&LW\¶V3ROLFH 'HSDUWPHQWDQGWKH8NLDK9DOOH\)LUHDXWKRULW\7KLVPLQLPDOLQFUHDVHLQVHUYLFHDUHDZRXOGQRWEH Page 380 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  FRQVLGHUHGVLJQLILFDQWDVILUHDQGSROLFHLPSDFWIHHVDUHFROOHFWHGIRUQHZFRQVWUXFWLRQWRRIIVHWWKH ILQDQFLDOEXUGHQWKDWQHZGHYHORSPHQWFDQSRWHQWLDOO\FUHDWHIRUWKHILUHGHSDUWPHQW  6LPLODUO\LWLVQRWDQWLFLSDWHGWKDWWKHDGGLWLRQDOUHVLGHQWLDOXQLWVFXUUHQWO\DOUHDG\EHLQJVHUYHGE\ H[LVWLQJVFKRROGLVWULFWVZRXOGUHVXOWLQDVLJQLILFDQWLPSDFWWRVFKRROVHUYLFHV  /DVWO\ DV GLVFXVVHG LQ 6HFWLRQ  5HFUHDWLRQ WKH LQFUHDVH LQ UHVLGHQWLDO XQLWV ZRXOG QRW EH FRQVLGHUHGVLJQLILFDQWDQGIXWXUHGHYHORSPHQWZRXOGEHUHTXLUHGWRSD\SDUNLPSDFWIHHVZKLFKDUH XVHGWRDVVLVWLQWKHGHYHORSPHQWDQGPDLQWHQDQFHRISDUNVDQGUHFUHDWLRQIDFLOLWLHV  )XWXUHUHVLGHQWLDOGHYHORSPHQWZRXOGEHDVVHVVHGDQGLPSDFWIHHVIRUDOODIRUHPHQWLRQHGSXEOLF VHUYLFHVZRXOGEHFROOHFWHGGXULQJWKH%XLOGLQJ3HUPLWSURFHVV$VVXFKWKH3URMHFWZRXOGKDYHD OHVVWKDQVLJQLILFDQWLPSDFWRQSXEOLFVHUYLFHV  5HFUHDWLRQ 5(&5($7,213RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D :RXOGWKHSURMHFWLQFUHDVHWKHXVHRIH[LVWLQJQHLJKERUKRRG DQG UHJLRQDO SDUNV RU RWKHUUHFUHDWLRQDO IDFLOLWLHV VXFK WKDW VXEVWDQWLDOSK\VLFDOGHWHULRUDWLRQRIWKHIDFLOLW\ZRXOGRFFXURU EHDFFHOHUDWHG"  E 'RHVWKHSURMHFWLQFOXGHUHFUHDWLRQDOIDFLOLWLHVRUUHTXLUHWKH FRQVWUXFWLRQRUH[SDQVLRQRIUHFUHDWLRQDOIDFLOLWLHVZKLFKPLJKW KDYHDQDGYHUVHSK\VLFDOHIIHFWRQWKHHQYLURQPHQW"   6LJQLILFDQFH&ULWHULD,PSDFWVWRUHFUHDWLRQZRXOGEHVLJQLILFDQWLIWKH3URMHFWUHVXOWHGLQLQFUHDVHG XVH RI H[LVWLQJ SDUNV RU UHFUHDWLRQDO IDFLOLWLHV WR WKH H[WHQW WKDW VXEVWDQWLDO GHWHULRUDWLRQ ZDV DFFHOHUDWHGRULIWKH3URMHFWLQYROYHGWKHGHYHORSPHQWRUH[SDQVLRQRIUHFUHDWLRQDOIDFLOLWLHVWKDWZRXOG KDYHDQDGYHUVHHIIHFWRQWKHSK\VLFDOHQYLURQPHQW  (QYLURQPHQWDO6HWWLQJ7KH8NLDK9DOOH\RIIHUVDZLGHYDULHW\RIUHFUHDWLRQDORSSRUWXQLWLHV7KHVH LQFOXGHPRUHWKDQ&LW\SDUNVDPXQLFLSDOJROIFRXUVHDQGDVNDWHSDUNPDQDJHGE\WKH&LW\RI 8NLDKWZRUHJLRQDOSDUNVPDQDJHGE\WKH&RXQW\&RZ0RXQWDLQ5HFUHDWLRQ$UHDPDQDJHGE\WKH %XUHDXRI/DQG0DQDJHPHQWDQG/DNH0HQGRFLQRPDQDJHGE\WKH86$UP\&RUSVRI(QJLQHHUV,Q DGGLWLRQWKHUHDUHDSSUR[LPDWHO\PLOHVRIWUDLOVORFDWHGWKURXJKRXWWKH8NLDK9DOOH\  'LVFXVVLRQ DE /HVVWKDQVLJQLILFDQWLPSDFW7KH3URMHFWGRHVQRWSURSRVHDQ\UHFUHDWLRQDO IDFLOLWLHVDWWKLVWLPH+RZHYHUWKH&LW\GRHVKDYHDVSLUDWLRQVWRGHYHORSWUDLOVDQGUHFUHDWLRQDORSHQ VSDFHDUHDVDWVRPHSRLQWLQWKHIXWXUH3RWHQWLDOGHYHORSPHQWRIXSWRQHZUHVLGHQWLDOXQLWVZRXOG LQFUHDVH SRSXODWLRQ DQG LQ WXUQ LQFUHDVH WKH XVH RI H[LVWLQJ UHFUHDWLRQ IDFLOLWLHV +RZHYHU WKH LQFUHDVHLQSRSXODWLRQZRXOGQRWEHFRQVLGHUHGVLJQLILFDQWDQGIXWXUHGHYHORSPHQWZRXOGEHUHTXLUHG WRSD\DOOSDUNLPSDFWIHHVZKLFKDUHXVHGWRDVVLVWLQWKHGHYHORSPHQWDQGPDLQWHQDQFHRISDUNV DQGUHFUHDWLRQIDFLOLWLHV$VVXFKLPSDFWVZRXOGEHOHVVWKDQVLJQLILFDQWRQSDUNIDFLOLWLHV Page 381 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   7UDQVSRUWDWLRQ 75$163257$7,21:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D  &RQIOLFW ZLWK D SURJUDP SODQ RUGLQDQFH RU SROLF\ DGGUHVVLQJWKHFLUFXODWLRQV\VWHPLQFOXGLQJWUDQVLWURDGZD\ ELF\FOHDQGSHGHVWULDQIDFLOLWLHV"  E &RQIOLFWRUEHLQFRQVLVWHQWZLWK&(4$*XLGHOLQHV† VXEGLYLVLRQ E &ULWHULDIRU$QDO\]LQJ7UDIILF,PSDFWV" F 6XEVWDQWLDOO\LQFUHDVHKD]DUGVGXHWRDJHRPHWULFGHVLJQ IHDWXUH HJ VKDUS FXUYHV RU GDQJHURXV LQWHUVHFWLRQV  RU LQFRPSDWLEOHXVHV HJIDUPHTXLSPHQW "  G 5HVXOWLQLQDGHTXDWHHPHUJHQF\DFFHVV"  6LJQLILFDQFH&ULWHULD,PSDFWVWRWUDQVSRUWDWLRQDQGWUDIILFZRXOGEHVLJQLILFDQWLIWKH3URMHFWFRQIOLFWHG ZLWKDORFDOSODQRUGLQDQFHRUSROLF\DGGUHVVLQJWUDQVLWURDGZD\ELF\FOHDQGSHGHVWULDQIDFLOLWLHV FRQIOLFWHGZLWK&(4$*XLGHOLQHV6HF E ZKLFKFRQWDLQVFULWHULDIRUDQDO\]LQJWUDQVSRUWDWLRQ LPSDFWVVXEVWDQWLDOO\LQFUHDVHGKD]DUGVGXHWRJHRPHWULFGHVLJQIHDWXUHVRUUHVXOWHGLQLQDGHTXDWH HPHUJHQF\DFFHVV  7UDGLWLRQDOO\WUDQVSRUWDWLRQLPSDFWVKDGEHHQHYDOXDWHGE\XVLQJ/HYHORI6HUYLFH /26 DQDO\VLVWR PHDVXUHWKHOHYHORIFRQJHVWLRQRQORFDOURDGZD\V+RZHYHURQ6HSWHPEHU*RYHUQRU-HUU\ %URZQVLJQHG6HQDWH%LOO 6% LQWRODZLQLWLDWLQJDQXSGDWHWRWKH&(4$*XLGHOLQHVWRFKDQJH KRZOHDGDJHQFLHVHYDOXDWHWUDQVSRUWDWLRQLPSDFWVXQGHU&(4$ZLWKWKHJRDOWREHWWHUPHDVXUHWKH DFWXDOWUDQVSRUWDWLRQUHODWHGHQYLURQPHQWDOLPSDFWVRIDJLYHQSURMHFW6WDUWLQJ-XO\OHDG DJHQFLHV DUH UHTXLUHGWR DQDO\]H WKH WUDQVSRUWDWLRQ LPSDFWV RI QHZ SURMHFWV XVLQJ YHKLFOH PLOHV WUDYHOHG 907 LQVWHDGRI/26907PHDVXUHVWKHDPRXQWRIDGGLWLRQDOPLOHVSURGXFHGE\WKH SURMHFW ,I WKH SURMHFW LQFUHDVHV FDU WUDYHO RQWR WKH URDGV H[FHVVLYHO\ WKH SURMHFW PD\ FDXVH D VLJQLILFDQWWUDQVSRUWDWLRQLPSDFW907DQDO\VLVLVLQWHQGHGWRSURPRWHWKHVWDWH¶VJRDOVRIUHGXFLQJ JUHHQKRXVHJDVHPLVVLRQVDQGWUDIILFUHODWHGDLUSROOXWLRQSURPRWLQJWKHGHYHORSPHQWRIDPXOWLPRGDO WUDQVSRUWDWLRQV\VWHPDQGSURYLGLQJFOHDQHIILFLHQWDFFHVVWRGHVWLQDWLRQV  ,QWKH2IILFHRI3ODQQLQJDQG5HVHDUFK 235 SXEOLVKHGD7HFKQLFDO$GYLVRU\RQEvaluating Transportation Impacts in CEQA  ZKLFKLVLQWHQGHGWRSURYLGHDGYLFHDQGUHFRPPHQGDWLRQVIRU HYDOXDWLQJ907ZKLFKDJHQFLHVDQGRWKHUHQWLWLHVPD\XVHDWWKHLUGLVFUHWLRQ$VGLVFXVVHGIXUWKHU EHORZWKH7HFKQLFDO$GYLVRU\RIIHUVWKDWVFUHHQLQJWKUHVKROGVPD\EHXVHGWRLGHQWLI\ZKHQODQGXVH SURMHFWVVXFKDVVPDOOVFDOHUHVLGHQWLDOSURMHFWVVKRXOGEHH[SHFWHGWRFDXVHDOHVVWKDQVLJQLILFDQW LPSDFWZLWKRXWFRQGXFWLQJDGHWDLOHGWUDIILFVWXG\  2QEHKDOIRIWKH0HQGRFLQR&RXQFLORI*RYHUQPHQWV 0&2* )HKU 3HHUVSUHSDUHGD6HQDWH%LOO 9HKLFOH0LOHV7UDYHOHG5HJLRQDO%DVHOLQH6WXG\ %DVHOLQH6WXG\0D\ WRSURYLGHDQ RYHUYLHZRI6%VXPPDUL]H907GDWDDYDLODEOHIRU0HQGRFLQR&RXQW\GLVFXVVDOWHUQDWLYHVIRU DQGUHFRPPHQG907PHDVXUHPHQWPHWKRGVDQGWKUHVKROGVIRUOHDGDJHQFLHVLQ0HQGRFLQR&RXQW\ DQGUHFRPPHQGWUDQVSRUWDWLRQGHPDQGPDQDJHPHQW 7'0 VWUDWHJLHVIRUUHGXFLQJ907RQSURMHFWV LQ0HQGRFLQR&RXQW\  Page 382 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  7KHIROORZLQJORFDOSODQVKDYHKLVWRULFDOO\DGGUHVVWUDQVSRUWDWLRQZLWKLQWKH&LW\RI8NLDK8NLDK %LF\FOHDQG3HGHVWULDQ0DVWHU3ODQ&LW\RI8NLDK6DIH5RXWHVWR6FKRRO3ODQ  0HQGRFLQR &RXQW\5DLO7UDLO3ODQ  8NLDK'RZQWRZQ6WUHHWVFDSH,PSURYHPHQW3ODQ  DQGWKH&LW\ RI8NLDK*HQHUDO3ODQ &LUFXODWLRQDQG7UDQVSRUWDWLRQ(OHPHQWDPHQGHGLQ 0&2*¶V5HJLRQDO 7UDQVSRUWDWLRQ3ODQ  DQG6HFWLRQ&LUFXODWLRQDQG7UDQVSRUWDWLRQRIWKH8NLDK9DOOH\$UHD 3ODQ  DGGUHVVHVWUDQVSRUWDWLRQZLWKLQWKHODUJHU8NLDK9DOOH\7KH%DVHOLQH6WXG\LQFRUSRUDWHG DSSOLFDEOHJRDOVDQGSROLFLHVIURPHDFKRIWKHVHGRFXPHQWVLQWRWKHPHWKRGRORJ\DQGDQDO\VLVZKHQ IRUPXODWLQJLWVVFUHHQLQJWRROV  $VQRWHGLQWKH%DVHOLQH6WXG\SHU&(4$*XLGHOLQHV6HFWLRQYHKLFOHPLOHVWUDYHOHGIRUODQG XVHSURMHFWVH[FHHGLQJDQDSSOLFDEOHWKUHVKROGRIVLJQLILFDQFHPD\LQGLFDWHDVLJQLILFDQWLPSDFW *HQHUDOO\SURMHFWVZLWKLQRQHKDOIPLOHRIHLWKHUDQH[LVWLQJPDMRUWUDQVLWVWRSRUDVWRSDORQJDQ H[LVWLQJKLJKTXDOLW\WUDQVLWFRUULGRUVKRXOGEHSUHVXPHGWRFDXVHDOHVVWKDQVLJQLILFDQWWUDQVSRUWDWLRQ LPSDFW,QDGGLWLRQSURMHFWVWKDWGHFUHDVHYHKLFOHPLOHVWUDYHOHGLQWKHSURMHFWDUHDFRPSDUHGWR H[LVWLQJFRQGLWLRQVVKRXOGEHSUHVXPHGWRKDYHDOHVVWKDQVLJQLILFDQWWUDQVSRUWDWLRQLPSDFW  ,IH[LVWLQJPRGHOVRUPHWKRGVDUHQRWDYDLODEOHWRHVWLPDWHWKHYHKLFOHPLOHVWUDYHOHGIRUWKHSDUWLFXODU SURMHFWEHLQJFRQVLGHUHGDOHDGDJHQF\PD\DQDO\]HWKHSURMHFW¶VYHKLFOHPLOHVWUDYHOHGTXDOLWDWLYHO\ 6XFKDTXDOLWDWLYHDQDO\VLVZRXOGHYDOXDWHIDFWRUVVXFKDVWKHDYDLODELOLW\RIWUDQVLWSUR[LPLW\WRRWKHU GHVWLQDWLRQVHWF)RUPDQ\SURMHFWVDTXDOLWDWLYHDQDO\VLVRIFRQVWUXFWLRQWUDIILFPD\EHDSSURSULDWH  $OHDGDJHQF\KDVGLVFUHWLRQWRFKRRVHWKHPRVWDSSURSULDWHPHWKRGRORJ\WRHYDOXDWHDSURMHFW¶V YHKLFOHPLOHVWUDYHOHGLQFOXGLQJZKHWKHUWRH[SUHVVWKHFKDQJHLQDEVROXWHWHUPVSHUFDSLWDSHU KRXVHKROGRULQDQ\RWKHUPHDVXUH$OHDGDJHQF\PD\XVHPRGHOVWRHVWLPDWHDSURMHFW¶VYHKLFOH PLOHVWUDYHOHGDQGPD\UHYLVHWKRVHHVWLPDWHVWRUHIOHFWSURIHVVLRQDOMXGJPHQWEDVHGRQVXEVWDQWLDO HYLGHQFH$Q\DVVXPSWLRQVXVHGWRHVWLPDWHYHKLFOHPLOHVWUDYHOHGDQGDQ\UHYLVLRQVWRPRGHORXWSXWV VKRXOGEHGRFXPHQWHGDQGH[SODLQHGLQWKHHQYLURQPHQWDOGRFXPHQWSUHSDUHGIRUWKHSURMHFW  (QYLURQPHQWDO6HWWLQJ7KH&LW\RI8NLDKJHQHUDOO\OLHVZHVWRI86EHWZHHQWKH861RUWK 6WDWH6WUHHWLQWHUFKDQJHDQGWKH866RXWK6WDWH6WUHHWLQWHUFKDQJH7KUHHPDMRULQWHUFKDQJHV DORQJ867DOPDJH5RDG*REEL6WUHHWDQG3HUNLQV6WUHHW IURPVRXWKWRQRUWK SURYLGHDFFHVV WRVRXWKHUQDQGFHQWUDO8NLDK7KH&LW\RI8NLDKLVGHYHORSHGLQDW\SLFDOJULGSDWWHUQZLWKVWUHHWV JHQHUDOO\RULHQWHGQRUWKWRVRXWKDQGHDVWWRZHVW%LF\FOHODQHVDUHORFDWHGWKURXJKRXWWKH&LW\DQG SXEOLFWUDQVLWLVSURYLGHGE\WKH0HQGRFLQR7UDQVLW$XWKRULW\ 07$   7KH3URMHFWSDUFHOVDUHFXUUHQWO\DFFHVVHGWKURXJKH[LVWLQJSULYDWHGLUWDQGJUDYHOURDGVWKDWFRQQHFW WR5HGZRRG$YHQXHD&LW\RZQHGDQGPDLQWDLQHGURDGWKURXJKDQH[LVWLQJDFFHVVSRLQWFRQWUROOHG E\DSULYDWHJDWH+RZHYHUWKHDFFHVVURDGZLGWKUDQJHVIURPIWWRIWZLWKWKHPDMRULW\RILW EHLQJDPLQLPXPRIIWZLGH7KHVHFWLRQVWKDWDUHIWZLGHDUHDSSUR[LPDWHO\IWORQJDQGKDYH ZLGHUWXUQRXWVLPPHGLDWHO\EHIRUHRUDIWHUWKHP7KH1HDUHVW07$EXVVWRSLVORFDWHGDW:DVKLQJWRQ $YHQXHDQG6RXWK'RUD6WUHHWDSSUR[LPDWHO\PLOHVRXWKHDVWRIWKHDFFHVVSRLQWRQ5HGZRRG $YHQXH3RUWLRQVRI5HGZRRG$YHQXHDUHLPSURYHGZLWKVLGHZDONV5HGZRRG$YHQXHXOWLPDWHO\ FRQQHFWVYLD+HOHQ$YHQXHDQGHLWKHU2EVHUYDWRU\RU:DVKLQJWRQ6WUHHWVWR'RUD6WUHHWDQGWKH ODUJHUZHVWHUQ8NLDKDUHDZKLFKFRQWDLQORFDOELNHDQGSHGHVWULDQIDFLOLWLHV  'LVFXVVLRQ DE  /HVV WKDQ VLJQLILFDQW LPSDFW7KH 235 7HFKQLFDO $GYLVRU\ RQEvaluating Transportation Impacts Under CEQA VXJJHVWVWKDWDKRPHEDVHGWULSDSSURDFKLVRQHRIWKHEHVW PHWKRGVIRUDVVHVVLQJ907IURPUHVLGHQWLDOSURMHFWV$VQRWHGLQWKH7HFKQLFDO$GYLVRU\PDQ\ DJHQFLHVXVH³VFUHHQLQJWKUHVKROGV´WRTXLFNO\LGHQWLI\ZKHQDSURMHFWVKRXOGEHH[SHFWHGRUDVVXPHG Page 383 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  WRFDXVHDOHVVWKDQVLJQLILFDQWLPSDFWZLWKRXWFRQGXFWLQJDGHWDLOHGVWXG\$VQRWHGLQWKH)HKU  3HHUV%DVHOLQH6WXG\WKHVSHFLILF907HVWLPDWHUHOLHVRQWKHYHKLFOHWULSJHQHUDWLRQUDWHFRQWDLQHG LQ WKH 235 7HFKQLFDO $GYLVRU\ IRU VPDOO SURMHFW VFUHHQLQJ DQG DYHUDJH YHKLFOH WULS OHQJWKV IRU 0HQGRFLQR&RXQW\EDVHGRQWKH&DOLIRUQLD+RXVHKROG7UDYHO6XUYH\ &+76 &RQYHUWLQJWKLV YDOXHWRDQHTXLYDOHQWQXPEHURIUHVLGHQWLDOKRXVHKROGVZRXOGLQGLFDWHWKDWUHVLGHQWLDOSURMHFWVXSWR XQLWVLQ0HQGRFLQR&RXQW\FRXOGEHVFUHHQHGRXWRIDQDO\VLV%HFDXVHWKH3URMHFWZRXOGXOWLPDWHO\ DOORZDPD[EXLOGRXWRIVHYHQVLQJOHIDPLO\UHVLGHQWLDOXQLWVDQGWKHSRVVLELOLW\RIDVVRFLDWHG$'8V WKH3URMHFWPD\EHVFUHHQHGRXWRIIXUWKHU907DQDO\VLV1RQHWKHOHVVDTXDOLWDWLYHDQDO\VLVRI907 LVSURYLGHGEHORZ  6LQFHWKH3URMHFWVLWHLVFXUUHQWO\XQGHYHORSHGDQ\GHYHORSPHQWZLWKUHODWHGYHKLFOHXVHZRXOG LQFUHDVH907,QWKLVFDVHWKHUHZRXOGEHDQLQFUHDVHLQWUDIILFWRDQGIURPWKHVLWHGXULQJERWK FRQVWUXFWLRQDQGRSHUDWLRQRIWKH3URMHFW,WLVH[SHFWHGWKDWFRQVWUXFWLRQRIWKH3URMHFWZRXOGUHVXOWLQ DWHPSRUDU\LQFUHDVHLQWUDIILFWRDQGIURPWKHVLWHDVFRQVWUXFWLRQZRUNHUVDUULYHDQGOHDYHHDFKZRUN GD\,QDGGLWLRQPLQRULQFUHDVHVWRWUDIILFRQDGMDFHQWVWUHHWV VSHFLILFDOO\5HGZRRG$YHQXHDQG+HOHQ $YHQXH FRXOGRFFXUZKHQKHDY\HTXLSPHQWUHTXLUHGIRUFRQVWUXFWLRQLVWUDYHOLQJWRDQGIURPWKHVLWH +RZHYHURQFHFRQVWUXFWLRQLVFRPSOHWHZRUNHUVZRXOGQRORQJHUEHWUDYHOLQJWRWKHVLWHDQGWKH VRXUFH RI 907 ZRXOG UHVXOW IURP SHUPDQHQW UHVLGHQWV )RXU KRXVHKROGV ZRXOG JHQHUDWH DSSUR[LPDWHO\907SHUGD\LQ0HQGRFLQR&RXQW\EDVHGRQWKH&DOLIRUQLD+RXVHKROG7UDYHO 6XUYH\ &+76 QRWHGLQWKH907%DVHOLQH6WXG\7KLVUHVXOWVLQHDFKUHVLGHQFHSURGXFLQJ907 SHUGD\$FFRUGLQJO\LWLVDQWLFLSDWHGWKDWWKHVHYHQVLQJOHIDPLO\KRPHVZRXOGSURGXFHDWRWDORI 907SHUGD\,IWKHDVVRFLDWHGVHYHQ$'8VZHUHFRQVWUXFWHGWKLVZRXOGJHQHUDWHPRUH907EXWLV QRWDQWLFLSDWHGWRUHVXOWLQWKHVDPHQXPEHURI907DVWKHSULPDU\UHVLGHQFHV1RQHWKHOHVV907 JHQHUDWHGIURPWKH3URMHFWZRXOGEHVLPLODUWRWKDWRIH[LVWLQJORZGHQVLW\UHVLGHQWLDOGHYHORSPHQW DQGZRXOGEHFRQVLGHUHGOHVVWKDQVLJQLILFDQW  7KH 907 LPSDFWV RI WKH UHVLGHQWLDO GHYHORSPHQW ZRXOG QRW FRQIOLFW ZLWK WKH  5HJLRQDO 7UDQVSRUWDWLRQ 3ODQ 573  DGRSWHG E\ WKH 0&2* 0HQGRFLQR &RXQW\¶V 5HJLRQDO7UDQVSRUWDWLRQ 3ODQQLQJ$JHQF\3HUWKH5HJLRQDO7UDQVSRUWDWLRQ3ODQ 573 QHZGHYHORSPHQWLVH[SHFWHGWR SURGXFHUDWKHUORFDOL]HGLPSDFWV$VFLWHGEHORZLQIRRWQRWH“Land use policies [in Mendocino County] tend to protect open-spaced lands such as agriculture and forestlands.”5 7KH 3URSRVHG  3URMHFWZRXOGQRWFRQIOLFWZLWKLGHQWLILHG0DMRU,PSURYHPHQWV*RDOV3ROLFLHVRU2EMHFWLYHVLGHQWLILHG LQWKH573$GGLWLRQDOO\WKH8NLDK9DOOH\$UHD3ODQ  LGHQWLILHVIXWXUHFRQFHSWXDOURDGZD\ LPSURYHPHQWV IRU WKH SODQ DUHD 7KH 3URSRVHG 3URMHFW GRHV QRW FRQIOLFW ZLWK WKH 89$3¶V UHFRPPHQGDWLRQV DQG FRQFHSWXDOURDG LPSURYHPHQWV EHFDXVHWKHVH UHFRPPHQGDWLRQV DGGUHVV JDSV LQ WKH VWUHHW V\VWHP H[SDQG FDSDFLW\ ZKHUH IXWXUH FRQJHVWLRQ OHYHOV DUH DQWLFLSDWHG DQG GHYHORSPHQWRISDUDOOHOQRUWKVRXWKIDFLOLWLHV  )RUWKHUHDVRQVVWDWHGDERYHWKH3URMHFWZRXOGQRWFRQIOLFWZLWK&(4$*XLGHOLQHV†QRU ZRXOGLWFRQIOLFWZLWKDUHJLRQDOSODQRUSROLF\UHODWHGWRWUDIILF,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  FG /HVVWKDQVLJQLILFDQWLPSDFW$SSUR[LPDWHO\RQHKDOIPLOHRIWKHH[LVWLQJWRIWZLGHJUDYHO SULYDWHDFFHVVURDGEHJLQQLQJDWWKHDFFHVVSRLQWDWWKHWHUPLQXVRIRQ5HGZRRG$YHQXHWRWKHKRXVH VLWHVZRXOGEHSDYHGWRVHUYHWKHIXWXUHKRXVLQJGHYHORSPHQWVLWHV7KHURDGLPSURYHPHQWVZLOO LQFOXGH GHYHORSLQJ D FXOGHVDF DQGSRVVLEO\ H[WHQGLQJ GULYHZD\V WR'HYHORSPHQW 3DUFHOV7KH 'HYHORSHUZLOOFRPSOHWHWKHURDGLPSURYHPHQWVEXWWKHURDGZLOOUHPDLQXQGHUSULYDWHRZQHUVKLSWKDW ZLOOEHPDLQWDLQHGE\D+RPHRZQHU¶V$VVRFLDWLRQ +2$ IRUIXWXUHUHVLGHQWLDOGHYHORSPHQW%RWKWKH  KWWSVZZZPHQGRFLQRFRJRUJILOHV573$V$GRSWHGZHEIRUPDWSGI SJ  Page 384 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  &DOLIRUQLD'HSDUWPHQWRI)RUHVWU\DQG)LUH3URWHFWLRQ &DO)LUH DQGWKH8NLDK9DOOH\)LUH$XWKRULW\ 89)$ KDYH UHYLHZHG WKH 3URMHFW DQG FRQGXFWHG D VLWH YLVLW$OO URDG LPSURYHPHQWVZRXOGEH GHYHORSHGLQDFFRUGDQFHZLWK)LUHDQG%XLOGLQJFRGHVUHODWHGWRHPHUJHQF\DFFHVVDQGVDIHW\ 7KHUHIRUHSURSRVHGDFFHVVLPSURYHPHQWVZRXOGQRWLQFUHDVHWUDIILFKD]DUGVQRUZRXOGWKH\UHVXOW LQLQDGHTXDWHHPHUJHQF\DFFHVV,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  7ULEDO&XOWXUDO5HVRXUFHV 75,%$/&8/785$/5(6285&(6:RXOGWKHSURMHFWFDXVH D VXEVWDQWLDO DGYHUVH FKDQJH LQ WKH VLJQLILFDQFH RI D WULEDO FXOWXUDO UHVRXUFH GHILQHG LQ 3XEOLF 5HVRXUFHV &RGH VHFWLRQ DVHLWKHUDVLWHIHDWXUHSODFHFXOWXUDOODQGVFDSHWKDWLV JHRJUDSKLFDOO\GHILQHGLQWHUPVRIWKHVL]HDQGVFRSHRIWKH ODQGVFDSH VDFUHG SODFH RU REMHFW ZLWK FXOWXUDO YDOXH WR D &DOLIRUQLD1DWLYH$PHULFDQWULEHDQGWKDWLV 3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D  /LVWHG RU HOLJLEOH IRU OLVWLQJ LQ WKH &DOLIRUQLD 5HJLVWHU RI +LVWRULFDO 5HVRXUFHV RU LQ D ORFDO UHJLVWHU RI KLVWRULFDO UHVRXUFHV DV GHILQHG LQ 3XEOLF 5HVRXUFHV &RGH VHFWLRQ  N RU  E $UHVRXUFHGHWHUPLQHGE\WKHOHDGDJHQF\LQLWVGLVFUHWLRQ DQG VXSSRUWHG E\ VXEVWDQWLDO HYLGHQFH WR EH VLJQLILFDQW SXUVXDQW WR FULWHULD VHW IRUWK LQ VXEGLYLVLRQ F  RI 3XEOLF 5HVRXUFHV&RGH6HFWLRQ,QDSSO\LQJWKHFULWHULDVHW IRUWKLQVXEGLYLVLRQ F RI3XEOLF5HVRXUFH&RGH6HFWLRQ WKHOHDGDJHQF\VKDOOFRQVLGHUWKHVLJQLILFDQFHRIWKHUHVRXUFH WRD&DOLIRUQLD1DWLYH$PHULFDQWULEH   6LJQLILFDQFH&ULWHULD$QLPSDFWWRWULEDOFXOWXUDOUHVRXUFHVZRXOGEHVLJQLILFDQWLIWKH3URMHFWZHUHWR VXEVWDQWLDOO\UHGXFHWKHVLJQLILFDQFHRIDWULEDOFXOWXUDOUHVRXUFHDOLVWHGRUHOLJLEOHKLVWRULFUHVRXUFH RUDUHVRXUFHFRQVLGHUHGVLJQLILFDQWE\D&DOLIRUQLD1DWLYH$PHULFDQWULEH7ULEDOFXOWXUDOUHVRXUFHV LQFOXGH³VLWHVIHDWXUHVSODFHVFXOWXUDOODQGVFDSHVVDFUHGSODFHVDQGREMHFWVZLWKFXOWXUDOYDOXHWR D&DOLIRUQLD1DWLYH$PHULFDQ7ULEH´WKDWDUHHOLJLEOHIRULQFOXVLRQLQWKH&DOLIRUQLD5HJLVWHURI+LVWRULFDO 5HVRXUFHV &DOLIRUQLD5HJLVWHU RULQFOXGHGLQDORFDOUHJLVWHURIKLVWRULFDOUHVRXUFHV/HDGDJHQFLHV DUHUHTXLUHGWR³EHJLQFRQVXOWDWLRQZLWKD&DOLIRUQLD1DWLYH$PHULFDQWULEHWKDWLVWUDGLWLRQDOO\DQG FXOWXUDOO\DIILOLDWHGZLWKWKHJHRJUDSKLFDUHDRIWKH3URSRVHG3URMHFW´7KHFRQVXOWDWLRQSURFHVVPXVW EHFRPSOHWHGEHIRUHD&(4$GRFXPHQWFDQEHFHUWLILHG  (QYLURQPHQWDO6HWWLQJ$VGLVFXVVHGLQ6HFWLRQ&XOWXUDO5HVRXUFHVDUHDVWKDWDUHPRVWW\SLFDOO\ FXOWXUDOO\ VHQVLWLYH LQFOXGH WKRVH DGMDFHQW WR VWUHDPVVSULQJV DQG PLGVORSH EHQFKHV DERYH ZDWHUFRXUVHVEHFDXVH1DWLYH$PHULFDQVDQGVHWWOHUVIDYRUHGHDV\DFFHVVWRSRWDEOHZDWHU  7ULEHVNQRZQWREHSUHVHQWZLWKLQWKH8NLDKDUHDLQFOXGH EXWDUHQRWOLPLWHGWR WKHIROORZLQJ •&R\RWH9DOOH\%DQGRI3RPR,QGLDQV •*XLGLYLOOH,QGLDQ5DQFKHULDRI3RPR,QGLDQV •+RSODQG%DQGRI3RPR,QGLDQV •3LQROHYLOOH3RPR1DWLRQ •3RWWHU9DOOH\5DQFKHULD •5HGZRRG9DOOH\/LWWOH5LYHU%DQGRI3RPR,QGLDQV •6FRWWV9DOOH\%DQGRI3RPR,QGLDQV •<RND\R7ULEHQRWIHGHUDOO\UHFRJQL]HG Page 385 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  'LVFXVVLRQ DE /HVVWKDQVLJQLILFDQWLPSDFW$VGHVFULEHGLQ6HFWLRQ&XOWXUDO5HVRXUFHVRI WKLV,QLWLDO6WXG\QRFXOWXUDOUHVRXUFHVZHUHLGHQWLILHGZLWKLQWKH3URMHFWDUHDDVDUHVXOWRIWKHUHFRUGV VHDUFKOLWHUDWXUHUHYLHZRUDUFKDHRORJLFDOILHOGVXUYH\,QDGGLWLRQGXHWRLWVWRSRJUDSK\WKHVLWHLV FRQVLGHUHGWRKDYHD³ORZSRWHQWLDO´IRUFXOWXUDODUFKHRORJLFDODQGKLVWRULFUHVRXUFHV $OWKRXJK QR WULEHV KDYH FRQWDFWHG WKH &LW\ RI 8NLDK WR UHTXHVW QRWLILFDWLRQ XQGHU $%  WULEDO QRWLILFDWLRQVRIIHULQJ WKH RSSRUWXQLW\ WR UHTXHVW IRUPDO FRQVXOWDWLRQ ZHUH VHQW WR ORFDO WULEHV RQ 'HFHPEHU,QDGGLWLRQDUHTXHVWVHHNLQJDOLVWRIWULEHVWKDWVKRXOGEHFRQWDFWHGZDVVHQW WRWKH1$+&1RWLFHVZHUHVHQWWRWKHDGGLWLRQDOWULEHVLGHQWLILHGE\WKH1$+&RQ-DQXDU\ 2Q-DQXDU\DUHTXHVWIRUIRUPDOFRQVXOWDWLRQE\WKH3LQROHYLOOH3RPR1DWLRQZDVUHFHLYHG $%FRQVXOWDWLRQZDVFRQFOXGHGZLWKWKHWULEHRQ0D\&RUUHVSRQGHQFHZLWK3LQROHYLOOH 3RPR 1DWLRQ KDV EHHQ RPLWWHG IRU FRQILGHQWLDOLW\7KH OLVW RI WULEHV FRQWDFWHG DUH LQFOXGHG LQ $WWDFKPHQW&  'HVSLWHWKHQHJDWLYHILQGLQJVDQGWKHORZSRWHQWLDOIRUUHVRXUFHVWRRFFXURQVLWHWKHUHLVSRWHQWLDOIRU UHVRXUFHVWREHLQDGYHUWHQWO\GLVFRYHUHGGXULQJJURXQGGLVWXUELQJDFWLYLWLHV7KHUHIRUH0LWLJDWLRQ 0HDVXUHV&8/DQG&8/ZRXOGEHLPSOHPHQWHG,PSDFWVWRZRXOGEHOHVVWKDQVLJQLILFDQWZLWK PLWLJDWLRQLQFRUSRUDWHG  0LWLJDWLRQ0HDVXUHV  ,PSOHPHQWDWLRQRI&8/DQG&8/   8WLOLWLHVDQG6HUYLFH6\VWHPV 87,/,7,(6$1'6(59,&(6<67(06:RXOGWKHSURMHFW3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 5HTXLUHRUUHVXOWLQWKHUHORFDWLRQRUFRQVWUXFWLRQRIQHZRU H[SDQGHG ZDWHU ZDVWHZDWHU WUHDWPHQW RU VWRUP ZDWHU GUDLQDJHHOHFWULFSRZHUQDWXUDOJDVRUWHOHFRPPXQLFDWLRQV IDFLOLWLHVWKHFRQVWUXFWLRQRUUHORFDWLRQRIZKLFKFRXOGFDXVH VLJQLILFDQWHQYLURQPHQWDOHIIHFWV"  E +DYHVXIILFLHQWZDWHUVXSSOLHVDYDLODEOHWRVHUYHWKHSURMHFW DQGUHDVRQDEO\IRUHVHHDEOHIXWXUHGHYHORSPHQWGXULQJQRUPDO GU\DQGPXOWLSOHGU\\HDUV"  F  5HVXOW LQ D GHWHUPLQDWLRQ E\ WKH ZDVWHZDWHU WUHDWPHQW SURYLGHU ZKLFK VHUYHV RU PD\ VHUYH WKH SURMHFW WKDW LW KDV DGHTXDWHFDSDFLW\WRVHUYHWKHSURMHFW¶VSURMHFWHGGHPDQGLQ DGGLWLRQWRWKHSURYLGHU¶VH[LVWLQJFRPPLWPHQWV"  G *HQHUDWHVROLGZDVWHLQH[FHVVRIVWDWHRUORFDOVWDQGDUGVRU LQH[FHVVRIWKHFDSDFLW\RIORFDOLQIUDVWUXFWXUHRURWKHUZLVH LPSDLUWKHDWWDLQPHQWRIVROLGZDVWHUHGXFWLRQJRDOV"  H  &RPSO\ ZLWK IHGHUDO VWDWH DQG ORFDO PDQDJHPHQW DQG UHGXFWLRQVWDWXWHVDQGUHJXODWLRQVUHODWHGWRVROLGZDVWH"  6LJQLILFDQFH&ULWHULD,PSDFWVWRXWLOLW\DQGVHUYLFHV\VWHPVZRXOGEHVLJQLILFDQWLIWKH3URMHFWUHVXOWHG LQWKHFRQVWUXFWLRQRUH[SDQVLRQRIXWLOLWLHVWKDWFRXOGFDXVHVLJQLILFDQWHQYLURQPHQWDOHIIHFWVKDYH Page 386 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  LQVXIILFLHQWZDWHUVXSSOLHVDYDLODEOHWRWKH3URMHFWGXULQJQRUPDOWRH[WUHPHO\GU\\HDUVUHVXOWHGLQ LQDGHTXDWHFDSDFLW\RIWKHZDVWHZDWHUWUHDWPHQWSODQWJHQHUDWHGVROLGZDVWHH[FHHGLQJWKHFDSDFLW\ RIORFDOLQIUDVWUXFWXUHRULPSDLULQJWKHDFKLHYHPHQWRIVROLGZDVWHUHGXFWLRQJRDOVRUIDLOHGWRFRPSO\ ZLWKDQ\PDQDJHPHQWDQGUHGXFWLRQVWDWXWHVRUUHJXODWLRQVUHODWHGWRVROLGZDVWH  (QYLURQPHQWDO6HWWLQJ7KHPDMRULW\RI&LW\SURSHUWLHVDUHVHUYHGE\&LW\ZDWHUVHZHUHOHFWULFLW\ DQGWUDVKFROOHFWLRQ+RZHYHUVRPHSURSHUWLHVZLWKLQWKH:HVWHUQ+LOOVLQFOXGLQJWKH3URSRVHG 3URMHFWVLWHVGRQRWFXUUHQWO\KDYHDFFHVVWR&LW\XWLOLWLHV)RUSURSHUW\RXWVLGHRIWKH&LW\OLPLWV VHUYLFHVDUHSURYLGHGE\SULYDWHVHUYLFHSURYLGHUVDQGVSHFLDOGLVWULFWVDVVXPPDUL]HGEHORZ  Electric. 7KH&LW\RI8NLDK¶V(OHFWULF8WLOLW\'HSDUWPHQWSURYLGHVHOHFWULFVHUYLFHVWRSURSHUWLHVZLWKLQ WKH&LW\OLPLWVZKLOH3DFLILF*DV (OHFWULF 3* ( SURYLGHVVHUYLFHVWRSURSHUWLHVRXWVLGHRIWKH&LW\ Water.7KHUHDUHILYHPDMRUSURYLGHUVRIFRPPXQLW\ZDWHUVHUYLFHVLQWKH8NLDK9DOOH\7KH&LW\RI 8NLDKVHUYHVFXVWRPHUVZLWKLQWKH&LW\ZKLOH5RJLQD:DWHU&RPSDQ\DQG0LOOYLHZ&DOSHOODDQG :LOORZ&RXQW\:DWHU'LVWULFWVVHUYHWKHXQLQFRUSRUDWHGDUHDV$OOVXSSOLHUVDUHUHJXODWHGE\WKH &DOLIRUQLD'HSDUWPHQWRI+HDOWK6HUYLFHVDQG5RJLQD:DWHU&RPSDQ\LVDGGLWLRQDOO\UHJXODWHGE\WKH &DOLIRUQLD3XEOLF8WLOLWLHV&RPPLVVLRQ7KH3URMHFWSDUFHOVDUHQRWORFDWHGZLWKLQDQH[LVWLQJZDWHU GLVWULFW¶VERXQGDU\$FFRUGLQJWRWKH89$3WKHSULPDU\ZDWHUVRXUFHIRUZDWHUSURYLGHUVLQWKH8NLDK 9DOOH\LVWKH5XVVLDQ5LYHUDQGGLYHUVLRQRI(HO5LYHUZDWHUZLWKVWRUDJHLQ/DNH0HQGRFLQR3URSHUW\ RZQHUVZLWKRXWDFFHVVWRWKH&LW\RUFRPPXQLW\V\VWHPVREWDLQZDWHUIURPLQGLYLGXDOZHOOVVSULQJV RUGLUHFWGLYHUVLRQVRI5XVVLDQ5LYHUZDWHU  7KH&LW\RI8NLDK8UEDQ:DWHU0DQDJHPHQW3ODQ 8:03 ZDVDGRSWHGE\&LW\&RXQFLORQ-XQH 7KH8:03FRQVLGHUVVHYHUDOJURZWKVFHQDULRVLQFOXGLQJDQDGGLWLRQDODQG KRRNXSVFHQDULRVDQGGHWHUPLQHGWKDWWKHUHLVFDSDFLW\WKURXJKWKHSODQQLQJKRUL]RQWRVHUYH WKHVHJURZWKSURMHFWLRQV  Sewer and Wastewater.7KH8NLDK9DOOH\6DQLWDWLRQ'LVWULFW 896' DQGWKH&LW\RI8NLDKSURYLGH SXEOLFVHZHUVHUYLFHVWRFXVWRPHUVZLWKLQWKHLUERXQGDULHVXQGHUWKHSXUYLHZRIWKH6WDWH:DWHU 4XDOLW\&RQWURO%RDUG7KH&LW\¶VVHZDJHWUHDWPHQWSODQWDQG:DVWH:DWHU7UHDWPHQW3ODQW ::73  RSHUDWLRQDOVLQFHVHUYHVWKH&LW\RI8NLDKDQGWKH8NLDK9DOOH\6DQLWDWLRQ'LVWULFW7KH::73 ZDVXSJUDGHGLQ7KLVXSJUDGHLQFOXGHGWKHDGGLWLRQRIHTXLYDOHQWVDQLWDU\VHZHUXQLWV (668V $Q(668LVDSSUR[LPDWHO\ZKDWLVXVHGE\DVLQJOHIDPLO\GZHOOLQJXQLW,WKDVDFXUUHQW WUHDWPHQWFDSDFLW\RIPLOOLRQJDOORQVSHUGD\ 0*' RIGU\ZHDWKHUIORZDQG0*'RISHDNZHW ZHDWKHUIORZ3ULPDU\WUHDWPHQWUHPRYHVIORDWLQJPDWHULDORLOVDQGJUHDVHVVDQGDQGVLOWDQGRUJDQLF VROLGV KHDY\ HQRXJK WR VHWWOH LQ ZDWHU6HFRQGDU\ WUHDWPHQW ELRORJLFDOO\ UHPRYHV PRVW RI WKH VXVSHQGHGDQGGLVVROYHGRUJDQLFPDWHULDO3URSRVHG3DUFHOVDUHORFDWHGZLWKLQWKH8NLDK9DOOH\ 6DQLWDWLRQ'LVWULFW 896' VHUYLFHDUHDZKLOH3DUFHOVDUHQRWLQFOXGHGZLWKLQDSURYLGHU¶VFXUUHQW VHUYLFHDUHD Solid Waste7KH8NLDKODQGILOORXWVLGH&LW\OLPLWVRQ9LFK\6SULQJV5RDGVWRSSHGUHFHLYLQJPXQLFLSDO VROLGZDVWHLQDQGWKH&LW\LVZRUNLQJRQFDSSLQJWKHODQGILOO1RQHZZDVWHJHQHUDWHGZLOOEH SURFHVVHGWKURXJKWKHODQGILOO6ROLGZDVWHJHQHUDWHGLQWKH8NLDK9DOOH\LVH[SRUWHGIRUGLVSRVDOWR WKH3RWUHUR+LOOV/DQGILOOLQ6RODQR&RXQW\7KH9DOOH\¶VVROLGZDVWHGLVSRVDOV\VWHPFRQVLVWVRID ODUJHYROXPHWUDQVIHUVWDWLRQ8NLDK7UDQVIHU6WDWLRQZKLFKUHFHLYHVZDVWHIRUH[SRUW  'LVFXVVLRQ D /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG6HZHUZDWHUDQG HOHFWULFXWLOLWLHVZRXOGEHSURYLGHGWRWKH'HYHORSPHQW3DUFHOV6HZHUDQGZDWHUZLOOEHGHYHORSHGE\ Page 387 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  WKHSURSHUW\RZQHUZKLOHHOHFWULFLQIUDVWUXFWXUHZLOOEHGHYHORSHGE\WKHSURSHUW\RZQHUDQGRUWKH &LW\$OOXWLWOLHVZRXOGEHRZQHGDQGPDLQWDLQHGE\WKH+2$ZLWKWKHH[FHSWLRQRIHOHFWULFZKLFKZLOO EHXOWLPDWHO\PDLQWDLQHGE\WKH&LW\'HYHORSPHQWRIXWLOLWLHVFRXOGUHVXOWLQSK\VLFDOLPSDFWVWRWKH HQYLURQPHQW+RZHYHUDOOXWLOLWLHVZLOOEHXQGHUJURXQGHGDQGORFDWHGZLWKLQRUDGMDFHQWWRH[LVWLQJ DFFHVVURDGVRQSULYDWHSDUFHOVDQGSUHYLRXVO\GLVWXUEHGDUHDV,QDGGLWLRQWRVHUYLQJWKHSURSRVHG UHVLGHQWLDOGHYHORSPHQWVWZRZDWHUWDQNVZLOOEHLQVWDOOHGWRDGGQHZZDWHUVWRUDJHDQGILUHSURWHFWLRQ IDFLOLWLHVLQWKH:HVWHUQ+LOOV LGHQWLILHGE\DEOXHGRWRQWKH3URMHFW0DSLQ)LJXUH 1RRWKHU GHYHORSPHQWLVSURSRVHGDWWKLVWLPH:LWKLQFRUSRUDWLRQRIPLWLJDWLRQPHDVXUHVOLVWHGEHORZDQG GHVFULEHGLQ%LRORJLFDO5HVRXUFHV*HRORJ\DQG6RLOVDQG+\GURORJ\DQG:DWHU4XDOLW\LPSDFWV UHODWHGWRH[SDQVLRQRIXWLOLWLHVZRXOGQRWUHVXOWLQDVLJQLILFDQWLPSDFWWRWKHHQYLURQPHQW,PSDFWV ZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQPHDVXUHVLQFRUSRUDWHG  E /HVVWKDQVLJQLILFDQWLPSDFW:DWHUZLOOEHSURYLGHGE\WKHSURSHUW\RZQHUGHYHORSHURQVLWHYLD WZR  JDOORQZDWHUWDQNV7KHZDWHUWDQNVZLOOEHRZQHGDQGPDLQWDLQHGE\WKH+2$ $FFRUGLQJWRWKHZDWHUWDQNSODQQLQJVWXG\PHPRUDQGXPSUHSDUHGE\*+' 'HFHPEHU  WKHH[LVWLQJZHOOVSURGXFHDSSUR[LPDWHO\JDOORQVSHUGD\DQGDUHORFDWHGDGMDFHQWWRWKH  SURSRVHGWDQN$VDUHVXOWWKHGHYHORSHUSURSRVHVWRVXSSO\WKHWDQNVZLWKZDWHUIURPWKHZHOOVUDWKHU WKDQFRQVWUXFWLQJQHZERRVWHUSXPSVWDWLRQVWRSXPSZDWHUXSWRWKHWDQNVIURPWKH&LW\¶VH[LVWLQJ ZHOOV$VQRWHGLQWKH*+'PHPRUDQGXPWKHSRWHQWLDOGHYHORSPHQWLQWKLVDUHDFRXOGEHVHUYHGZLWK DGHTXDWHSUHVVXUHE\DWDQNDWWKHSURSRVHGORFDWLRQ$FFRUGLQJO\LPSDFWVZRXOGEHOHVVWKDQ VLJQLILFDQW  F  /HVV WKDQ VLJQLILFDQW LPSDFW:DVWHZDWHU IURP WKH SURSHUWLHV ZLOO EH WUHDWHG DW WKH &LW\¶V :DVWHZDWHU7UHDWPHQW3ODQW ::73 WKURXJKDQHZHIIOXHQWOLQHWKDWZLOOEHFRQVWUXFWHGLQH[LVWLQJ URDGZD\V7KH::73ZDVXSJUDGHGLQ7KLVXSJUDGHLQFOXGHGWKHDGGLWLRQRIHTXLYDOHQW VDQLWDU\VHZHUXQLWV (668V 7KLVSURMHFWKDVVHYHQEXLOGLQJVLWHVWKDWFRXOGKDYHVHYHQDGGLWLRQDO $FFHVVRU\'ZHOOLQJ8QLWV $'8V 7KH3URMHFWZRXOGXVHDFRPPXQLW\VHSWLFWDQNZKLFKZRXOGKDYH WREHSXPSHGDVQHHGHGDQGVOXGJHZRXOGEHGLVSRVHGRIDWWKH::73:LWKWKLVGHVLJQGLVFKDUJHV WKURXJKWKHVHZHUOLQHZRXOGKDYHOHVV%LRFKHPLFDO2[\JHQ'HPDQG %2' DQG7RWDO'LVVROYHG 6ROLGV 7'6 WKDQIURPRWKHUUHVLGHQWLDOGHYHORSPHQWV7KLVSURMHFWLVDQWLFLSDWHGWRXVH(668V 7KH::73FXUUHQWO\KDVDYDLODEOHEHWZHHQWKH&LW\RI8NLDKDQGWKH8NLDK9DOOH\6DQLWDWLRQ'LVWULFW 896' (668V7KH::73KDVFDSDFLW\WRVHUYHWKLVGHYHORSPHQWDQGLPSDFWVZRXOGEH OHVVWKDQVLJQLILFDQW  GH /HVVWKDQVLJQLILFDQWLPSDFW$VLJQLILFDQWDPRXQWRIVROLGZDVWHLVQRWDQWLFLSDWHGWREH JHQHUDWHGIURPWKH3URMHFWDQGDOOVROLGZDVWHZRXOGEHGLVSRVHGRILQDFFRUGDQFHZLWKDOOIHGHUDO VWDWHDQGORFDOVWDWXWHVDQGUHJXODWLRQVUHODWHGWRVROLGZDVWHLQFOXGLQJVWDWHDQGORFDOZDVWHGLYHUVLRQ UHTXLUHPHQWV6ROLGZDVWHFROOHFWHGIURPFRQVWUXFWLRQDQGIXWXUHGHYHORSPHQWZLOOEHGHOLYHUHGWRWKH 8NLDK7UDQVIHU6WDWLRQZKLFKLVRZQHGE\WKH&LW\RI8NLDKDQGRSHUDWHGE\6ROLG:DVWHV6\VWHPV ,QFDQGDQ\PDWHULDOVQRWUHF\FOHGZLOOEHH[SRUWHGIRUGLVSRVDOWRWKH3RWUHUR+LOOV/DQGILOOLQ6RODQR &RXQW\%DVHGRQLQIRUPDWLRQSURYLGHGRQ&DO5HF\FOH¶VZHEVLWHWKH3RWUHUR+LOOV/DQGILOOKDVD PD[LPXPSHUPLWWHGWKURXJKSXWRIWRQVSHUGD\DQGDUHPDLQLQJFDSDFLW\RIPLOOLRQFXELF \DUGVDQGLVHVWLPDWHGWRUHPDLQLQRSHUDWLRQXQWLO)HEUXDU\$VVXFKWKHSURSRVHGZRXOGQRW QHJDWLYHO\LPSDFWWKHSURYLVLRQRIVROLGZDVWHVHUYLFHVRULPSDLUWKHDWWDLQPHQWRIVROLGZDVWHUHGXFWLRQ JRDOV$OHVVWKDQVLJQLILFDQWLPSDFWZRXOGRFFXU $OOGHYHORSPHQWZRXOGEHUHTXLUHGWRFRPSO\ZLWKDOOUHJXODWLRQVSHUWDLQLQJWRZDVWHZDWHUVROLGZDVWH DQGRWKHUVHUYLFHV\VWHPV  Page 388 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  0LWLJDWLRQ0HDVXUHV  ,PSOHPHQWDWLRQRI%,2WKURXJK%,2DQG*(2   :LOGILUH :,/'),5(,IORFDWHGLQRUQHDUVWDWHUHVSRQVLELOLW\DUHDVRU ODQGVFODVVLILHGDVYHU\KLJKILUHKD]DUGVHYHULW\]RQHVZRXOG WKHSURMHFW 3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 6XEVWDQWLDOO\LPSDLUDQDGRSWHGHPHUJHQF\UHVSRQVHSODQRU HPHUJHQF\HYDFXDWLRQSODQ"  E 'XHWRVORSHSUHYDLOLQJZLQGVDQGRWKHUIDFWRUVH[DFHUEDWH ZLOGILUHULVNVDQGWKHUHE\H[SRVHSURMHFWRFFXSDQWVWRSROOXWDQW FRQFHQWUDWLRQVIURPDZLOGILUHRUWKHXQFRQWUROOHGVSUHDGRID ZLOGILUH"  F  5HTXLUH WKH LQVWDOODWLRQ RU PDLQWHQDQFH RI DVVRFLDWHG LQIUDVWUXFWXUH VXFK DV URDGV IXHO EUHDNV HPHUJHQF\ ZDWHU VRXUFHVSRZHUOLQHVRURWKHUXWLOLWLHV WKDWPD\H[DFHUEDWHILUH ULVNRUWKDWPD\UHVXOWLQWHPSRUDU\RURQJRLQJLPSDFWVWRWKH HQYLURQPHQW"  G ([SRVHSHRSOHRUVWUXFWXUHVWRVLJQLILFDQWULVNVLQFOXGLQJ GRZQVORSHRUGRZQVWUHDPIORRGLQJRUODQGVOLGHVDVDUHVXOWRI UXQRIISRVWILUHVORSHLQVWDELOLW\RUGUDLQDJHFKDQJHV"   6LJQLILFDQFH&ULWHULD,PSDFWVWRZLOGILUHZRXOGEHVLJQLILFDQWLIWKH3URMHFWZHUHORFDWHGLQRUQHDUD 6WDWH 5HVSRQVLELOLW\ $UHD 65$  RU ODQGV FODVVLILHG DV YHU\ KLJKILUH KD]DUG VHYHULW\ ]RQHV DQG VXEVWDQWLDOO\LPSDLUHGDQHPHUJHQF\UHVSRQVHSODQH[SRVHG3URMHFWRFFXSDQWVWRZLOGILUHSROOXWDQWV RUXQFRQWUROOHGVSUHDGRIZLOGILUHGXHWRVLWHFRQGLWLRQVVXFKDVVORSHDQGSUHYDLOLQJZLQGVUHTXLUH WKHLQVWDOODWLRQRUPDLQWHQDQFHRILQIUDVWUXFWXUHWKDWFRXOGH[DFHUEDWHILUHULVNRUH[SRVHSHRSOHRU VWUXFWXUHVWRVLJQLILFDQWULVNVDVDUHVXOWRISRVWILUHUXQRIIVORSHLQVWDELOLW\RUGUDLQDJHFKDQJHV  (QYLURQPHQWDO6HWWLQJ1RQHRIWKHODQGVZLWKLQWKH&LW\RI8NLDKDUHORFDWHGZLWKLQD&DOLIRUQLD 'HSDUWPHQW RI )RUHVWU\ &DO)LUH  6WDWH 5HVSRQVLELOLW\ $UHD 65$  +RZHYHU &RXQW\ ODQGV LPPHGLDWHO\ZHVWRIWKH&LW\ LQFOXGLQJWKHPDMRULW\RIWKH3URMHFWVLWH V DUHORFDWHGZLWKLQWKH65$ DQGDUHFODVVLILHGDVKDYLQJD³9HU\+LJK´ILUHKD]DUGVHYHULW\$OWKRXJKQRWORFDWHGZLWKLQDQ65$ WKH&LW\RI8NLDK 8&&† KDVDGRSWHGWKH65$UHJXODWLRQVIRUODQGVZLWKLQWKH&LW\OLPLWVORFDWHG LQ+LJKRU9HU\+LJKILUHDUHDV  7KH 3URMHFWVLWH LV GHYHORSHG ZLWK &DO)LUH IXHO EUHDNV DQG KDV EHHQ VXEMHFW WR YHJHWDWLRQ PDQDJHPHQWSUDFWLFHVLQRUGHUWRUHGXFHILUHULVNLQWKH:HVWHUQ+LOOV$VKDGHGIXHOEUHDNZDV FRQVWUXFWHG 1RUWKWR6RXWK DORQJWKHEDVHRIWKHZHVWHUQKLOOVDORQJWKHHQWLUHOHQJWKRIWKH&LW\WR UHGXFHIXHOORDGVDQGSURWHFWWKHFRPPXQLW\IURPZLOGILUHULVNLQ0DLQWHQDQFHZDVSHUIRUPHG RQWKHIWZLGHPLOHIXHOEUHDNLQODWHDQGHDUO\ZLWKRQJRLQJDQQXDOPDLQWHQDQFH SHUIRUPHGE\WKHSURSHUW\RZQHUGHYHORSHU  $VGLVFXVVHGLQ6HFWLRQ+D]DUGVDQG+D]DUGRXV0DWHULDOVWKH&RXQW\¶V(23SODQDQG0-+03 DGGUHVVHPHUJHQF\RSHUDWLRQVQDWXUDOGLVDVWHUV LQFOXGLQJZLOGILUH DVZHOODVPLWLJDWLRQVWUDWHJLHV WRUHGXFHSRWHQWLDOULVNV7KH&LW\RI8NLDKDGRSWHGLWV³MXULVGLFWLRQDODQQH[´FKDSWHURIWKH0-+03 Page 389 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  RQ1RYHPEHU+D]DUGVLGHQWLILHGIRUWKH&LW\RI8NLDKLQFOXGHHDUWKTXDNHVZLOGILUHGDP IDLOXUH IORRG DQG SDQGHPLF 7DEOH  RI WKH &LW\¶V MXULVGLFWLRQDO DQQH[ OLVWV HDFK KD]DUG DQG PLWLJDWLRQDFWLRQIRU&LW\RI8NLDK  'LVFXVVLRQ D E  G  /HVV WKDQ VLJQLILFDQWLPSDFW$V GHVFULEHGDERYH WKH3URMHFWDUHD LV GHYHORSHGZLWKIXHOEUHDNVDQGKDVEHHQVXEMHFWWRYHJHWDWLRQPDQDJHPHQWSUDFWLFHVLQRUGHUWR UHGXFHIXHOORDGZLWKLQWKH:HVWHUQ+LOOV7KH3URMHFWVLWHLVGHYHORSHGZLWKDQH[LVWLQJDFFHVVURDG WKDWYDULHVIURPIWWRIWZLGHZLWKWKHPDMRULW\RILWEHLQJDPLQLPXPRIIWZLGH7KHVHFWLRQV WKDWDUHIWZLGHDUHVKRUWLQOHQJWK DSSUR[LPDWHO\IWORQJ DQGKDYHZLGHWXUQRXWVLPPHGLDWHO\ EHIRUHRUDIWHUWKHP%RWKWKH&DOLIRUQLD'HSDUWPHQWRI)RUHVWU\DQG)LUH3URWHFWLRQ &DO)LUH DQGWKH 8NLDK9DOOH\)LUH$XWKRULW\ 89)$ KDYHUHYLHZHGWKH3URMHFWDQGFRQGXFWHGDVLWHYLVLW7KHH[LVWLQJ JUDYHODFFHVVURDGZLOOEHLPSURYHGZLWKDVSKDOWDQGDFXOGHVDFLQDFFRUGDQFHZLWKDOOFXUUHQWILUH DQGVDIHW\FRGHVDSSOLFDEOHWRWKH3URMHFW7KHSURSRVHGLPSURYHPHQWVZRXOGLQFUHDVHWKHOHYHORI ILUHSURWHFWLRQWRWKH3URMHFWDUHD7KH3URMHFWDOVRLQFOXGHVLQVWDOODWLRQRIZDWHUWDQNVDQGILUHK\GUDQWV WRDGGQHZZDWHUVWRUDJHDQGILUHSURWHFWLRQIDFLOLWLHVLQWKH:HVWHUQ+LOOV3HUWKH&DOLIRUQLD)LUH&RGH DSRUWLRQRIWKHZDWHU YDULHVEDVHGRQVL]HDQGQXPEHURIKRPHV ZLOOEHUHTXLUHGWREHDOORWWHGIRU ILUHSURWHFWLRQVHUYLFHVDQGFDQQRWEHXVHGIRUUHVLGHQWLDOXVHWKLVZLOOEHDFFRPSOLVKHGE\DIORDW VZLWFKWKDWZLOOEHLQVWDOOHGLQWKHWDQNV,QDGGLWLRQ3XEOLF5HVRXUFHV&RGH6HFWLRQVDQG FRQWDLQDGGLWLRQDOUHTXLUHPHQWVIRUODQGVZLWKLQ9HU\+LJK)LUH6HYHULW\=RQHVWKDWZRXOGDSSO\WRWKH 3URMHFW7KHVHLQFOXGHEXWDUHQRWOLPLWHGWRWKHIROORZLQJZKLFKDUHGHVLJQHGWRSURYLGHGHIHQVLEOH VSDFHDQGILUHSURWHFWLRQIRUQHZFRQVWUXFWLRQDQGHQVXUHDGHTXDWHHPHUJHQF\DFFHVVLQFUHDVHG SURSHUW\ OLQH VHWEDFNV IRU DOO DSSOLFDEOH FRQVWUXFWLRQ RQVLWH ZDWHU VWRUDJH IRU ILUH SURWHFWLRQ GULYHZD\URDGZD\W\SHVDQGVSHFLILFDWLRQVEDVHGRQGHVLJQDWHGXVDJHDOOZHDWKHUGULYHZD\URDGZD\ VXUIDFHVEHLQJHQJLQHHUHGIRUOEYHKLFOHVPD[LPXPVORSHRIWXUQRXWUHTXLUHPHQWVJDWH UHTXLUHPHQWVDQGVHWEDFNVSDUNLQJVWDQGDUGVIXHOVUHGXFWLRQUHJXODWLRQVHWF$OOIXWXUHUHVLGHQWLDO GHYHORSPHQWZRXOGEHUHYLHZHGE\WKHILUHGHSDUWPHQWDQGEHUHTXLUHGWRDGKHUHWRDOOILUHVDIHW\ VWDQGDUGVLQFOXGLQJWKRVHHWF  7KHUHDUHQRFRPSRQHQWVRIWKH3URMHFWWKDWZRXOGFRQIOLFWZLWKRULPSDLUWKHDGRSWHG0-+03(23 RURWKHUDGRSWHGHPHUJHQF\UHVSRQVHSODQRUHPHUJHQF\HYDOXDWLRQSODQ)RUWKHUHDVRQVVWDWHGWKH 3URMHFWZRXOGQRWH[SRVHSHRSOHRUVWUXFWXUHVWRDVLJQLILFDQWULVNRIORVVLQMXU\RUGHDWKLQYROYLQJ ZLOGODQGILUHVDQGZRXOGQRWLPSDLUHPHUJHQF\DFFHVV,PSDFWVZRXOGEHOHVVWKDQVLJQLILFDQW  & /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG$VGHVFULEHGLQ6HFWLRQ+D]DUGV DQG+D]DUGRXV0DWHULDOVRIWKLV,QLWLDO6WXG\LQVWDOODWLRQRILQIUDVWUXFWXUHDQGFRQVWUXFWLRQRIWKH 3URMHFWPD\LQYROYHWKHXVHRIJDVROLQHSRZHUHGWRROVDQGHTXLSPHQWSRWHQWLDOO\LQWURGXFLQJQHZ WHPSRUDU\VRXUFHVRILJQLWLRQWKDWFRXOGLQFUHDVHILUHULVN+RZHYHULPSOHPHQWDWLRQRI0LWLJDWLRQ 0HDVXUH+$=ZLOOUHGXFHLPSDFWVWROHVVWKDQVLJQLILFDQW/HVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQ LQFRUSRUDWHG  0LWLJDWLRQ0HDVXUHV  ,PSOHPHQWDWLRQRI+$=     Page 390 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK   0DQGDWRU\)LQGLQJVRI6LJQLILFDQFH  0$1'$725<),1',1*62)6,*1,),&$1&(3RWHQWLDOO\ 6LJQLILFDQW ,PSDFW /HVV 7KDQ 6LJQLILFDQW ZLWK 0LWLJDWLRQ /HVV 7KDQ 6LJQLILFDQW ,PSDFW 1R,PSDFW D 'RHVWKHSURMHFWKDYHWKHSRWHQWLDOWRGHJUDGHWKHTXDOLW\RI WKHHQYLURQPHQWVXEVWDQWLDOO\UHGXFHWKHKDELWDWRIDILVKRU ZLOGOLIHVSHFLHVFDXVHDILVKRUZLOGOLIHSRSXODWLRQWRGURSEHORZ VHOIVXVWDLQLQJOHYHOVWKUHDWHQWRHOLPLQDWHDSODQWRUDQLPDO FRPPXQLW\ VXEVWDQWLDOO\ UHGXFH WKH QXPEHU RU UHVWULFW WKH UDQJH RI D UDUH RU HQGDQJHUHG SODQW RU DQLPDO RU HOLPLQDWH LPSRUWDQWH[DPSOHVRIWKHPDMRUSHULRGVRI&DOLIRUQLDKLVWRU\RU SUHKLVWRU\"  E 'RHVWKHSURMHFWKDYHLPSDFWVWKDWDUHLQGLYLGXDOO\OLPLWHG EXW FXPXODWLYHO\ FRQVLGHUDEOH" &XPXODWLYHO\ FRQVLGHUDEOH PHDQVWKDWWKHLQFUHPHQWDOHIIHFWVRIDSURMHFWDUHFRQVLGHUDEOH ZKHQYLHZHGLQFRQQHFWLRQZLWKWKHHIIHFWVRISDVWSURMHFWVWKH HIIHFWVRIRWKHUFXUUHQWSURMHFWVDQGWKHHIIHFWVRISUREDEOH IXWXUHSURMHFWV "  F 'RHVWKHSURMHFWKDYHHQYLURQPHQWDOHIIHFWVZKLFKZLOOFDXVH VXEVWDQWLDODGYHUVHHIIHFWVRQKXPDQEHLQJVHLWKHUGLUHFWO\RU LQGLUHFWO\"  'LVFXVVLRQ D /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG3URMHFWFRPSRQHQWV LQFOXGLQJWKHDFTXLVLWLRQDQQH[DWLRQDQGSUH]RQLQJRISDUFHOVLQDGGLWLRQWRWKH/RW/LQH$GMXVWPHQWV ZRXOGQRWGLUHFWO\UHVXOWLQSK\VLFDOLPSDFWVWRWKHSK\VLFDOHQYLURQPHQW+RZHYHULQIUDVWUXFWXUH LPSURYHPHQWVDQGWKHSRWHQWLDOFRQVWUXFWLRQRIXSWRVHYHQVLQJOHIDPLO\KRPHVDQGVHYHQDVVRFLDWHG $'8VIRUDWRWDORIXQLWVZLWKLQWKHHDVWHUQPRVWDFUHVRIWKH3URMHFWDUHDFRXOGRFFXUXQGHU WKH'HYHORSPHQW$JUHHPHQW+XOO3URSHUWLHVLVFKRRVLQJWRUHTXLUHWKHVLQJOHIDPLO\KRPHVWREH FRQVWUXFWHGWR5+VWDQGDUGVE\LQFOXGLQJWKHPLQWKH'HFODUDWLRQRI&RYHQDQWV&RQGLWLRQVDQG 5HVWULFWLRQV && 5V IRU'HYHORSPHQW3DUFHOV,QDGGLWLRQDOWKRXJKQRWUHTXLUHGWKHPLWLJDWLRQ PHDVXUHVFRQWDLQHGZLWKLQWKH,601'IRUUHVLGHQWLDOGHYHORSPHQWZLOODOVREHLQFOXGHGLQWKH&& 5V 'HYHORSPHQW3DUFHOVZLOOVWLOOEHLQFOXGHGLQWKHDSSOLFDWLRQIRUDQQH[DWLRQDQGSUH]RQHGWR5+ $OWKRXJKUHVLGHQWLDOGHYHORSPHQWLVQRWSURSRVHGDWWKLVWLPHDQGWKH3URMHFWZRXOGQRWJUDQWDQ\ HQWLWOHPHQWVWKLVDQDO\VLVDVVXPHVWKDWWKHGHYHORSPHQWZLOORFFXURQDOO'HYHORSPHQW3DUFHOVERWK XQGHUWKH&RXQW\DQG&LW\¶VMXULVGLFWLRQ$VGHVFULEHGWKURXJKRXWWKH,QLWLDO6WXG\FRQVWUXFWLRQDQG JURXQGGLVWXUELQJDFWLYLWLHVDVVRFLDWHGZLWKWKHVHFRPSRQHQWVFRXOGUHVXOWLQGLUHFWVLJQLILFDQWLPSDFWV WR$LU4XDOLW\%LRORJLFDO5HVRXUFHV&XOWXUDO7ULEDO&XOWXUDO5HVRXUFHV*HRORJ\DQG6RLOV+D]DUGV DQG+D]DUGRXV0DWHULDOV+\GURORJ\DQG:DWHU4XDOLW\1RLVH8WLOLWLHVDQG6HUYLFH6\VWHPVDQG :LOGILUH+RZHYHUPLWLJDWLRQPHDVXUHVLGHQWLILHGZLWKLQWKHDIRUHPHQWLRQHGVHFWLRQVZRXOGUHGXFH LPSDFWVWROHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLQFRUSRUDWHG  E /HVVWKDQVLJQLILFDQWLPSDFWZLWKPLWLJDWLRQLQFRUSRUDWHG&XPXODWLYHLPSDFWVDUHJHQHUDOO\ FRQVLGHUHGLQDQDO\VHVRI$LU4XDOLW\%LRORJLFDO5HVRXUFHV&XOWXUDO5HVRXUFHV1RLVHDQG7UDIILF $VGLVFXVVHGWKURXJKRXWWKH,QLWLDO6WXG\WKH3URSRVHG3URMHFWZRXOGKDYHOHVVWKDQVLJQLILFDQW LPSDFWV RQ WKHVH UHVRXUFHVZLWK LPSOHPHQWDWLRQ RI PLWLJDWLRQ PHDVXUHV GHVFULEHG KHUHLQ$V GLVFXVVHGLQ6HFWLRQ3RSXODWLRQDQG+RXVLQJDVZHOODV6HFWLRQ/DQG8VHDQG3ODQQLQJWKH SRWHQWLDOGHYHORSPHQWRIXSWRXQLWVZRXOGQRWLQGXFHVXEVWDQWLDOXQSODQQHGSRSXODWLRQJURZWKLQ DQ DUHD HLWKHU GLUHFWO\ RU LQGLUHFWO\ ,QGLYLGXDOLPSDFWV IURP WKH3URMHFWZRXOG QRW VLJQLILFDQWO\ FRQWULEXWHWRFXPXODWLYHLPSDFWVLQWKHDUHDDVWKHUHDUHQRNQRZQSDVWSURMHFWVQRUFXUUHQWSURMHFWV Page 391 of 800   8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  ZLWKLQWKHYLFLQLW\RIWKHVLWH+RZHYHUDOOIXWXUHKRXVLQJGHYHORSPHQWZRXOGEHDQDO\]HGRQDSURMHFW OHYHOEDVLVIRUGLUHFWLQGLUHFWDQGFXPXODWLYHLPSDFWVDVQHFHVVDU\0LWLJDWLRQPHDVXUHVLGHQWLILHG ZLWKLQWKH,QLWLDO6WXG\DQG0LWLJDWHG1HJDWLYH'HFODUDWLRQUHODWHGWRJURXQGGLVWXUELQJDFWLYLWLHVDQG FRQVWUXFWLRQIRUURDGDQGXWLOLW\LPSURYHPHQWVDVZHOODVUHVLGHQWLDOGHYHORSPHQWZLOOEHLQFOXGHGLQ WKH 'HYHORSPHQW $JUHHPHQW DQG &RQGLWLRQV RI $SSURYDO WR HQVXUH WKDW WKH\ DUH LPSOHPHQWHG DFFRUGLQJO\%DVHGRQWKHILQGLQJVDQGFRQFOXVLRQVFRQWDLQHGLQWKH,QLWLDO6WXG\FXPXODWLYHLPSDFWV UHODWHGWRWKH3URSRVHG3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLQFRUSRUDWHG  F /HVV WKDQ VLJQLILFDQW LPSDFWZLWK PLWLJDWLRQ LQFRUSRUDWHG%DVHG RQ WKH ILQGLQJV DQG FRQFOXVLRQVFRQWDLQHGLQWKH,QLWLDO6WXG\WKH3URSRVHG3URMHFWZRXOGQRWKDYHHQYLURQPHQWDOHIIHFWV ZKLFKZLOOFDXVHVXEVWDQWLDODGYHUVHHIIHFWVRQKXPDQEHLQJVHLWKHUGLUHFWO\RULQGLUHFWO\,PSDFWV ZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLQFRUSRUDWHG Page 392 of 800     8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  9, 5()(5(1&(6                $OWD$UFKHRORJLFDO&RQVXOWLQJ $OWD $UFKHRORJLFDO6XUYH\5HSRUW $65 &LW\RI8NLDK :HVWHUQ+LOOV$QQH[8NLDK0HQGRFLQR&RXQW\&DOLIRUQLD$31V 0DUFK  &DO)LUH6WDWH5HVSRQVLELOLW\$UHD9LHZHU KWWSZZZILUHFDJRYILUHSUHYHQWLRQIHHVUDYLHZHUBODXQFK &DO)LUH&DOLIRUQLD)LUH+D]DUG6HYHULW\=RQH0DS:HE9LHZHU KWWSHJLVILUHFDJRY)+6= &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ&DOLIRUQLD*HRORJLFDO6XUYH\(DUWKTXDNH)DXOW 0DS8NLDK=RQHVRI5HTXLUHG,QYHVWLJDWLRQ KWWSJPZFRQVHUYDWLRQFDJRY6+3(=5,00DSV8.,$+3') &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ&DOLIRUQLD*HRORJLFDO6XUYH\86/DQGVOLGH ,QYHQWRU\:HE$SSOLFDWLRQ KWWSVXVJVPDSVDUFJLVFRPDSSVZHEDSSYLHZHULQGH[KWPO"LG DHIEF EFG &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ)DUPODQG0DSSLQJ 0RQLWRULQJ3URJUDP &DOLIRUQLD,PSRUWDQW)DUPODQG)LQGHUKWWSVPDSVFRQVHUYDWLRQFDJRY'/53&,)) &DOLIRUQLD'HSDUWPHQWRI)LQDQFH$PHULFDQ&RPPXQLW\6XUYH\ KWWSZZZGRIFDJRY5HSRUWV'HPRJUDSKLFB5HSRUWV$PHULFDQB&RPPXQLW\B6XUYH\ &DOLIRUQLD'HSDUWPHQWRI7R[LF6XEVWDQFH&RQWURO(QYLUR6WRUGDWDEDVH KWWSVZZZHQYLURVWRUGWVFFDJRY &DOLIRUQLD'HSDUWPHQWRI7UDQVSRUWDWLRQ&DOLIRUQLD6WDWH6FHQLF+LJKZD\6\VWHPPDS KWWSVZZZDUFJLVFRPDSSVZHEDSSYLHZHULQGH[KWPO"LG HFEDDIG IFF &DOLIRUQLD*RYHUQRU¶V2IILFHRI3ODQQLQJDQG5HVHDUFK'LVFXVVLRQ'UDIW7HFKQLFDO $GYLVRU\$%DQG7ULEDO&XOWXUDO5HVRXUFHVLQ&(4$0D\ &LW\RI8NLDK*HQHUDO3ODQ/DVWDPHQGHG &LW\RI8NLDK%LF\FOHDQG3HGHVWULDQ0DVWHU3ODQ3UHSDUHGE\$OWD3ODQQLQJ'HVLJQ :7UDQVDQG:DON%LNH0HQGRFLQR$XJXVW &LW\RI8NLDK&RGH/DVWDPHQGHGKWWSVZZZFRGHSXEOLVKLQJFRP&$8NLDK &LW\RI8NLDK+RXVLQJ(OHPHQW8SGDWH$GRSWHG2FWREHUDQG &HUWLILHGE\+&''HFHPEHUKWWSZZZFLW\RIXNLDKFRPSURMHFWVKRXVLQJ HOHPHQWXSGDWH )HGHUDO+LJKZD\$GPLQLVWUDWLRQ5RDGZD\&RQVWUXFWLRQ1RLVH0RGHO )+:$ +(3  Page 393 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  )HGHUDO7UDQVLW$GPLQLVWUDWLRQ7UDQVLW1RLVHDQG9LEUDWLRQ,PSDFW$VVHVVPHQW 0DQXDO)7$5HSRUW1R3UHSDUHGE\-RKQ$9ROSH1DWLRQDO7UDQVSRUWDWLRQ 6\VWHPV&HQWHU6HSWHPEHU KWWSVZZZWUDQVLWGRWJRYVLWHVIWDGRWJRYILOHVGRFVUHVHDUFK LQQRYDWLRQWUDQVLWQRLVHDQGYLEUDWLRQLPSDFWDVVHVVPHQWPDQXDOIWDUHSRUWQR BSGI )HKU 3HHUVRQEHKDOIRIWKH0HQGRFLQR&RXQFLORI*RYHUQPHQWV 0&2* 6HQDWH%LOO 9HKLFOH0LOHV7UDYHOHG5HJLRQDO%DVHOLQH6WXG\0D\ KWWSVZZZPHQGRFLQRFRJRUJYHKLFOHPLOHVWUDYHOHGYPWUHJLRQDOEDVHOLQHVWXG\ FRPSOHWHG *+':DWHU7DQN3ODQQLQJ6WXG\0HPRUDQGXPSUHSDUHGE\*+''HFHPEHU  -DFREV]RRQDQG$VVRFLDWHV,QF%LRORJLFDO$VVHVVPHQWIRU$31V DQG0DUFK  -DFREV]RRQ DQG $VVRFLDWHV ,QF  %LRORJLFDO $VVHVVPHQW $GGHQGXP IRU 5DUH 3ODQW $VVHVVPHQWDQG%RWDQLFDO6XUYH\IRU$31VDQG -XO\  /DQGVOLGH,QYHQWRU\ %HWD &DOLIRUQLD'HSDUWPHQWRI&RQVHUYDWLRQ&DOLIRUQLD*HRORJLFDO 6XUYH\KWWSVPDSVFRQVHUYDWLRQFDJRYFJVOVL 0HQGRFLQR&RXQFLORI*RYHUQPHQWV 0&2* 0HQGRFLQR&RXQW\5HJLRQDO 7UDQVSRUWDWLRQ3ODQ3UHSDUHGE\'DYH\%DWHV&RQVXOWLQJ$GRSWHG)HEUXDU\ KWWSVZZZPHQGRFLQRFRJRUJILOHV573$V$GRSWHGZHEIRUPD WSGI 0HQGRFLQR&RXQW\$LU4XDOLW\0DQDJHPHQW'LVWULFWRIWKH&DOLIRUQLD1RUWK&RDVW$LU %DVLQ3DUWLFXODWH0DWWHU$WWDLQPHQW3ODQ-DQXDU\ KWWSVZZZFRPHQGRFLQRFDXVDTPGSPDWWDLQPHQWKWPO 0HQGRFLQR&RXQW\$LU4XDOLW\0DQDJHPHQW'LVWULFWZHEVLWH KWWSZZZFRPHQGRFLQRFDXVDTPGGLHVHOHQJLQHLQIRUPDWLRQKWPO 0HQGRFLQR&RXQW\$LUSRUW/DQG8VH&RPPLVVLRQ0HQGRFLQR&RXQW\$LUSRUW &RPSUHKHQVLYH/DQG8VH3ODQ5HYLVHG-XQH 0HQGRFLQR&RXQW\)LUH+D]DUG6HYHULW\0DS1RYHPEHU 0HQGRFLQR&RXQW\,PSRUWDQW)DUPODQG0DSXQGDWHG 0HQGRFLQR&RXQW\0XOWL-XULVGLFWLRQDO+D]DUG0LWLJDWLRQ3ODQ 0-+03 $GRSWHG 'HFHPEHU9RO&KDSWHU&LW\RI8NLDK-XULVGLFWLRQDO$QQH[DGRSWHGE\WKH &LW\RI8NLDK1RYHPEHU 0HQGRFLQR&RXQW\2IILFHRI(GXFDWLRQ6FKRROV 'LVWULFWV KWWSVZZZPFRHXVVFKRROVGLVWULFWV 0HQGRFLQR&RXQW\3URSHUW\6HDUFK H75$.L7  KWWSHWUDFNLWFRPHQGRFLQRFDXVHWUDNLW6HDUFKSDUFHODVS[ 0HQGRFLQR&RXQW\:DWHU$JHQF\:DWHU6XSSO\$VVHVVPHQWIRUWKH8NLDK9DOOH\$UHD 3ODQ2FWREHU KWWSVZZZPHQGRFLQRFRXQW\RUJKRPHVKRZSXEOLVKHGGRFXPHQW"LG  Page 394 of 800  8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG/LPLWHG'HYHORSPHQW$JUHHPHQW Final Draft Initial Study and Mitigated Negative Declaration &LW\RI8NLDK  0HQGRFLQR&RXQW\:LOGODQG8UEDQ,QWHUIDFH :8, =RQHV0DSXQGDWHG KWWSVZZZPHQGRFLQRFRXQW\RUJKRPHVKRZGRFXPHQW"LG  0HQGRFLQR&RXQW\*HQHUDO3ODQDGRSWHGLQDQGODVWUHYLVHG KWWSVZZZPHQGRFLQRFRXQW\RUJJRYHUQPHQWSODQQLQJEXLOGLQJ VHUYLFHVSODQVPHQGRFLQRFRXQW\JHQHUDOSODQ 0HQGRFLQR&RXQW\+RXVLQJ(OHPHQW WK&\FOH $XJXVW KWWSVZZZPHQGRFLQRFRXQW\RUJJRYHUQPHQWSODQQLQJEXLOGLQJ VHUYLFHVSODQVKRXVLQJHOHPHQW 0HQGRFLQR&RXQW\3XEOLF*,63RUWDOKWWSVJLVPHQGRFLQRFRXQW\RUJSRUWDOKRPH 0HQGRFLQR&RXQW\,QODQG=RQLQJ&RGH KWWSVZZZPHQGRFLQRFRXQW\RUJJRYHUQPHQWSODQQLQJEXLOGLQJ VHUYLFHVUHJXODWLRQV]RQLQJFRGH 30&%DFNJURXQG5HSRUWIRUWKH&RXQW\RI0HQGRFLQR*HQHUDO3ODQ8SGDWH3UHSDUHG -DQXDU\ 6WDWH:DWHU5HVRXUFHV&RQWURO%RDUG*HR7UDFNHU KWWSVJHRWUDFNHUZDWHUERDUGVFDJRY 2IILFHRI3ODQQLQJDQG5HVHDUFK 235 7HFKQLFDO$GYLVRU\RQ(YDOXDWLQJ7UDQVSRUWDWLRQ ,PSDFWV,Q&(4$'HFHPEHUKWWSVZZZRSUFDJRYGRFV B7HFKQLFDOB$GYLVRU\SGI 86'HSDUWPHQWRI$JULFXOWXUH6RLO&RQVHUYDWLRQ6HUYLFH:HE6RLO6XUYH\ KWWSVZHEVRLOVXUYH\VFHJRYXVGDJRY$SS+RPH3DJHKWP 86'HSDUWPHQWRI)LVKDQG:LOGOLIH(QYLURQPHQWDO&RQVHUYDWLRQ2QOLQH6\VWHP KWWSVHFRVIZVJRYHFSUHSRUWVVSHFLHVOLVWHGE\VWDWHUHSRUW"VWDWH &$ VWDWXV OLVWHG 8NLDK9DOOH\$UHD3ODQDGRSWHG$XJXVW KWWSVZZZPHQGRFLQRFRXQW\RUJJRYHUQPHQWSODQQLQJEXLOGLQJVHUYLFHVSODQVXNLDK YDOOH\DUHDSODQ  Page 395 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah 9,, 0,7,*$7,21021,725,1*$1'5(3257,1*352*5$0 8.,$+:(67(51+,//623(1/$1' /,0,7(''(9(/230(17$*5((0(17352-(&7 3RWHQWLDO,PSDFW0LWLJDWLRQ0HDVXUH,PSOHPHQWDWLRQ 5HVSRQVLELOLW\ 0RQLWRULQJ  5HSRUWLQJ 5HVSRQVLELOLW\ 7LPLQJ'DWH ,PSOHPHQWHG &RQVWUXFWLRQDQG JURXQGGLVWXUELQJ DFWLYLWLHVFRXOG UHVXOWLQVKRUW WHUPLPSDFWVWR DLUTXDOLW\ $4 'LHVHO(QJLQHV±6WDWLRQDU\DQG3RUWDEOH (TXLSPHQWDQG0RELOH9HKLFOHV $Q\VWDWLRQDU\RQVLWHGLHVHO,&HQJLQHV KRUVHSRZHURUJUHDWHU LHODUJHSRZHU JHQHUDWRUVRUSXPSV RUDQ\SURSDQHRUQDWXUDO JDVHQJLQHVKRUVHSRZHURUJUHDWHUPD\ UHTXLUHDSHUPLWIURPWKH'LVWULFW 3RUWDEOHGLHVHOSRZHUHGHTXLSPHQWWKDWPD\ EHXVHGGXULQJWKHSURSRVHGSURMHFWDUH UHTXLUHGWREHUHJLVWHUHGZLWKWKHVWDWH3RUWDEOH (TXLSPHQW5HJLVWUDWLRQ3URJUDP 3(53 RU REWDLQSHUPLWVIURPWKH'LVWULFW 3URMHFWVORFDWHGDGMDFHQWWRVHQVLWLYHUHFHSWRUV VFKRROVFKLOGFDUHIDFLOLWLHVKHDOWKFDUH IDFLOLWLHVVHQLRUIDFLOLWLHVEXVLQHVVHVDQG UHVLGHQFHVHWF GXULQJWKHFRQVWUXFWLRQSKDVH RIWKLVSURMHFWKDYHWKHSRWHQWLDOIRUH[SRVXUHWR GLHVHOSDUWLFXODWH +HDY\GXW\WUXFNLGOLQJDQGRIIURDGGLHVHO HTXLSPHQWRURWKHUGLHVHOHQJLQHLGOLQJLV OLPLWHGWROHVVWKDQPLQXWHV 'HYHORSHU'HYHORSHU 'XULQJ FRQVWUXFWLRQ DQGJURXQG GLVWXUELQJ DFWLYLWLHV $4 *UDGLQJ3URMHFWV'XULQJ&RQVWUXFWLRQ$OO JUDGLQJDFWLYLWLHVPXVWFRPSO\ZLWKWKHIROORZLQJ IXJLWLYHGXVWPLWLJDWLRQPHDVXUHVLQDFFRUGDQFH ZLWK'LVWULFW5HJXODWLRQ5XOH $OOYLVLEO\GU\GLVWXUEHGVRLOURDGVXUIDFHVVKDOO EHZDWHUHGWRPLQLPL]HIXJLWLYHGXVWHPLVVLRQV 'HYHORSHU'HYHORSHU 'XULQJ FRQVWUXFWLRQ DQGJURXQG GLVWXUELQJ DFWLYLWLHV 69 Page 396 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah $OOXQSDYHGVXUIDFHVXQOHVVRWKHUZLVHWUHDWHG ZLWKVXLWDEOHFKHPLFDOVRURLOVVKDOOKDYHD SRVWHGVSHHGOLPLWRIPSK (DUWKRURWKHUPDWHULDOWKDWKDVEHHQ WUDQVSRUWHGE\WUXFNLQJRUHDUWKPRYLQJ HTXLSPHQWHURVLRQE\ZDWHURURWKHUPHDQV RQWRSDYHGVWUHHWVVKDOOEHSURPSWO\UHPRYHG $VSKDOWRLOZDWHURUVXLWDEOHFKHPLFDOVVKDOO EHDSSOLHGRQPDWHULDOVVWRFNSLOHVDQGRWKHU VXUIDFHVWKDWFDQJLYHULVHDLUERUQHGXVWV $OOHDUWKPRYLQJDFWLYLWLHVVKDOOFHDVHZKHQ VXVWDLQHGZLQGVH[FHHGPSK 7KHRSHUDWRUVKDOOWDNHUHDVRQDEOHSUHFDXWLRQV WRSUHYHQWWKHHQWU\RIXQDXWKRUL]HGYHKLFOHV RQWRWKHVLWHGXULQJQRQZRUNKRXUV 7KHRSHUDWRUVKDOONHHSDGDLO\ORJRIDFWLYLWLHV WRFRQWUROIXJLWLYHGXVW  )RUSURMHFWVJUHDWHUWKDQRQHDFUHRURQHPLOH RIURDGQRWORFDWHGZLWKLQD1DWXUDOO\2FFXUULQJ $VEHVWRV$UHDSULRUWRVWDUWLQJDQ\ FRQVWUXFWLRQWKHDSSOLFDQWLVUHTXLUHGWR 6XEPLWD/DUJH$UHD*UDGLQJSHUPLW DSSOLFDWLRQWRWKH'LVWULFW 2EWDLQDILQDOGHWHUPLQDWLRQIURPWKH$LU 4XDOLW\0DQDJHPHQW'LVWULFWDVWRWKHQHHG IRUDQ$VEHVWRV'XVW0LWLJDWLRQ3ODQDQGRU *HRORJLF6XUYH\WRFRPSO\ZLWK&&5 VHFWLRQVDQGUHODWLQJWR 1DWXUDOO\2FFXUULQJ$VEHVWRV 2EWDLQZULWWHQYHULILFDWLRQIURPWKH'LVWULFW VWDWLQJWKDWWKHSURMHFWLVLQFRPSOLDQFHZLWK 6WDWHDQG/RFDOUHJXODWLRQVUHODWLQJWR 1DWXUDOO\2FFXUULQJ$VEHVWRV ,IWKHSURMHFWLVORFDWHGZLWKLQD1DWXUDOO\ 2FFXUULQJ$VEHVWRV$UHDDGGLWLRQDO PLWLJDWLRQVVKDOOEHUHTXLUHG 70 Page 397 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah $4 3URSHUW\'HYHORSPHQW3ULRUWRVWDUWLQJDQ\ FRQVWUXFWLRQWKHDSSOLFDQWLVUHTXLUHGWR D2EWDLQD3URSHUW\'HYHORSPHQW3HUPLWIURP WKH'LVWULFWIRUDQ\RSHQRXWGRRUEXUQLQJ E2EWDLQD*UDGLQJ3HUPLWLIDSSOLFDEOH F&RQILUPZKHWKHUWKHSURMHFWLVLQD1DWXUDOO\ 2FFXUULQJ$VEHVWRV$UHDDQGIROORZDGGLWLRQDO 0&$40'UHFRPPHQGDWLRQVLIDSSOLFDEOH G&RQVLGHUDOWHUQDWHPHDQVRIGLVSRVDORWKHU WKDQRSHQEXUQLQJVXFKDVFXWWLQJWKHPDMRULW\ RIWKHODUJHUPDWHULDOXSDVILUHZRRGDQG FKLSSLQJVPDOOHUPDWHULDOLIIHDVLEOHWRPLWLJDWH LPSDFWVIURPRSHQRXWGRRUEXUQLQJ H2EWDLQZULWWHQYHULILFDWLRQIURPWKH0&$40' VWDWLQJWKDWWKHSURMHFWLVLQFRPSOLDQFHZLWK 6WDWHDQG/RFDOUHJXODWLRQV 'HYHORSHU'HYHORSHU3ULRUWR FRQVWUXFWLRQ %LRORJLFDO5HVRXUFHV &RQVWUXFWLRQ DQGJURXQG GLVWXUELQJ DFWLYLWLHVFRXOG UHVXOWLQ LPSDFWVWR VHQVLWLYHSODQW VSHFLHVDQG VHQVLWLYH ZRRGODQGWUHH KDELDW %,26HQVLWLYH7UHHV,IWUHHVDUHSURSRVHGIRU UHPRYDO SUHFRQVWUXFWLRQVXUYH\V VKDOO EH FRQGXFWHGE\DTXDOLILHGELRORJLVWWRLGHQWLI\2UHJRQ ZKLWHRDNIRUHVWDQGZRRGODQGDVZHOODV&DOLIRUQLD ED\ IRUHVW DQG ZRRGODQG KDELWDW UHPRYDO RI VHQVLWLYHKDELWDWVKDOOEHFRQGXFWHGLQDFFRUGDQFH ZLWK &DOLIRUQLD 'HSDUWPHQW RI )LVK DQG :LOGOLIH &'): UHJXODWLRQV. 4XDOLILHG %LRORJLVW'HYHORSHU 3ULRUWR JURXQG GLVWXUELQJ DFWLYLWLHV &RQVWUXFWLRQDQG JURXQGGLVWXUELQJ DFWLYLWLHVFRXOG LPSDFW5HGEHOO\ QHZWDQGRWKHU VSHFLDOVWDWXV DPSKLELDQVDQG WKHLUKDELWDW %,26HQVLWLYH$PSKLELDQ6SHFLHV$TXDOLILHG ELRORJLVW VKDOO VXUYH\ WKH DUHD SULRU WR DQ\ JURXQGEUHDNLQJDFWLYLWLHVWRGHWHUPLQHWKHSUHVHQFH RI 5HGEHOO\ QHZW RU RWKHU VHQVLWLYH DPSKLELDQ VSHFLHV DQG LGHQWLI\ DGGLWLRQDO DYRLGDQFH PHDVXUHVLIQHHGHG$TXDOLILHGELRORJLVWVKDOOEH RQVLWH IRU DQ\ GHZDWHULQJ HYHQW WR DGGUHVV WKH SRWHQWLDO IRU WKH SUHVHQFH RI VHQVLWLYH DPSKLELDQ 4XDOLILHG %LRORJLVW'HYHORSHU 3ULRUWR JURXQG GLVWXUELQJ DFWLYLWLHV 71 Page 398 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah VSHFLHV VXFK DV IRRWKLOO \HOORZOHJJHG IURJ 5DQD ER\OLL  &RQVWUXFWLRQ YHJHWDWLRQ UHPRYDODQG JURXQGGLVWXUELQJ DFWLYLWLHVFRXOG LPSDFWQHVWLQJ ELUGVDQGWKHLU KDELWDW %,21HVWLQJ %LUGV3UHFRQVWUXFWLRQ VXUYH\V VKDOOEHFRQGXFWHGSULRUWRDQ\YHJHWDWLRQUHPRYDO RU JURXQG GLVWXUELQJ DFWLYLWLHV RFFXUULQJ EHWZHHQ 0DUFKDQG$XJXVWRIDQ\\HDU$OODFWLYHELUG QHVWVVKDOOQRWEHUHPRYHGUHORFDWHGRURWKHUZLVH GLVWXUEHGIRUDQ\SXUSRVHXQWLODOOIOHGJOLQJVKDYHOHIW WKHQHVW 4XDOLILHG %LRORJLVW'HYHORSHU 3ULRUWR YHJHWDWLRQ UHPRYDORU JURXQG GLVWXUELQJ DFWLYLWLHV EHWZHHQ 0DUFK DQG$XJXVW  &RQVWUXFWLRQDQG JURXQGGLVWXUELQJ DFWLYLWLHVFRXOG LPSDFWVSHFLDO VWDWXVLQVHFWV DQGWKHLUKDELWDW %,2 6SHFLDO6WDWXV ,QVHFWV $ TXDOLILHG ELRORJLVW VKDOO VXUYH\ WKH DUHD SULRU WR DQ\ JURXQGEUHDNLQJDFWLYLWLHVWRGHWHUPLQHWKHSUHVHQFH RI VSHFLDOVWDWXV LQVHFW VSHFLHV DQG LGHQWLI\ DGGLWLRQDO DYRLGDQFH PHDVXUHV LI QHHGHG  ,I D VSHFLDOVWDWXV LQVHFW QHVWV DUH REVHUYHG DFWLYH QHVWVVKDOOQRWEHUHPRYHGUHORFDWHGRURWKHUZLVH GLVWXUEHGXQWLOWKHQHVWEHFRPHVLQDFWLYH 4XDOLILHG %LRORJLVW'HYHORSHU 3ULRUWR JURXQG GLVWXUELQJ DFWLYLWLHV &RQVWUXFWLRQDQG JURXQGGLVWXUELQJ DFWLYLWLHVFRXOG LPSDFWVSHFLDO VWDWXVPDPPDOV DQGWKHLUKDELWDW %,26SHFLDO6WDWXV0DPPDOV3UHFRQVWUXFWLRQ VXUYH\VVKDOOEHFRQGXFWHGSULRUWRDQ\YHJHWDWLRQ UHPRYDORUJURXQGGLVWXUELQJDFWLYLWLHV,IHYLGHQFH RIEDWURRVWVLVREVHUYHG LHEDWJXDQRDPPRQLD RGRU JUHDVH VWDLQHG FDYLWLHV  DURXQG WUHHV RU VWUXFWXUHV SUHFRQVWUXFWLRQ EDW VXUYH\V VKDOO EH FRQGXFWHGE\DTXDOLILHGELRORJLVWIRUDFWLYLWLHVWKDW PD\DIIHFWEDWURRVWLQJKDELWDWDQGGHQVLWHV 4XDOLILHG %LRORJLVW'HYHORSHU 3ULRUWR JURXQG GLVWXUELQJ DFWLYLWLHV &XOWXUDO5HVRXUFHVDQG7ULEDO&XOWXUDO5HVRXUFHV 72 Page 399 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah *URXQG GLVWXUELQJ DFWLYLWLHVKDYH WKHSRWHQWLDOIRU DFFLGHQWDO GLVFRYHU\RI XQNQRZQ XQGLVFRYHUHG FXOWXUDO UHVRXUFHVDQG WULEDOFXOWXUDO UHVRXUFHV &8/8QDQWLFLSDWHG 'LVFRYHU\ ,I SUHYLRXVO\ XQLGHQWLILHG FXOWXUDO KLVWRULF SDOHQWRORJLF RU DUFKHRORJLF UHVRXUFHV DUH HQFRXQWHUHG GXULQJ SURMHFW LPSOHPHQWDWLRQ DOWHULQJ WKH PDWHULDOV DQG WKHLUVWUDWLJUDSKLFFRQWH[WVKDOOEHDYRLGHGDQGZRUN VKDOO KDOW LPPHGLDWHO\ $ TXDOLILHG SURIHVVLRQDO DUFKDHRORJLVW VKDOO EH FRQWDFWHG WR HYDOXDWH WKH UHVRXUFH DQG PHWKRGV QHFHVVDU\ WR SURWHFW LW 3URMHFWSHUVRQQHOVKDOOQRWFROOHFWPRYHRUGLVWXUE FXOWXUDOUHVRXUFHV3UHKLVWRULFUHVRXUFHVLQFOXGHEXW DUHQRWOLPLWHGWRFKHUWRUREVLGLDQIODNHVSURMHFWLOH SRLQWV PRUWDUV SHVWOHV DQG GDUN IULDEOH VRLO FRQWDLQLQJ VKHOO DQG ERQH GLHWDU\ GHEULV KHDW DIIHFWHGURFNRUKXPDQEXULDOV+LVWRULFUHVRXUFHV LQFOXGH VWRQH RU DERGH IRXQGDWLRQV RU ZDOOV VWUXFWXUHVDQGUHPDLQVZLWKVTXDUHQDLOVDQGUHIXVH GHSRVLWVRUERWWOHGXPSVRIWHQORFDWHGLQROGZHOOV RUSULYLHV 4XDOLILHG DUFKDHRORJLVW'HYHORSHU 'XULQJ JURXQG GLVWXUELQJ DFWLYLWLHV *URXQG GLVWXUELQJ DFWLYLWLHVKDYH WKHSRWHQWLDOIRU DFFLGHQWDO GLVFRYHU\RI XQNQRZQ1DWLYH $PHULFDQ UHPDLQV &8/(QFRXQWHULQJ1DWLYH$PHULFDQ5HPDLQV ,IKXPDQUHPDLQVDUH HQFRXQWHUHGGXULQJJURXQG GLVWXUELQJ DFWLYLWLHV DOO ZRUN VKDOO VWRS LQ WKH LPPHGLDWHYLFLQLW\RIWKHGLVFRYHUHGUHPDLQVDQGWKH &RXQW\&RURQHUDQGDTXDOLILHGDUFKDHRORJLVWVKDOO EHQRWLILHGLPPHGLDWHO\VRWKDWDQHYDOXDWLRQFDQEH SHUIRUPHG,IWKHUHPDLQVDUHGHHPHGWREH1DWLYH $PHULFDQ DQG SUHKLVWRULF WKH 1DWLYH $PHULFDQ +HULWDJH &RPPLVVLRQ PXVW EH FRQWDFWHG E\ WKH &RURQHUVRWKDWD³0RVW/LNHO\'HVFHQGDQW´FDQEH GHVLJQDWHGDQGIXUWKHUUHFRPPHQGDWLRQVUHJDUGLQJ WUHDWPHQWRIWKHUHPDLQVZLOOEHSURYLGHG 4XDOLILHG DUFKDHRORJLVW'HYHORSHU 'XULQJ JURXQG GLVWXUELQJ DFWLYLWLHV *HRORJ\DQG6RLOV *URXQG GLVWXUELQJ DFWLYLWLHVFRXOG ,QFRUSRUDWLRQRI0LWLJDWLRQ0HDVXUH&8/4XDOLILHG DUFKDHRORJLVW'HYHORSHU'XULQJ JURXQG 73 Page 400 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah UHVXOWLQLPSDFWV DVVRFLDWHGZLWK HURVLRQWKHORVV RIWRSVRLODQG ODQGVOLGHVLIQRW SURSHUO\ GHVLJQHG GLVWXUELQJ DFWLYLWLHV *(27KH3URMHFWVKDOOFRPSO\ZLWKWKHHURVLRQ DQGGHVLJQVWDQGDUGVRXWOLQHGLQ&KDSWHURIWKH 8NLDK&LW\&RGH3ULRUWRDQ\JURXQGGLVWXUEDQFH HURVLRQ DQG VHGLPHQW FRQWURO SODQV VKDOO EH VXEPLWWHG WR WKH 3XEOLF :RUNV DQG &RPPXQLW\ 'HYHORSPHQW'HSDUWPHQWVIRUUHYLHZDQGDSSURYDO 6DLG SODQV VKDOO SURWHFW DJDLQVW VRLO HURVLRQ DQG UXQRII WKURXJK WKH LPSOHPHQWDWLRQ RI DSSURSULDWH %HVW0DQDJHPHQW3UDFWLFHV %03V 7\SLFDO%03V LQFOXGH WKH SODFHPHQW RI VWUDZ PXOFK VHHGLQJ VWUDZZDWWOHVVLOWIHQFLQJHWF1RVLOWVHGLPHQWRU RWKHU PDWHULDOV VKDOO EH DOORZHG WR IORZ IURP WKH SURMHFWDUHD 'HYHORSHU'HYHORSHU 3ULRUWRDQ\ JURXQG GLVWXUEDQFH DQG WKURXJKRXW FRQVWUXFWLRQ DFWLYLWLHV RQJRLQJDV QHHGHGWR FRQWURO HURVLRQ +D]DUGVDQG+D]DUGRXV0DWHULDOV 3URMHFW FRQVWUXFWLRQ FRXOGUHVXOWLQD KD]DUGWRWKH SXEOLFRUWKH HQYLURQPHQWLI WKHLQFLGHQWDO XVHRISHWUROHXP K\GURFDUERQV IXHORLO LQWRROV XVHGGXULQJ FRQVWUXFWLRQ ZHUHWROHDGWR DFFLGHQWDOOHDNV RUVSLOOVLQRU DURXQGWKHZRUN DUHD +$=7KHGHYHORSHUVKDOOHVWDEOLVKDQG LPSOHPHQWFRQVWUXFWLRQVLWHPDQDJHPHQWSUDFWLFHV WKDWZLOOSUHYHQWWR[LFPDWHULDOVDQGRWKHUGHEULV IURPHQWHULQJWKH&LW\¶VVWRUPGUDLQDJHDQG ZDWHUZD\V\VWHPVLQFOXGLQJ D 7KHUHVKDOOEHQRVWRUDJHRIKD]DUGRXV PDWHULDOVDWWKH3URMHFW6LWH E 7KHGHYHORSHUVKDOOSURYLGHDGHTXDWHPDWHULDOV PDQDJHPHQWLQFOXGLQJFRYHULQJVHFXULQJDQG VHJUHJDWLQJSRWHQWLDOO\WR[LFPDWHULDOV JUHDVH RLOVIXHOVROYHQWVHWF DQG F 7KHGHYHORSHUVKDOOPDLQWDLQVXSSOLHVRQKDQG WRFRQWDLQVSLOOVRIRLODQGDQ\RWKHUKD]DUGRXV PDWHULDOVXVHGRQVLWH 'HYHORSHU'HYHORSHU'XULQJ FRQVWUXFWLRQ &RQVWUXFWLRQRI WKH3URMHFWPD\ LQYROYHWKHXVH +$=6KRXOGSRUWDEOHJDVROLQHSRZHUHG HTXLSPHQWEHXVHGRQVLWHWKHIROORZLQJILUHVDIH SUHFDXWLRQVVKDOOEHWDNHQ'HYHORSHU'HYHORSHU'XULQJ FRQVWUXFWLRQ 74 Page 401 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah RIJDVROLQH SRZHUHGWRROV DQGHTXLSPHQW SRWHQWLDOO\ LQWURGXFLQJQHZ WHPSRUDU\ VRXUFHVRI LJQLWLRQWKDW FRXOGLQFUHDVH ILUHULVN D 6SDUNDUUHVWHUVDUHUHTXLUHGRQDOOSRUWDEOH JDVROLQHSRZHUHGHTXLSPHQW E (TXLSPHQWVKDOOEHPDLQWDLQHGLQJRRGZRUNLQJ FRQGLWLRQZLWKH[KDXVWV\VWHPVDQGVSDUN DUUHVWHUVLQSURSHUZRUNLQJRUGHUDQGIUHHRI FDUERQEXLOGXS F )XHOWKHHTXLSPHQWLQDVDIHSODFHZKHUHVSLOOV FDQEHFRQWDLQHGDQGDILUHH[WLQJXLVKHULV QHDUE\8VHWKHUHFRPPHQGHGJDVRLOPL[WXUH DQGGRQRWWRSRII8VHDIXQQHORUVSRXWIRU SRXULQJ:LSHRIIDQ\VSLOOV G 'RQRWUHIXHOUXQQLQJRUKRWHTXLSPHQW 'LVSHQVHIXHODWOHDVWIHHWIURPVRXUFHVRI LJQLWLRQ H 'RQRWXVHHTXLSPHQWLQDUHDVRIGU\ YHJHWDWLRQ.HHSOHDYHVDQGGU\PDWHULDOV DZD\IURPDKRWPXIIOHU I 1RVPRNLQJRURSHQIODPHDOORZHGQHDU JDVROLQHSRZHUHGHTXLSPHQW +\GURORJ\DQG:DWHU4XDOLW\ *URXQG GLVWXUELQJ DFWLYLWLHVDQG FRQVWUXFWLRQRI WKHSURMHFWZRXOG UHVXOWLQ LPSHUYLRXV VXUIDFHVWKDW FRXOGLPSDFW ZDWHUTXDOLW\ ,PSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUHV*(2DQG +$='HYHORSHU'HYHORSHU 3ULRUWRDQG GXULQJ FRQVWUXFWLRQ RQJRLQJDV QHHGHGWR FRQWURO HURVLRQ 1RLVH *URXQG GLVWXUELQJ DFWLYLWLHVDQG FRQVWUXFWLRQRI WKHSURMHFWZRXOG 12,3ULRU WR EXLOGLQJ SHUPLW RU JUDGLQJ SHUPLW LVVXDQFH WKH GHYHORSHU VKDOO FRPSO\ ZLWK WKH IROORZLQJ 'HYHORSHU'HYHORSHU 3ULRUWR LVVXDQFHRI EXLOGLQJRU JUDGLQJ SHUPLWV 75 Page 402 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah UHVXOWLQ WHPSRUDU\QRLVH LPSDFWV D&RQVWUXFWLRQ FRQWUDFWV VKDOO VSHFLI\ WKDW DOO FRQVWUXFWLRQHTXLSPHQWIL[HGRUPRELOHVKDOOEH HTXLSSHG ZLWK SURSHUO\ RSHUDWLQJ DQG PDLQWDLQHG PXIIOHUV DQG RWKHU VWDWHUHTXLUHG QRLVHDWWHQXDWLRQGHYLFHV E&RQVWUXFWLRQKDXOURXWHVVKDOOEHGHVLJQHGWR DYRLGRUOHVVHQLPSDFWVWRQRLVHVHQVLWLYHXVHV HJ UHVLGHQFHV VFKRROV FRQYDOHVFHQW KRPHV WRWKHH[WHQWIHDVLEOH F'XULQJ FRQVWUXFWLRQ VWDWLRQDU\ FRQVWUXFWLRQ HTXLSPHQW VKDOO EH SODFHG VXFK WKDW HPLWWHG QRLVH LV GLUHFWHG DZD\ IURP VHQVLWLYH QRLVH UHFHLYHUV G3HU WKH &LW\¶V 1RLVH 2UGLQDQFH FRQVWUXFWLRQ VKDOOQRWWDNHSODFHRXWVLGHRIWKHKRXUVRI DPWRSP DQGGXULQJ FRQVWUXFWLRQ 8WLOLWLHVDQG6HUYLFH6\VWHPV &LW\VHZHUZDWHU DQGHOHFWULF XWLOLWLHVZRXOGEH H[WHQGHGWRWKH DUHDZKLFKFRXOG UHVXOWLQSK\VLFDO LPSDFWVWRWKH HQYLURQPHQW ,PSOHPHQWDWLRQRI%,2WKURXJK%,2DQG*(2  6HH%,2 WKURXJK%,2 DQG*(2 6HH%,2 WKURXJK%,2 DQG*(2 6HH%,2 WKURXJK %,2DQG *(2 :LOGILUH &RQVWUXFWLRQRI WKH3URMHFWPD\ LQYROYHWKHXVH RIJDVROLQH SRZHUHG HTXLSPHQWDQG PDFKLQHU\ SRWHQWLDOO\ LQWURGXFLQJQHZ ,PSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUH+$='HYHORSHU'HYHORSHU'XULQJ FRQVWUXFWLRQ 76 Page 403 of 800 Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Final Draft Initial Study and Mitigated Negative Declaration City of Ukiah VRXUFHVRI LJQLWLRQWKDW FRXOGLQFUHDVH ILUHULVN 77 Page 404 of 800 ),1$/'5$)7,601'$77$&+0(176 Page 405 of 800 Existing Site Photographs ATTACHMENT A Existing access road Page 406 of 800 Existing water tank site Page 407 of 800 Existing "house site" on one of the proposed Development Parcels Page 408 of 800 Biological Assessment Report Prepared For: Michelle Irace, Planning Manager Department of Community Development 300 Seminary Avenue, Ukiah, CA 95482 APNs: 001-040-83, 157- 070-01, 157-070-02, and 003-190-01 Prepared by Jacobszoon & Associates, Inc. Alicia Ives Ringstad Senior Wildlife Biologist alicia@jaforestry.com Date: March 11, 2021 Updated: April 8, 2021 ATTACHMENT B Page 409 of 800 Page 1 of 101 Table of Contents Section 1.0: Introduction .................................................................................................................................................................. 2 Section 2.0: Regulations and Descriptions ....................................................................................................................................... 2 2.1 Regulatory Setting ................................................................................................................................................................. 2 2.2 Natural Communities and Sensitive Natural Communities .................................................................................................... 3 2.3 Special-Status Species............................................................................................................................................................ 3 Section 3.0: Field Survey Methodology ........................................................................................................................................... 3 3.1 Assessment Methods .............................................................................................................................................................. 3 3.2 Database and Resource Descriptions ..................................................................................................................................... 4 3.3 Database Resource Assessment ............................................................................................................................................. 5 3.4 Biological Communities ........................................................................................................................................................ 6 3.4.1 Non-sensitive Biological Communities ........................................................................................................................... 7 3.4.2 Sensitive Biological Communities .................................................................................................................................. 7 3.5 Special-status Species ............................................................................................................................................................ 8 Section 4.0: Study Area Setting ....................................................................................................................................................... 9 4.1 Climate and Hydrology .......................................................................................................................................................... 9 4.2 Topography and Soils ............................................................................................................................................................ 9 4.3 Biota and Land Use .............................................................................................................................................................. 10 Section 5.0: Field Survey Results................................................................................................................................................... 10 5.1 Biological Communities ...................................................................................................................................................... 10 5.1.1 Non-sensitive Biological Communities ......................................................................................................................... 15 5.1.2 Sensitive Biological Communities ................................................................................................................................ 16 5.2 Special-status Species .......................................................................................................................................................... 16 5.2.1 Special-status Plant Species ......................................................................................................................................... 16 Section 6.0: Assessment Summary and Recommendations ........................................................................................................... 26 6.1 Biological Communities ...................................................................................................................................................... 26 6.2 Special-status Species .......................................................................................................................................................... 28 6.2.1 Special-status Plant Species ......................................................................................................................................... 28 6.2.2 Special-status Wildlife Species ..................................................................................................................................... 29 6.3 Wildlife Corridors ................................................................................................................................................................ 30 6.4 Critical Habitat ..................................................................................................................................................................... 30 Section 7.0: References .................................................................................................................................................................. 31 Appendix A: Table of Potential for Special-Status Plants and Wildlife within the Study Area ....................................................... 0 Appendix B: List of Species Observed .......................................................................................................................................... 34 Appendix C: Photographs .............................................................................................................................................................. 39 Appendix D: Maps ......................................................................................................................................................................... 63 Appendix E: Supporting Documents ............................................................................................................................................. 64 Page 410 of 800 Page 2 of 101 Section 1.0: Introduction This biological assessment was prepared by Jacobszoon and Associates Inc. for the City of Ukiah for the purpose a lot line adjustment to reconfigure parcels for future single-family residential development on approximately 55 acres. The project site is located just west of Ukiah, CA within Sections 19 and 30, Township 15N, Range 12W, Mount Diablo Base and Meridian, in the Ukiah USGS 7.5-minute quadrangle, APNs: 001-040-83, 157-070-01, 157-070-02, and 003- 190-01 (Appendix D: Map 1, Study Area- Topographic Map). A site visit was conducted on February 5, 2021. A botanical survey was conducted on March 30, 2021. Additional botanical survey results will be amended in once completed. The purpose of this study was to identify and map areas within the parcel that are potential sensitive natural communities and to locate special-status plants and special-status animal habitats to determine if they would be directly or potentially impacted by the proposed project. The Study Area referred to within this report comprises approximately 55 acres and includes existing dirt and gravel roads, fire breaks, water tank pad sites, and areas cleared for potential house sites (Appendix D: Map 2, Study Area-Aerial Map). This report includes the following: •Regulations and Project Description (Section 2) •Field Survey Methodology (Section 3) •Study Area Setting (Section 4) •Field Survey Results (Section 5) •Assessment Summary and Recommendations (Section 6) •Tables of Special-Status Plants and Wildlife within CNDDB nine quads (Appendix A) •List of Species Observed (Appendix B) •Representative Photographs of Study Area (Appendix C) •Supporting Maps (Appendix D) •Supporting Documents (Appendix E) Section 2.0: Regulations and Descriptions 2.1 Regulatory Setting In addition to the requirements of Mendocino County’s permitting process, the project shall comply with Federal, State, and local regulations designed to protect sensitive natural resources. The following natural resources are protected under one or more of several Federal and/or State regulations and should be considered when designing and/or implementing the proposed project within the Study Area: Essential Fish Habitat: protected through changes to the Magnuson-Stevens Fishery Conservation and Management Act to maintain sustainable fisheries in the United States, administered by National Marine Fisheries Service (NMFS): •Includes habitats (rivers, creeks, estuaries) that may support anadromous fish (fish migrating from ocean habitat into freshwater river habitat), as well as commercially and/or ecologically valuable fishes. Page 411 of 800 Page 3 of 101 Streams, Lakes, and Riparian Habitat: protected under the California Fish and Game Code (CFGC), administered by the California Department of Fish and Wildlife (CDFW): •Includes creeks and rivers (bodies where water flows at least periodically or intermittently through a bed or channel having banks and supports fish or other aquatic life), and vegetation adjacent to and associated with (riparian habitat). Waters of the State: protected under the State Water Resources Control Board Waters of the U.S.: protected under the Clean Water Act (CWA), administered by the Environmental Protection Agency (EPA) and U.S. Army Corps of Engineers (Corps): •Includes wetlands, streams, rivers, and other aquatic habitats meeting the guidance issued by the Corps. 2.2 Natural Communities and Sensitive Natural Communities Sensitive Natural Communities: protected under the California Fish and Game Code (CFGC), administered by California Department of Fish and Wildlife (CDFW 2020): •Includes terrestrial vegetation or plant communities that are ranked by NatureServe and considered “threatened” or “endangered” by CDFW, lists of such are included in List of Vegetation Alliances and Associations (CDFW 2020). 2.3 Special-Status Species Special-status Plant and Wildlife Species including Critical Habitat: protected under one or more of the Federal Endangered Species Act (ESA), California Endangered Species Act (CESA), California Environmental Quality Act (CEQA), administered by the U.S. Fish and Wildlife Service (USFWS), and/or CDFW: •Includes plants listed under the ESA and/or CESA, or those plants ranked by the California Native Plant Society (CNPS) as Rank 1, 2, 3 and 4. •Includes wildlife listed under the ESA and/or CESA, and wildlife listed by CDFW as Species of Special Concern, Fully Protected Species, and/or Special status including Invertebrates, Birds of Conservation Concern listed by USFWS, Species of Concern listed by National Marine Fisheries Service (NMFS), Western Bat Working Group (WBWG). Section 3.0: Field Survey Methodology 3.1 Assessment Methods The biological resource assessment is designed to identify sensitive communities within the Study Area and determine the existence or potential occurrence for special-status species. The assessment is also designed to address the potential for cumulative impacts to biological resources that may occur as a result of the project and to make recommendations to reduce or mitigate potential impacts. Page 412 of 800 Page 4 of 101 The biological resource assessment includes the analysis and comparison of existing habitat conditions within the Study Area and the documented range and habitat requirements of sensitive plant and wildlife species described in CDFW’s California Wildlife Habitat Relationships System (CWHR). Jacobszoon & Associates Inc. senior biologist Alicia Ives Ringstad conducted a biological resource assessment of the Study Area on February 5, 2021, consisting of approximately six (6) hours. The Study Area was assessed to document: (1) the on-site plant communities, (2) existing conditions and their ability to provide suitable habitat for any special-status plant or wildlife species, and (3) if sensitive biological communities (e.g. wetlands, vernal pools) are present. Plant species observed during the site assessment were recorded and are listed in Appendix B. Plants listed in Appendix B were identified using The Jepson Manual: Vascular Plants of California 2nd Edition (Baldwin et al. 2012) to the taxonomic level necessary to determine rarity. The names provided in this biological assessment report follow The Jepson Flora Project (JFP 2021). 3.2 Database and Resource Descriptions Prior to conducting field surveys, available reference materials were reviewed, including the United States Department of Agriculture (USDA), Natural Resources Conservation Service (NRCS) Web Soil Survey, the United States Fish and Wildlife Service (USFWS) National Wetlands Inventory (NWI), the Ukiah 7.5'-minute USGS quadrangle topographic map, and the most recent available aerial imagery. The 100-year flood zone was assessed using the Federal Emergency Management Agency’s (FEMA) National Flood Hazard Layer (NFHL) (Appendix D, Map 8: FEMA National Flood Hazard Layer Map). The location of streams and watercourses within the project vicinity were reviewed using datasets from California Streams and the California Department of Forestry and Fire Protection (CAL FIRE). Existing vegetative communities were reviewed using CDFW’s Vegetation Classification and Mapping Program (VegCAMP) data for the potential existence and location of sensitive biological communities including Mendocino Cypress (Hesperocyparis pygmaea) and related vegetation. Where VegCAMP data was not available, existing vegetative communities were reviewed using USDA Forest Service Classification and Assessment with Landsat of Visible Ecological Groupings (CALVEG) data. Databases queried for the occurrence of special-status species include the USFWS Information for Planning and Consultation (IPaC), California Native Plant Society (CNPS) Inventory of Rare and Endangered Plants (online edition, v8-03 0.39), and the California Department of Fish and Wildlife California Natural Diversity Database (CNDDB) Spotted Owl Data Viewer, RareFind and Quick Viewer processed and unprocessed data (online edition, v5.94.01). The CNDDB consists of mapped overlays of all known populations of sensitive plants and wildlife. The database is continually updated with new sensitive species population data. Page 413 of 800 Page 5 of 101 The CNPS database produces a list of sensitive plants that have population occurrences registered within the scoping range. Various habitat characteristics are included with each listed species, including location of the Study Area with regard to the geographic range of sensitive plant species, location(s) of known populations of sensitive plant species as mapped in the CNDDB, soils of the Study Area, elevation, presence/absence of special habitat features (vernal pools, serpentine/volcanic soils, etc.) and plant communities existing within the Study Area. While use of the CNPS inventory does not eliminate the need for an in-season botanical survey, it can, when used in conjunction with other information, provide a very good indication of the suitability of a site as habitat for sensitive plant species. The CNDDB consists of mapped overlays of all known populations of sensitive plants and wildlife (Appendix D, Map 3: CNDDB Vicinity Map). The database is continually updated with new sensitive species population data. California Wildlife Habitat Relationships (CWHR) Predicted Habitat Suitability is a dataset accessed through CNDDB BIOS Commercial/Spotted Owl Viewer that represents areas of suitable habitat within species’ documented ranges. Examination of the CWHR dataset was applied when: 1) the data is available for the species of concern, and 2) when there is a moderate to high potential for an animal to occur on or within 100 feet of the Study Area. CWHR examines whether the areas being examined in the biological assessment is habitat which may support a species of special concern. Habitat suitability ranks of Low (less than 0.34), Medium (0.34-0.66) and High (greater than 0.66) suitability are based on the mean expert opinion suitability value for each habitat type for breeding, foraging, and cover (CDFW 2021). 3.3 Database Resource Assessment A scoping of the CNDDB and CNPS Inventory of Rare and Endangered Plants was performed to identify existing and historical occurrences of special status species and sensitive terrestrial communities within the project vicinity. The scoping extended to twelve quads surrounding and including the Ukiah 7.5-minute USGS Quadrangles and included the Boonville, Cow Mountain, Elledge Peak, Laughlin Range, Orrs Springs, Potter Valley, Purdy’s Gardens, Redwood Valley, and Ukiah 7.5-minute USGS Quadrangles. In addition, a 0.25-mile radius scoping area was completed for the identification of northern spotted owl (Strix occidentalis caurina, NSO) Activity Centers. No spotted owl territories (Activity Centers) are located within the 0.25-mile buffer. Prior to the site visit, the databases listed above were accessed to determine whether sensitive biological communities, special-status species or other sensitive areas were documented within the vicinity of the Study Area (Appendix D: Map 3, CNDDB Vicinity Map). During the site visit, existing habitat conditions were evaluated and used to assess the potential for presence of special-status species. The potential for each special-status species to occur in the Study Area was then evaluated according to the following criteria: •No Potential: Habitat on and adjacent to the Study Area is clearly unsuitable for the species requirements (foraging, breeding, cover, substrate, elevation, hydrology, plant community, site history, disturbance regime). Page 414 of 800 Page 6 of 101 •Unlikely: Few of the habitat components meeting the species requirements are present, and/or the majority of habitat on and adjacent to the Study Area is unsuitable or of very poor quality. The species is not likely to be found on-site. •Moderate Potential: Some of the habitat components meeting the species requirements are present, and/or only some of the habitat on or adjacent to the Study Area is suitable. The species has a moderate probability of being found on-site. •High Potential: All the habitat components meeting the species requirements are present and/or most of the habitat on or adjacent to the Study Area is highly suitable. The species has a high probability of being found on-site. •Present: Species is observed on the site or has been recorded (i.e. CNDDB) on-site recently. A complete list of all special-status species and communities listed in the nine-quad scoping of the CNDDB and CNPS as well as those listed in an official USFWS IPaC search of the project area is included in Appendix A: Scoping Table of Special-Status Species and Communities and Potential to occur within the Study Area, and in supporting documents within Appendix E. 3.4 Biological Communities Biological communities present within the Study Area were classified based on existing plant community descriptions described by Preliminary Descriptions of the Terrestrial Natural Communities of California (Holland 1986), USDA Forest Service Classification and Assessment with Landsat of Visible Ecological Groupings (CALVEG) system, and the Manual of California Vegetation Online Edition (MCV2 Alliances, CNPS 2021b). However, in some cases it may be necessary to identify variants of community types or to describe non-vegetated areas that are not described in the literature. Biological communities were classified as sensitive or non-sensitive as defined by CEQA and other applicable laws and regulations. The currently accepted vegetation classification system for the state that is standardly used by CDFW, CNPS, and other state and federal agencies, organizations, and consultants for survey and planning purposes is the Manual of California Vegetation (MCV; Sawyer, Keeler-Wolf, and Evans 2009). Unlike Holland, this vegetation classification system is based on the standard National Vegetation Classification System (NVCS) and includes alliances (a floristically defined vegetation unit identified by its dominant and/or characteristic species) and associations (the finer level of classification beneath alliance). Although the CNDDB still maintains records of some of the old Holland vegetation types, these types are no longer the accepted standard, and the CDFW Vegetation Classification and Mapping Program (VegCAMP) has published more recent vegetation lists for the state based on a standardized vegetation classification system that is currently being developed for California and which is consistent with the MCV classification system. Global and state rarity rankings have been assigned for various types on the recent VegCAMP lists. Page 415 of 800 Page 7 of 101 3.4.1 Non-sensitive Biological Communities Non-sensitive biological communities are those communities that are not afforded special protection under CEQA, and other Federal, State, and local laws, regulations, and ordinances. These communities may, however, provide suitable habitat for some special-status plant or wildlife species, and are described in Section 5.1. 3.4.2 Sensitive Biological Communities Sensitive biological communities include those that are listed in CNDDB as well as MCV2 alliances or associations with state ranks of S1-S3. Aquatic resources (e.g. watercourses, ponds, wetlands, vernal pools, etc.) are also considered sensitive biological communities and are afforded special protections under CEQA and other Federal, State, and local laws, regulations, and ordinances. Sources for assessing sensitive terrestrial or aquatic natural communities include Preliminary Descriptions of the Terrestrial Natural Communities of California (Holland 1986), List of Vegetation Alliances (CDFW, 2020), A Manual of California Vegetation (CNPS 2021b), California Streams, and USFWS National Wetlands Inventory (NWI). Sensitive Natural Communities CDFW considers any MCV2 alliance or association with a state rank of S1-S3 a sensitive natural community. Global and state rankings are defined below. Global Ranking: •G1-Critically Imperiled: At very high risk of extinction due to extreme rarity (often 5 or fewer populations), very steep declines, or other factors. •G2-Imperiled: At high risk of extinction due to very restricted range, very few populations (often 20 or fewer), steep declines, or other factors. •G3-Vulnerable: At moderate risk of extinction due to a restricted range, relatively few populations (often 80 or fewer), recent and widespread declines, or other factors. •G4-Apparently Secure: Uncommon but not rare; some cause for long-term concern due to declines or other factors. •G5-Secure: Common; widespread and abundant. State Ranking: •S1-Critically Imperiled: Critically imperiled in the state because of extreme rarity (often 5 or fewer populations) or because of factor(s) such as very steep declines making it especially vulnerable to extirpation from the state. •S2-Imperiled: Imperiled in the state because of rarity due to very restricted range, very few populations (often 20 or fewer), steep declines, or other factors making it very vulnerable to extirpation from the state. •S3-Vulnerable: Vulnerable in the state due to a restricted range, relatively few populations (often 80 or fewer), recent and widespread declines, or other factors making it vulnerable to extirpation from the state. •S4-Apparently Secure: Uncommon but not rare in the state; some cause for long-term concern due to declines or other factors. •S5-Secure: Common, widespread, and abundant in the state. Page 416 of 800 Page 8 of 101 Critical Habitat Critical habitat is a term defined by the ESA as a specific geographic area that contains features essential for the conservation of a threatened or endangered species and that may require special management and protection. The ESA requires federal agencies to consult with the USFWS to conserve listed species on their lands and to ensure that any activities or projects they fund, authorize, or carry out will not jeopardize the survival of a threatened or endangered species. Federal agencies must also ensure that their activities or projects do not adversely modify critical habitat to the point that it will no longer aid in the species’ recovery. In many cases, this level of protection is similar to that already provided to species by the ESA jeopardy standard. However, areas that are currently unoccupied by the species, but which are needed for the species’ recovery, are protected by the prohibition against adverse modification of critical habitat. Aquatic Resources Watercourses and other waterbodies were classified using guidance from the California Forest Practice Rules 2020 (FPR). Wetlands are determined using the USFWS National Wetland Inventory (NWI) database and are defined in the 1987 USACE Wetlands Delineation Manual as “Those areas that are inundated or saturated by surface or ground water at a frequency and duration sufficient to support, and that under normal circumstances do support, a prevalence of vegetation typically adapted for life in saturated soil conditions.” Wetlands generally include swamps, marshes, bogs, and similar areas. Wet areas are areas with observed hydrophytic vegetation and/or other hydrologic indicators that suggest the area is influenced by ponding or flooding for a significant amount of time throughout the growing season. Wet areas should be given the same protections as wetlands for the purposes of this assessment until a wetland delineation is conducted to confirm the presence and extent of wetlands. 3.5 Special-status Species Special-status plants (native, vascular and non-vascular) and animals assessed are of limited abundance in California, with known occurrence or distribution in Mendocino County, and were derived from the following lists: •Federal listed or threatened or endangered plants or species of concern (FT, FE, FSC) •California State listed or rare, threatened or endangered plants or species of concern (SR, ST, SE, SP, SSC) •Board of Forestry Sensitive (BFS) •California Department of Fish and Wildlife (CDFW) Status animals: Fully Protected, Species of Special Concern and Watch List (FP, SSC, WL) •California Native Plant Society Rare Plant Rank (CRPR) list 1A species (plants presumed extirpated in California, and either rare or extinct elsewhere) •California Native Plant Society Rare Plant Rank (CRPR) list 1B species (plants rare, threatened or endangered in California and elsewhere) •California Native Plant Society Rare Plant Rank (CRPR) list 2A species (plants presumed extirpated in California but more common elsewhere) •California Native Plant Society Rare Plant Rank (CRPR) list 2B species (plants rare, threatened, or endangered in California but more common elsewhere) •California Native Plant Society Rare Plant Rank (CRPR) list 3 (plants which more information is needed- a review list) Page 417 of 800 Page 9 of 101 •California Native Plant Society Rare Plant Rank (CRPR) list 4 (plants of limited distribution – a watch list) Rare, threatened, and endangered plants are not necessarily limited to those species which have been “listed” by state and federal agencies but should include any species that, based on all available data, is rare, threatened, and/or endangered under the following definitions: A species, subspecies, or variety of plant is “endangered” when the prospects of its survival and reproduction are in immediate jeopardy from one or more causes, including loss of habitat, change in habitat, over-exploitation, predation, competition, or disease. A plant is “threatened” when it is likely to become endangered in the foreseeable future in the absence of protection measures. A plant is “rare” when, although not presently threatened with extinction, the species, subspecies, or variety is found in such small numbers throughout its range that it may be endangered if its habitat continues to deteriorate. The site assessment is intended to identify the presence or absence of suitable habitat for special- status species known to occur within the Study Area. The site visit does not constitute a full season protocol-level survey and is not intended to determine the actual presence or absence of a species. If a special-status species is observed during the site visit, its presence will be recorded and discussed. All plant and wildlife species observed were recorded and are included in Appendix B. Section 4.0: Study Area Setting 4.1 Climate and Hydrology The project site is located west of Ukiah, CA within Sections 19 and 30, Township 15N, Range 12W, Mount Diablo Base and Meridian, in the Ukiah USGS 7.5-minute quadrangle (Appendix D: Map 1, Study Area). The Study Area is located along a ridgetop that divides the Orrs Creek – Russian River watershed (HUC-12, 180101100403). The average annual precipitation is 41 to 63 inches, the average annual air temperature is 55-60 degrees F, and the average frost-free period is 240 to 340 days. 4.2 Topography and Soils The Study Area is located at approximately 840-1,600 feet in elevation and is underlain by two (2) soil mapping units, according to the United States Department of Agriculture, Natural Resources Conservation Service’s Web Soil Survey: Map Unit Symbol 141, Hopland loam, 30 to 50 percent slopes; and Map Unit Symbol 151, Hopland-Wohly loams, 50 to 75 percent slopes (Appendix D: Map 4, Soil Map). A description of the soil series are as follows: Hopland loam, 30 to 50 percent slopes (Map Unit Symbol 141): This map unit is located on mountains and hills. Included in this unit are small areas of Squawrock, Hellman, Witherell and Cummiskey soils. California black oak and Pacific madrone are the main tree species. Among the trees of limited extent are Douglas-fir, Oregon white oak, interior live oak and blue oak. The elevation range is 490 to 2,400 feet. Page 418 of 800 Page 10 of 101 •Hopland loam is moderately deep, well drained soils formed in material weathered from sandstone and shale. Redvine soils are on dissected stream terraces and have slopes of 2 to 30 percent. Hopland-Wohly loams, 50 to 75 percent slopes (Map Unit Symbol 151): This map unit is on hills and mountains. Included in this unit are small areas of Bearwallow, Cassabonne, Hellman and Squawrock soils. The native vegetation is mainly oaks and scattered pockets of Douglas-fir. The elevation range is 500 to 2,500 feet. •Hopland soil is moderately deep, well drained soils formed in material weathered from sandstone and shale. •Wholy soil is moderately deep, well drained soils formed in material weathered from sandstone and shale. 4.3 Biota and Land Use Regionally, the Study Area has historically been used primarily for timber and firewood production, recreation, homesite development, and wildlife habitat (USDA Web Soil Survey, 2021). Section 5 provides a detailed account of the biological communities found on-site, including sensitive and non-sensitive biological communities and additionally the special-status flora and fauna with potential to occur within the Study Area. Section 5.0: Field Survey Results 5.1 Biological Communities The Study Area and immediate surroundings were assessed prior to a site a visit on February 5, 2021 to determine local biological communities present and develop a comprehensive list of all plant and wildlife species that may be present. Natural communities referred to in this report include Holland 1986 descriptions, USFS CALVEG classifications, and the Manual of California Vegetation (MCV2) alliance descriptions. Holland Descriptions: The Study Area is within Cismontane woodland, Valley and foothill grassland and Broadleaved upland forest habitat as best classified by the habitat classification system described by Holland 1986. Descriptions of these habitat types are as follows: •Valley and Foothill Grassland: Introduced, annual Mediterranean grasses and native herbs. On most sites the native bunch grass species, such as needle grass, have been largely or entirely supplanted by introductions. Stands rich in natives usually found on unusual substrates, such as serpentinite or somewhat alkaline soils. •Cismontane Woodland: Trees deciduous, evergreen, or both, with open canopies. Broadleaved trees, especially oaks, dominate, although conifers may be present in or emergent through the canopy. Understories may be open and herbaceous or closed and shrubby. This type occurs on a variety of sites below the conifer forests in Mediterranean California. Page 419 of 800 Page 11 of 101 •Broadleaved Upland Forest: Stands of evergreen or deciduous, broadleaved trees 5 meters or more tall, forming closed canopies. Many, but not all, with very poorly developed understories. Several are seral to montane conifer forests. It includes the "mixed evergreen forest" of the Coast Ranges. USFS CALVEG Classifications: According to USDA Forest Service CALVEG mapping delineation, the regionally dominant vegetation type within the Study Area is comprised of Black oak, Oregon white oak, Pacific Douglas-fir, Douglas-fir-Ponderosa pine, Interior live oak and Interior mixed hardwood (Appendix D: Map 5, CALVEG Classification Map). Descriptions of these vegetation types are as follows: •California Black oak: California Black Oak (Quercus kelloggii) occurs extensively in this zone at elevations up to about 6000 feet (1830 m). It has been mapped abundantly as a dominant hardwood in the Eastern Klamath Mountains and Oregon Mountain Subsections (Mountains Section) and in the Eastern and Central Franciscan and Konocti Flows Subsections (Ranges Section) and scattered 13 among twenty-five other subsections in the three sections. It may develop into relatively pure stands on moderately steep slopes or may associate with Oregon White Oak (Q. garryana var. garryana) and/or Canyon Live Oak (Q. chrysolepis) on drier or harsher sites. These stands are commonly found within or below the Douglas-fir (Pseudotsuga menziesii), Mixed Conifer - Pine and Ponderosa Pine (Pinus ponderosa) types, often as a result of fire or other disturbance, especially in Douglas-fir areas. Black Oak commonly is a major understory hardwood in those conifer types and also typically grows on better soils than those of the Canyon Live Oak-dominant type. Commonly associated shrubs include both upper and lower montane species such as various Manzanitas (Arctostaphylos spp.), shrub Oaks (Quercus spp.), Deerbrush (Ceanothus intergerrimus), Brewer Oak (Q. garryana var. breweri), Wedgeleaf Ceanothus (C. cuneatus), etc. •Pacific Douglas-Fir: Douglas-fir (Pseudotsuga menziesii) is the dominant overstory conifer over a large area in the Mountains, Coast, and Ranges Sections. This alliance has been mapped at various densities in most subsections of this zone at elevations usually below 5600 feet (1708 m). Tanoak (Lithocarpus densiflorus var. densiflorus) is the most common hardwood associate on mesic sites towards the west. Along western edges of the Mountains Section, a scattered overstory of Douglas-fir often exists over a continuous Tanoak understory with occasional Madrones (Arbutus menziesii). Canyon Live Oak (Quercus chrysolepis) becomes an important hardwood associate on steeper or drier slopes and those underlain by shallow soils. Black Oak (Q. kelloggii) may often associate with this conifer but usually is not abundant. In addition, any of the following tree species may be sparsely present in Douglas-fir stands: Redwood (Sequoia sempervirens), Ponderosa Pine (Pinus ponderosa), Incense Cedar (Calocedrus decurrens), White Fir (Abies concolor), Oregon White Oak (Q. garryana) and Bigleaf Maple (Acer macrophyllum), among others. The shrub understory may also be quite diverse and includes a wide range of shrubs and forbs. Page 420 of 800 Page 12 of 101 •Interior Mixed Hardwood: No single species is dominant in the Interior Mixed Hardwood Alliance, a mixture that has been mapped most extensively in the Central Franciscan and Ultrabasic Complex Subsections of the Mountains Section and the Mount St. Helena Flows and Valleys, Coast Franciscan and Marin Hills and Valleys Subsections of the Coast Section. It also occurs with less abundance in thirteen other subsections in all three sections. The mixture in this area includes diverse proportions of Oregon White (Quercus garryana), Canyon Live (Q. chrysolepis) and Blue (Q. douglasii) Oaks, with lesser amounts of California Bay (Umbellifera californica) and Coast Live Oak (Q. agrifolia). Conifer associates are mainly Douglas-fir (Pseudotsuga menziesii) and in western areas, Redwood (Sequoia sempervirens). This alliance has been mapped at elevations generally below about 4000 feet (1220 m). Annual grasses and forbs typically occur in these open sites. •Oregon White Oak: Oregon White Oak (Quercus garryana) is widely distributed from British Columbia to this zone, with outlying scattered populations further east and south to the Sierra Nevada Mountains and southern California. The tree form (Q. g. var. garryana) becomes a local canopy dominant in woodlands of the three sections of this zone across thirty-one subsections, becoming especially prominent in seven of them. Mapped elevations of this type are usually below about 5800 feet (1768 m). Often developing on poor, exposed or droughty soils in inland valleys, foothills or rocky ridges, the Oregon White Oak type also is found in poorly drained areas having occasional standing water or next to stream terraces. On better sites, it is usually out-competed by species such as Douglas-fir (Pseudotsuga menziesii) and California Black Oak (Q. kelloggii), often becoming a minor element in mixed hardwood types. Other associated species include other conifers such as Ponderosa Pine (Pinus ponderosa), Gray Pine (P. sabiniana) and various Oaks (Quercus spp.). Open sites often have a grass understory. •Douglas-fir-Pine: Douglas-fir (Psuedotsuga menziesii) shares canopy dominance with Ponderosa Pine (Pinus ponderosa) at elevations below about 6000 feet (1830 m) in drier sites of the Mountains and Ranges Sections, and more rarely in the eastern sectors of the Coast Section. The type has been mapped within twenty-nine subsections, having greater spatial frequency towards the east and south sections of the zone. Knobcone Pine (P. attenuata) may occasionally be present as a minor component of the conifer overstory. Pacific Madrone (Arbutus menziesii), California Black Oak (Quercus kelloggii), Canyon Live Oak (Q. chrysolepis) and Bigleaf Maple (Acer macrophyllum) are often present in the understory, while Tanoak (Lithocarpus densiflorus var. densiflorus) is usually absent. This type may grade into the Mixed Conifer - Pine type in the Coast Ranges as site conditions become more mesic or disturbance factors less significant in the landscape. It is less prominent in the moister, outermost Klamath Mountains area where it intermixes with Pacific Douglas-fir forests. Page 421 of 800 Page 13 of 101 •Interior Live Oak: The Interior Live Oak (Quercus wislizenii) Alliance occurs mainly in southern areas of the Coast and Mountains Sections as mapped in eight subsections. It is often found to the north and east of the Coast Live Oak (Q. agrifolia) Alliance distribution and topographically above Blue Oak (Q. douglasii) dominated stands towards the east. This type often indicates xeric or rocky sites when associated with other hardwood types and has been mapped at elevations up to about 4400 feet (1342 m). The shrubby form (Q. wislizenii var. frutescens) may also dominate a site, especially in areas of frequent fires. Occasional trees and shrubs such as Douglas-fir (Pseudotsuga menziesii), Gray Pine (Pinus sabiniana), Blue Oak (Q. douglasii), Oregon White Oak (Q. garryana) and Chamise (Adenostoma fasciculatum) may be associated with this pure hardwood alliance. Interior Live Oak is known to hybidize with California Black Oak (Q. kelloggii) and Coast Live Oak (Q. agrifolia), occasionally making field identification more difficult. MCV2 Alliances: Biological communities observed were classified using data collected in the field and the Manual of California Vegetation Online Edition (MCV2 Alliances, CNPS 2020b). Five (5) MCV2 Alliance communities (Appendix D: Map 6: MCV2 Classification Map) were observed on site: •Quercus garryana Forest & Woodland Alliance: Oregon white oak forest and woodland •Pseudotsuga menziesii Forest & Woodland Alliance: Douglas-fir forest and woodland •Quercus kelloggii Forest and Woodland Alliance: California black oak forest and woodland •Umbellularia californica Forest & Woodland Alliance: California bay forest and woodland •Pinus attenuata Forest & Woodland Alliance: Knobcone pine forest and woodland Detailed descriptions of these communities are as follows: Quercus garryana Forest & Woodland Alliance: Oregon white oak forest and woodland: •Characteristics Species: Quercus garryana var. garryana is dominant or co-dominant in the tree canopy with Juniperous occidentalis, Pinus jeffreyi, Pinus ponderosa, Pinus sabiniana, Pseudotsuga menziesii, Quercus chrysolepis, Quercus kelloggii and Umbellularia californica. •Vegetation Layers: Trees < 30 m; canopy is open to continuous. Shrub layer is usually open. Herbaceous layer is open to intermittent and mostly grassy. •Membership Rules: oQuercus garryana > 30% relative cover in the tree canopy; > 25% absolute cover, and lacking an appreciable conifer cover. oQuercus garryana > 30% relative cover in the tree canopy often with other oaks such as Q. kelloggii. •Habitats: Raised stream benches, terraces, slopes. and ridges of all aspects. •State Rarity Rank: S3 •Global Rarity Rank: G4 Page 422 of 800 Page 14 of 101 Pseudotsuga menziesii Forest & Woodland Alliance; Douglas-fir forest and woodland: •Characteristic Species: Pseudotsuga menziesii is dominant or co-dominant with hardwoods in the tree canopy with Abies concolor, Acer macrophyllum, Alnus rhombifolia, Arbutus menziesii, Calocedrus decurrens, Chamaecyparis lawsoniana, Cornus nuttali, Pinus contorta, Pinus lambertianana, Quercus agrifolia., Quercus chrysolepis, Quercus garryana, Quercus kelloggii, and Sequoia sempervirens. •Vegetation Layer: Trees <75m; canopy intermittent to continuous, and it may be two- tiered. Shrubs are infrequent or common. Herbaceous layer is sparse or abundant. •Membership rules: oPseudotsuga menziesii > 50% relative cover in the tree canopy and reproducing successfully, though hardwoods may dominate or co-dominate in the subcanopy and regeneration layer; Abies concolor, Chamaecyparis lawsoniana, Pinus contorta, P. ponderosa, and Sequoia sempervirens <20% relative cover; and Notholithocarpus densiflorus <10% relative cover in the tree canopy. •Habitats: All topographic positions and aspects. Substrates various, including serpentine. •State Rarity Rank: S4 •Global Rarity Rank: G5 Quercus kelloggii Forest and Woodland Alliance: California black oak forest and woodland: •Characteristics Species: Quercus kelloggii is dominant or co-dominant in the tree camopy with Abies concolor, Arbutus menziesii, Calocedrus decurrens, Pinus attenuata, Pinus ponderosa, Pseudotsuga menziesii, Quercus agrofolia, Quercus chrysolepis, Quercus garryana, Quercus lobata and Umbellularia californica. •Vegetation Layers: Trees < 40 m; canopy is open to continuous. Shrub layer is open to intermittent. Herbaceous layer is sparse or grassy. •Membership Rules: oQuercus kelloggii > 50% relative cover in overstory, and conifers are not conspicuous; or Q. kelloggii > 30% relative cover in the overstory and Pinus ponderosa may co-dominate. oQuercus kelloggii > 50% relative cover in the tree canopy; emergent conifers <10% relative cover. oQuercus kelloggii and Pinus ponderosa 30-60% relative cover in the overstory. •Habitats: All topographic positions and aspects. Soils are moderately to excessively drained. •State Rarity Rank: S4 •Global Rarity Rank: G4 Pinus attenuata Forest & Woodland Alliance: Knobcone pine forest and woodland: •Characteristic Species: Pinus attenuata is dominant or co-dominant in the tree canopy with Arbutus menziesii, Juniperus occidentalis, Notholithocarpus densiflorus, Pinus contorta, Pinus coulteri, Pinus monticola, Pinus radiata, Pinus sabiniana, Pseudotsuga menziesii, Quercus chrysolepis and Quercus wislizeni. •Vegetation Layers: Trees < 25 m; canopy is open to continuous and one or two tiered. Shrub layer is sparse to continuous. Herbaceous layer is sparse. Page 423 of 800 Page 15 of 101 •Membership Rules oPinus attenuata > 50% relative cover in the tree layer; if co-dominant, > 30% relative cover. •Habitats: Slopes of all aspects, ridges. Soils are derived notably from ultramafic, granitic, sedimentary, and volcanic substrates. •State Rarity S4 •Global Rarity G4 Umbellularia californica Forest & Woodland Alliance: California bay forest and woodland: •Characteristic Species: Umbellularia californica is dominant or co-dominant in the tree or tall shrub canopy with Acer macrophyllum, Aesculus californica, Alnus rhombifolia, Alnus rubra, Arbutus menziesii, Corylus cornuta, Juglans californica, Notholithocarpus densiflorus, Pinus sabiniana, Platanus racemosa, Pseudotsuga menziesii, Quercus agrifolia, Quercus chrysolepis, Quercus wislizeni and Sequoia sempervirens. •Vegetation Layers: Trees < 25 (30) m; canopy is intermittent to continuous. Shrub layer open to intermittent. Herbaceous layer is sparse to abundant. •Membership Rules oConifers < 30% relative cover in canopy, Umbellularia californica > 30% relative cover in the tree canopy. oUmbellularia californica usually > 50% relative cover in the overstory as a tree or tall shrub; when with Alnus rhombifolia or Quercus wislizeni, > 30% relative cover. •Habitats: Alluvial benches, streamsides, valley bottoms, coastal bluffs, inland ridges, steep north-facing slopes, rocky outcrops. Soils are shallow to deep, sandy to clay loams. The USFWS Wetland Inventory (1996 national list) recognizes Umbellularia californica as a FAC plant. •State Rarity: S3 •Global Rarity: G4 5.1.1 Non-sensitive Biological Communities Non-sensitive biological communities are those communities that are not afforded special protection under CEQA, and other Federal, State, and local laws, regulations, and ordinances. The Study Area is comprised of three (3) non-sensitive biological communities, as classified under the MCV2 system: Pseudotsuga menziesii Forest & Woodland Alliance: Douglas-fir forest and woodland CDFW State Rarity Rank: S4 (Apparently Secure) Quercus kelloggii Forest and Woodland Alliance: California black oak forest and woodland CDFW State Rarity Rank: S4 (Apparently Secure) Pinus attenuata Forest & Woodland Alliance: Knobcone pine forest and woodland CDFW State Rarity Rank: S4 (Apparently Secure) Descriptions of these communities are listed above in section 5.1, Biological Communities, and include the Manual of California Vegetation (MCV2) alliance descriptions. Page 424 of 800 Page 16 of 101 5.1.2 Sensitive Biological Communities Sensitive biological communities include those that are listed in CNDDB as well as observed MCV2 alliances or associations with state ranks of S1-S3 and are listed on CDFW’s List of California Sensitive Natural Communities (CDFW 2020). The Study Area is comprised of two (2) non-sensitive biological communities, as classified under the MCV2 system: Quercus garryana Forest & Woodland Alliance: Oregon white oak forest and woodland CDFW State Rarity Rank: S3 (Vulnerable). Umbellularia californica Forest & Woodland Alliance: California bay forest and woodland CDFW State Rarity Rank: S3 (Vulnerable). Recommendations to avoid or mitigate potential impacts to sensitive natural communities are discussed in Section 6.0, Assessment Summary and Recommendations. Sensitive Aquatic Resources: The Study Area contains two (2) Class II watercourses and four (4) Class III watercourses that were observed and mapped on-site. Recommendations to avoid or mitigate potential impacts to aquatic resources are discussed in Section 6.0, Assessment Summary and Recommendations. 5.2 Special-status Species 5.2.1 Special-status Plant Species Upon review of the resource databases (Appendix E: listed in Section 3.2, forty-six (46) special- status plant species have been documented within the vicinity of the Study Area. Please refer to Appendix A for a table of all special-status plant species which occur within a nine-quad search surrounding the Study Area and additional discussion of the potential for each species to occur within the Study Area. Special-status species documented within five miles of the Study Area are depicted in the CNDDB Vicinity map (Appendix D: Map 3, CNDDB Vicinity Map). Of the forty-six (46) special-status plant species within the vicinity of the Study Area, seventeen (17) special-status plant species have a moderate to high potential to occur within the Study Area. The remaining twenty-nine (29) special-status plant species documented within the vicinity of the Study Area are unlikely to occur or do not have the potential to occur due to one or more of the following reasons: •Hydrologic conditions (e.g., vernal pools, riverine) necessary to support the special-status plant species are not present within the Study Area. •Edaphic conditions (soils, e.g., rocky outcrops, serpentinite) necessary to support the special-status plant species are not present within the Study Area. •Topographic conditions (e.g., montane) necessary to support the special-status plant species are not present within the Study Area. •Unique pH conditions (e.g., alkali scalds, acidic bogs) necessary to support the special- status plant species are not present within the Study Area. Page 425 of 800 Page 17 of 101 •Associated vegetation communities (e.g., interior chaparral, tidal marsh) necessary to support the special-status plant species are not present within the Study Area. •The Study Area is geographically isolated (e.g., outside of required elevations, coastal environment) from the documented range of the special-status plant species. •Ecological conditions (last recorded observations, human-made or natural disturbance) have encroached on species to a point to cause presumed extinction. The habitat requirements for the seventeen (17) special-status plant species with moderate or high potential to occur within the Study Area is described in the table below: SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Plants mountain lady’s-slipper Cypripedium montanum Rank 4.2 Lower montane coniferous forest, broadleaved upland forest, cismontane woodland, north coast coniferous forest, often on dry, undisturbed slopes. Elevation ranges from 607 to 7300 feet (185 to 2225 meters). A perennial herb (rhizomatous), the blooming period is from Mar-Aug. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment or during the botanical survey conducted on March 30. There are no recommendations for this species. Koch’s cord moss Entosthodon kochii Rank 1B.3 Cismontane woodland, often growing on soil over riverbanks. Elevation ranges from 607 to 1198 feet (185 to 365 meters). A moss, there is no distinct blooming period. Moderate Potential. Cismontane woodland is present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment and there are no recommendations for this species. stinkbells Fritillaria agrestis Rank 4.2 Cismontane woodland, chaparral, valley and foothill grassland, pinyon and juniper woodland, sometimes on serpentine soil, mostly found in non-native grassland or in grassy openings in clay soil. This species has a serpentine affinity of 2.7 (strong indicator). Elevation ranges from 33 to 5102 feet (10 to 1555 meters). A perennial bulbiferous herb, the blooming period is from Mar-Jun. Moderate Potential. The Study Area contains chapparal habitat that may be suitable for this species. Not Observed. This species was not observed during the biological assessment or during the botanical survey conducted on March 30. There are no recommendations for this species. Roderick’s fritillary Fritillaria roderickii Rank 1B.1 Coastal bluff scrub, coastal prairie, valley and foothill grassland, often on grassy slopes, mesas. Elevation ranges from 66 to 2002 feet (20 to 610 meters). A perennial herb (bulb), the blooming period is from Mar-May. Moderate Potential. Grassland habitat is present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment or during the botanical survey conducted on March 30. There are no recommendations for this species. Page 426 of 800 Page 18 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Mendocino tarplant Hemizonia congesta ssp. calyculata Rank 4.3 Cismontane woodland, valley and foothill grassland, open woods and forests, sometimes on serpentine. H. congesta ssp. calyculata has a serpentine affinity of 1.5 (weak indicator). Elevation ranges from 738 to 4593 feet (225 to 1400 meters). An annual herb, the blooming period is from Jul-Nov. Moderate Potential. Cismontane woodland and grassland habitat are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Jul- Nov). congested- headed hayfield tarplant Hemizonia congesta ssp. congesta Rank 1B.2 Valley and foothill grassland, often in fallow fields, sometimes along roadsides. H. congesta ssp. congesta has a serpentine affinity (1.3, weak indicator/indifferent). Elevation ranges from 17 to 1706 feet (5 to 520 meters). An annual herb, the blooming period is from Apr-Nov. Moderate Potential. Grassland habitat is present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-Nov). Contra Costa goldfields Lasthenia conjugens FE Rank 1B.1 Valley and foothill grassland, vernal pools, alkaline playas, cismontane woodlands, often found in swales and low depressions in open grassy areas. Elevation ranges from 4 to 1477 feet (1 to 450 meters). An annual herb, the blooming period is from Mar-Jun. Moderate Potential. The Study Area contains the required habitat (cismontane woodland and grassland habitat) and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment or during the botanical survey conducted on March 30. There are no recommendations for this species. bristly leptosiphon Leptosiphon acicularis Rank 4.2 Chaparral, cismontane woodland, coastal prairie, valley and foothill grassland. Elevation ranges from 181 to 4922 feet (55 to 1500 meters). An annual herb, the blooming period is from Apr-Jul. Moderate Potential. The Study Area contains the required habitat (cismontane woodland) and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period for this species. It is recommended to survey for this species during the appropriate blooming period (Apr- Jul). Page 427 of 800 Page 19 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS broad-lobed leptosiphon Leptosiphon latisectus Rank 4.3 Broadleaved upland forest, cismontane woodland. L. latisectus has a serpentine affinity of 2.0 (weak indicator). Elevation ranges from 558 to 4922 feet (170 to 1500 meters). An annual herb, the blooming period is from Apr- Jun. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr- Jun). redwood lily Lilium rubescens Rank 4.2 Chaparral, lower montane coniferous forest, broadleaved upland forest, upper montane coniferous forest, north coast coniferous forest, sometimes on serpentine. L. rubescens has a serpentine affinity of 2 (weak indicator). Elevation ranges from 99 to 6267 feet (30 to 1910 meters). A perennial herb (bulb), the blooming period is from Apr- Aug. Moderate Potential. Broadleaved upland forest is present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr- Aug). green monardella Monardella viridis Rank 4.3 Broadleaved upland forest, chaparral, cismontane woodland. Elevation ranges from 328 to 3314 feet (100 to 1010 meters). A perennial herb, the blooming period is from Jun-Sep. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr- Jun). white- flowered rein orchid Piperia candida Rank 1B.2 North Coast coniferous forest, lower montane coniferous forest, broadleaved upland forest, sometimes on serpentine. Often found in forest duff, mossy banks, ultramafic (serpentine) rock outcrops and muskeg. P. candida has a serpentine affinity of 1.2 (weak indicator/indifferent). Elevation ranges from 66 to 5299 feet (20 to 1615 meters). A perennial herb, the blooming period is from May-Sep. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (May-Sep). Page 428 of 800 Page 20 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Mayacamas popcornflower Plagiobothrys lithocaryus Rank 1A Chaparral, cismontane woodland, valley and foothill grassland, moist sites. Elevation ranges from 985 to 1477 feet (300 to 450 meters). An annual herb, the blooming period is from Apr- May. Moderate Potential. Cismontane woodland and grassland habitat are present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-May). beaked tracyina Tracyina rostrata Rank 1B.2 USFS: S Cismontane woodland, valley and foothill grassland, chaparral, often observed in open grassy meadows commonly within oak woodland and grassland habitats. Elevation ranges from 492 to 2609 feet (150 to 795 meters). An annual herb, the blooming period is from May-Jun. Moderate Potential. Cismontane woodland and grassland habitat are present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (May-Jun). showy Indian clover Trifolium amoenum FE Rank 1B.1 Valley and foothill grassland, coastal bluff scrub, sometimes on serpentine soils (ultramafic), open sunny sites, swales, along roadsides and eroding cliff faces. T. amoenum has an ultramafic affinity (1.3, weak indicator, indifferent). Elevation ranges from 17 to 1017 feet (5 to 310 meters). An annual herb, the blooming period is from Apr-Jun. Moderate Potential. Grassland habitat is present within the Study Area and this species is sometimes found in serpentine soil, but not always. The Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr- Jun). Methuselah’s beard lichen Usnea longissima Rank 4.2 North coast coniferous forest, broadleaved upland forest. Often grows in the “redwood zone” on tree branches of a variety of trees, including bigleaf maple (Acer macrophyllum), various oaks (Quercus spp.), ash (Fraxinus spp.), Douglas-fir (Pseudotsuga menziesii) and California bay (Umbellularia californica). Elevation ranges from 148 to 4807 feet (45 to 1465 meters). Moderate Potential. Broadleaved upland forest is present within the Study Area; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. Trees are not proposed for removal; therefore, there are no recommendations for this species. Page 429 of 800 Page 21 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS oval-leaved viburnum Viburnum ellipticum Rank 2B.3 Chaparral, cismontane woodland, lower montane coniferous forest. Elevation ranges from 706 to 4593 feet (215 to 1400 meters). A shrub, the blooming period is from May-Jun. Moderate Potential. Cismontane woodland is present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (May-Jun). No special-status plant species were observed within the Study Area during the Biological Assessment. A complete list of all plant and wildlife species observed within the Study Area was compiled during the site visit on February 5, 2021. A botanical survey was conducted on March 30, 2021. Further botanical surveys will be conducted in May and July of 2021 and results will be amended to this report. 5.2.2 Special-status Animal Species A total of forty-four (44) special-status wildlife species have been documented within the vicinity of the Study Area. Please refer to Appendix A for a table of all special-status wildlife species which occur within the vicinity of the Study Area and discussion of the potential for each species to occur within the Study Area. Special-status species documented within five miles of the Study Area are depicted in the CNDDB Vicinity map (Appendix D: Map 3, CNDDB Vicinity Map). Of the forty-four (44) special-status wildlife species within the vicinity of the Study Area, thirteen (13) special-status wildlife species recorded have a moderate to high potential to occur within the Study Area. The remaining thirty-one (31) special-status wildlife species documented within the vicinity of the Study Area are unlikely to occur or do not have the potential to occur due to one or more of the following reasons: •Aquatic Habitats (e.g., streams, rivers, vernal pools) necessary to support special-status wildlife species are not present within the Study Area. •Vegetation Habitats (e.g., forested area, riparian, grassland) that provide nesting and/or foraging resources necessary to support special-status wildlife species are not present within the Study Area. •Physical Structures and Vegetation (e.g., caves, old-growth trees) that provide nesting, cover, and/or foraging habitat necessary to support special-status wildlife species are not present within the Study Area. •Host Plants (e.g., Cirsium sp.) that provide larval and nectar resources necessary to support special-status wildlife species are not present within the Study Area. •Historic and Contemporary Disturbance (e.g., cattle grazing, agriculture) deter the presence of the special-status wildlife species from occupying the Study Area. Page 430 of 800 Page 22 of 101 •The Study Area is outside the documented nesting range of special-status wildlife species. The thirteen (13) special-status wildlife species with moderate or high potential to occur within the Study Area are described in the table below. SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Amphibians red-bellied newt Taricha rivularis CDFW: SSC IUCN: LC T. rivularis inhabits coastal forests, typically in redwood (Sequoia sempervirens) forest habitat although also found in other forest types (hardwood etc.). Adults are terrestrial and fossorial. Transformed juveniles leave aquatic environments and go into hiding in underground shelters, often until ready to reproduce. Breeding occurs in streams often with relatively strong flows. High Potential. Habitat within the Study Area is ranked High (1.00) in suitability according to the CWHR Predicted Habitat Suitability Map. Aquatic habitat is not present within the Study Area; however, the Study Area may be used for migration and refugia. There is a known occurrence of this species approximately 0.7 miles northwest from the Study Area along Gibson Creek according to CNDDB. Not Observed. This species was not observed during the biological assessment. It is recommended to survey for this species prior to ground disturbance. Avifauna northern goshawk Accipiter gentilis BLM: S CDF: S CDFW: SSC IUCN: LC USFS: S A. gentilis are often found in dense, mature and old growth stands of conifer and deciduous habitats. Younger seral stands that include larger residual or defective trees are also used. Nest often on cooler (northerly or easterly) moderate slopes in dense vegetation or within riparian zones, but close to openings. Nest sites are often located next to water, which may provide a break in canopy for easy access to the nest stand or may influence microclimate or prey distribution. High Potential. Habitat within the Study Area is ranked Medium (0.44) and High (1.00) in suitability according to the CWHR Predicted Habitat Suitability Map. There are no stands of dense, mature and old growth conifer or deciduous forest in the immediate vicinity of the Study Area; however, areas withing the Study Area does contain conifer and deciduous forest stands. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. Page 431 of 800 Page 23 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS golden eagle Aquila chrysaetos BLM: S CDF: S CDFW: FP, WL IUCN: LC USFWS: BCC A. chrysaetos is an uncommon permanent resident in northern California. This species ranges from sea level up to 11,500 feet inhabiting rolling foothills, mountain areas, sage-juniper flats and desert. This species frequently nests in secluded cliffs of all heights with overhanging ledges and in large trees in open areas. High Potential. Habitat within the Study Area is ranked Moderate (0.44) and High (1.00) in suitability according to the CWHR Predicted Habitat Suitability Map. There are no stands of dense, mature and old growth conifer or deciduous forest in the immediate vicinity of the Study Area; however, areas withing the Study Area does contain conifer and deciduous forest stands. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. osprey Pandion haliaetus CDF: S CDFW: WL IUCN: LC P. haliaetus are strictly associated with large, fish- bearing waters, primarily in ponderosa pine and mixed conifer stands. Foraging habitat consists of open, clear waters, rivers, lakes, reservoirs, estuaries, lagoons, swamps, marshes, and bays. Diet consists almost exclusively live fish. Large trees, snags, and blown- out treetops are used for cover and nesting. Nests are located on or near the tops of trees, snags, cliffs, or human-made structures. High Potential. Habitat within the Study Area is ranked Moderate (0.44) and High (0.77) in suitability according to the CWHR Predicted Habitat Suitability Map. There are no stands of dense, mature and old growth conifer or deciduous forest in the immediate vicinity of the Study Area; however, areas withing the Study Area does contain conifer and deciduous forest stands. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. yellow warbler Setophaga petechia CDFW: SSC USFWS: BCC S. petechia often inhabits riparian deciduous habitats in summer: willows, alders, cottonwoods, and other small trees and shrubs typical of low, open canopy riparian woodland. This species will also breed in montane shrubbery in open conifer forest. S. petechia migrates through woodland, forest and shrub habitats. Nests above ground in a deciduous dappling or shrub. Moderate Potential. Habitat within the Study Area is ranked Low (0.22) to Moderate (0.44) in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area contains does contain montane shrubs in open conifer and deciduous forest that may be potential habitat for this species. Not Observed. This species was not observed during the biological assessment. It is recommended that nesting bird surveys be conducted prior to vegetation removal. Page 432 of 800 Page 24 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS northern spotted owl Strix occidentalis caurina FT, ST CDF: S IUCN: NT NABCI: YWL S. occidentalis caurina are year- round residents in dense, structurally complex forests, primarily with old-growth conifers. Nests on snags and within tree cavities, and often is associated with existing structures (old raptor nests, squirrel nests and A. pomo nests). Moderate Potential. The Study Area is approximately 4.3 miles southeast from the closest NSO Activity Center and 4.5 miles northeast from the nearest critical habitat as identified by the USFWS. The Study Area is located within suitable habitat according to the CWHR Predicted Habitat Suitability Map. The Study Area does not contain large conifers for nesting but may provide suitable foraging habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. Trees are not proposed for removal; therefore, there are no recommendations for this species. Insects obscure bumble bee Bombus caliginosus CDFW: SSC IUCN: VU B. caliginosus are often found in coastal areas from Santa Barbara county north to Washington state. Food plant genera includes Baccharis, Cirisum, Lupinus, Lotus, Grindelia, and Phacelia. Moderate Potential. The Study Area contains suitable habitat and food plant genera for this species. Not Observed. This species was not observed during the biological assessment. Brush and grassland are proposed for removal; however, there is adequate potential habitat surrounding the Study Area. There are no recommendations for this species. western bumble bee Bombus occidentalis State: CE USFS: S Xerces: IM B. occidentalis are formerly common throughout much of western North America; however, populations from southern British Columbia to central California have nearly disappeared. They occur in a variety of habitat types and are generalist pollinators. B. occidentalis are commonly encountered along stream banks, meadows, disturbed areas, or on flowers by roadsides. Moderate Potential. The Study Area contains suitable habitat and food plant genera for this species. Not Observed. This species was not observed during the biological assessment. Brush and grassland are proposed for removal; however, there is adequate potential habitat surrounding the Study Area. There are no recommendations for this species. Page 433 of 800 Page 25 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Mammals Sonoma tree vole Arborimus pomo CDFW: SSC IUCN: NT A. pomo lives in humid coastal forests consisting of Douglas-fir, grand fir, western hemlock, and/or Sitka spruce. This species requires Douglas-fir and grand fir needles as a food source and nesting materials. Nests are frequently found in trees along the bole, in branch crotches, or in the top of snags. Nests are most often found along roads, skid trails, or forest edges; however, they could exist further in the forest with dense canopies making nest identification difficult. This species is distributed along the North Coast from Sonoma County north to the Oregon border, being practically restricted to the fog belt. Moderate Potential. Habitat within the Study Area is not suitable in some areas, ranks Low (0.33) withing Montane Hardwood- Conifer habitat and High (1) within Conifer Forest habitat according to the CWHR Predicted Habitat Suitability Map. The Study Area does contain Douglas-fir trees and map provide suitable habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. Trees are not proposed for removal, but if trees were to be removed, it is recommended to survey those trees for this species. North American porcupine Erethizon dorsatum IUCN: LC E. dorsatum are commonly found in coniferous and mixed forested areas, and can also inhabit shrublands, tundra and deserts, albeit less frequently as this species tends to spend much of its time in trees. This species makes its dens in hollow trees, decaying logs and caves in rocky areas. Recognized as primarily solitary and nocturnal, E. dorsatum may be seen foraging during daytime. Moderate Potential. Habitat within the Study Area is ranked Low (0.33) within the Montane Hardwood habitat to Moderate (0.55) within the Hardwood-Montane Conifer habitat in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area may contain suitable habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. It is recommended to survey for this survey prior to ground disturbance. western red bat Lasiurus blossevillii CDFW: SSC IUCN: LC WBWG: H L. blossevillii roosts primarily in trees, often 2-40ft above the ground from sea level through mixed conifer forests. Typical habitats include cismontane woodland, lower montane coniferous forest, riparian forests and woodlands. This species prefers habitat edges and mosaics with trees that are protected from above and open below with open areas for foraging. Moderate Potential. Habitat within the Study Area is ranked Moderate (0.66) within the Hardwood- Montane Conifer habitat in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area may contain suitable habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. There are no further recommendations for this species. Page 434 of 800 Page 26 of 101 SPECIES HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS hoary bat Lasiurus cinereus CDFW: SSC IUCN: LC WBWG: M L. cinereus are yearlong residents of Mendocino County. This bat is one of the few bats knows to both migrate south for winter and to hibernate locally. Hoary bat daytime roosts are typically dense foliage of medium to large sized trees. This bat occupies a variety of habitats including dense forest, forest edges, coniferous forests, deserts, and broadleaf forests. Moderate Potential. Habitat within the Study Area is ranked Moderate (0.55) within the Hardwood- Montane Conifer habitat in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area may contain suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. It is recommended to survey for this survey prior to ground disturbance. fisher [West Coast DPS] Pekania pennanti ST CDFW: SSC USFS: S P. pennanti are primarily solitary, except during breeding season (February – April) and they inhabit forest stands with late-successional characteristics including intermediate-to-large tree stages of coniferous forest and deciduous-riparian areas with high percent canopy closure. Den site and prey availability are often associated with these characteristics. P. pennanti use cavities, snags, logs and rocky areas for cover and denning and require large areas of mature, dense forest. Moderate Potential. Habitat within the Study Area is ranked from no suitable habitat (0) to High (1) in suitability according to the CWHR Predicted Habitat Suitability Map and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. Trees present within the Study Area do not exhibit late successional characteristics and none are not proposed for removal for this project. There are no further recommendations for this species. No special status animal species were observed within the Study Area during the biological site assessment. A complete list of all plant and wildlife species observed within the Study Area was compiled during the site visit on February 5, 2021 or March 30, 2021. Section 6.0: Assessment Summary and Recommendations 6.1 Biological Communities The Study Area is comprised predominantly of three (3) non-sensitive biological communities, two (2) sensitive biological communities, as well as several watercourses as determined during on-site biological assessments on February 5, 2021 and March 30, 2021 (Appendix D: Map 5, MCV2 Alliance Classifications). Non-Sensitive Communities: Under the MCV2 alliance classification system, site visits on February 5, 2021 and March 30, 2021 determined that non-sensitive communities within the Study Area are best classified as Pseudotsuga menziesii Forest & Woodland Alliance: Douglas-fir forest and woodland, Quercus kelloggii Forest and Woodland Alliance: California black oak forest and woodland and Pinus attenuata Forest & Woodland Alliance: Knobcone pine forest and woodland. Detailed descriptions of these biological communities are discussed in section 5.1. There are no recommendations for non-sensitive communities. Page 435 of 800 Page 27 of 101 Sensitive Communities: Sensitive biological communities include those that are listed in CNDDB as well as observed MCV2 alliances or associations with state rarity ranks of S1-S3 and are listed on CDFW’s List of California Sensitive Natural Communities (CDFW 2020). Two (2) sensitive communities, as classified under the MCV2 alliance classification system, exist within the Study Area and were observed on-site. More detailed descriptions of these sensitive communities are discussed in Section 5.1.2. Quercus garryana Forest & Woodland Alliance (Oregon white oak forest and woodland): This community has a Global Rarity Rank of G4 (Apparently Secure) and a State Rarity Rank of S3 (Vulnerable). It is recommended that any proposed work within or in the vicinity of this community avoid the removal of Quercus garryana. This community may also provide habitat for nesting birds protected by the Migratory Bird Treaty Act (MBTA) and it is recommended that nesting bird surveys be conducted for any activities that require vegetation removal between March 1st and August 31st of any year. Other management considerations for the preservation of this community include thinning or removal of conifer species within the stand in accordance with local laws, regulations, and ordinances. Such thinning could limit the possibility of vegetation type conversion to closed-canopy woodlands and conifer forest and inhibit the development of fuel ladders that increase the potential for stand-replacing fires. Any removal of Quercus garryana cannot be done without consultation with CDFW, and all work within this community shall adhere to CDFW recommendations. It is the understanding of Jacobszoon & Associates, Inc. that no tree removal is proposed. Umbellularia californica Forest & Woodland Alliance: California bay forest and woodland: This community has a Global Rarity Rank of G4 (Apparently Secure) and a State Rarity Rank of S3 (Vulnerable). It is recommended that any proposed work within or in the vicinity of this community avoid the removal of Umbellularia californica. This community may also provide habitat for nesting birds protected by the Migratory Bird Treaty Act (MBTA) and it is recommended that nesting bird surveys be conducted for any activities that require vegetation removal between March 1st and August 31st of any year. Other management considerations for the preservation of this community include thinning or removal of conifer species within the stand in accordance with local laws, regulations, and ordinances. Such thinning could limit the possibility of vegetation type conversion to closed-canopy woodlands and conifer forest and inhibit the development of fuel ladders that increase the potential for stand-replacing fires. Any removal of Umbellularia californica cannot be done without consultation with CDFW, and all work within this community shall adhere to CDFW recommendations. It is the understanding of Jacobszoon & Associates, Inc. that no tree removal is proposed. Aquatic resources, communities, and habitats (e.g. watercourses, ponds, wetlands, vernal pools, etc.) are considered sensitive biological communities and are afforded special protections under CEQA and other Federal, State, and local laws, regulations, and ordinances. Aquatic habitats present within the Study Area could provide suitable aquatic or riparian habitats for sensitive flora and fauna. Page 436 of 800 Page 28 of 101 Two (2) Class II watercourses and several Class III watercourses within the Study Area. Recommendations for aquatic resources are listed below: •It is recommended that all earthwork adjacent to any watercourse or other body of water adhere to standard methods of erosion and sediment control and, if possible, to complete all work while the channel is dry to reduce sediment load downstream. •It is recommended that a qualified biologist be on site for any dewatering event to address the potential for the presence of sensitive aquatic species such as foothill yellow- legged frog (Rana boylii). •It is recommended that any work within a watercourse or water body with the potential to impact aquatic resources be conducted in compliance with s CDFW’s Lake and Streambed Alteration Agreement. •It is recommended that future expansions or development associated with this project be located outside of the NFHL 100-year flood zone as well as SWRCB setbacks. A Class II watercourse located approximately 225 feet north of the Study Area is mapped on the USFWS National Wetland Inventory (Appendix D: Map 7, NWI mapped wetlands) as a riverine habitat classified as R4SBC. R4SBC is a riverine intermittent system with a streambed and is seasonally flooded. Riverine systems are considered watercourses for the purposes of this assessment. The proposed project will not impact this watercourse. 6.2 Special-status Species Seventeen (17) special-status plant species and thirteen (13) special-status wildlife species have a moderate or high potential to occur within the Study Area based on habitat present. No special status plant or wildlife species were observed within the Study Area during the biological site assessment. 6.2.1 Special-status Plant Species Seventeen (17) special status plant species have a moderate or high potential to occur within the Study Area: mountain lady’s-slipper (Cypripedium montanum), Koch’s cord moss (Entosthodon kochii), stinkbells (Fritillaria agrestis), Roderick’s fritillary (Fritillaria roderickii), Mendocino tarplant (Hemizonia congesta ssp. calyculata), congested-headed hayfield tarplant (Hemizonia congesta ssp. congesta), Contra Costa goldfields (Lasthenia conjugens), bristly leptosiphon (Leptosiphon acicularis), broad-lobed leptosiphon (Leptosiphon latisectus), redwood lily (Lilium rubescens), green monardella (Monardella viridis), white-flowered rein orchid (Piperia candida), Mayacamas popcornflower (Plagiobothrys lithocaryus), beaked tracyina (Tracyina rostrata) showy Indian clover (Trifolium amoenum), Methuselah’s beard lichen (Usnea longissimi) and oval-leaved viburnum (Viburnum ellipticum). Recommendations for special-status plant species are listed below: •It is recommended that a seasonally appropriate botanical survey be conducted for the above listed species prior to any groundbreaking 1 activities. 1 The term “groundbreaking” encompasses vegetation removal, grading, or excavation. Page 437 of 800 Page 29 of 101 No special-status plant species were observed during the biological site assessment. The biological site visit does not constitute a full season protocol-level botanical survey and is not intended to determine the actual presence or absence of a species. A botanical survey shall be conducted between March and July of 2021 and the results will be amended into this report. 6.2.2 Special-status Wildlife Species Thirteen (13) special-status wildlife species have a moderate or high potential to occur within the Study Area. These species include red-bellied newt (Taricha rivularis), northern goshawk (Accipiter gentilis), golden eagle (Aquila chrysaetos), osprey (Pandion haliaetus), yellow warbler (Setophaga petechia), northern spotted owl (Strix occidentalis caurina), obscure bumble bee (Bombus caliginosus), western bumble bee (Bombus occidentalis), pallid bat (Antrozous pallidus), Sonoma tree vole (Arborimus pomo), North American porcupine (Erethizon dorsatum), western red bat (Lasiurus blossevillii), hoary bat (Lasiurus cinereus), and fisher [West Coast DPS] (Pekania pennanti). Amphibians One (1) special-status amphibian has a moderate or high potential to occur within the Study Area; red-bellied newt (Taricha rivularis). Recommendations for this species are listed below: •It is recommended that a qualified biologist survey the area prior to any groundbreaking activities to determine the presence of special-status amphibian species. No special-status amphibian species were observed within the Study Area during the biological site assessment. Avifauna Five (5) special-status avian species have moderate or high potential to occur within the Study Area. These species include northern goshawk (Accipiter gentilis), golden eagle (Aquila chrysaetos), osprey (Pandion haliaetus), yellow warbler (Setophaga petechia), and northern spotted owl (Strix occidentalis caurina). Additionally, most non-game bird species in California are protected under the Migratory Bird Treaty Act (MBTA) which prohibits the deliberate destruction of active nests belonging to protected species. Groundbreaking activities, specifically vegetation removal, within the Study Area during avian breeding periods have the potential to significantly impact nesting migratory bird species. Recommendations for special-status avian species and migratory bird species are listed below: •It is recommended that all active bird nests not be removed, relocated, or otherwise disturbed for any purpose until all fledglings have left the nest. •It is recommended that nesting bird surveys be conducted prior to the commencement of any groundbreaking activities which occur between March 1st and August 31st of any year. No avian special-status species were observed within the Study Area during the biological assessment. Page 438 of 800 Page 30 of 101 Fish The Study Area does not contain any special-status fish species or fish bearing watercourses or waterbodies. The nearest fish-bearing watercourse is a Class II watercourse, located approximately 225 feet north of the Study Area. It is recommended that all earthwork within or adjacent to any watercourse or waterbody adhere to standard methods of erosion and sediment control. Future development within the Study Area does not have the potential to impact special- status fish species. No special-status fish were observed during the biological site assessment. Insects Two (2) special-status insect species have moderate or high potential to occur within the Study Area. These species include the obscure bumble bee (Bombus caliginosus) and western bumble bee (Bombus occidentalis). Recommendations for special-status insect species are listed below: •If a special-status insect nests are observed, it is recommended that active nests not be removed, relocated, or otherwise disturbed until the nest becomes inactive. No special-status insects or nests were observed within the Study Area during the biological site assessment. Mammals Five (5) special-status mammal species have moderate or high potential to occur within the Study Area. These species include the Sonoma tree vole (Arborimus pomo), North American porcupine (Erethizon dorsatum), western red bat (Lasiurus blossevillii), hoary bat (Lasiurus cinereus), and fisher [West Coast DPS] (Pekania pennanti). Recommendations for special-status mammal species are listed below: •If evidence of bat roosts are observed (i.e. bat guano, ammonia odor, grease stained cavities) around trees or structures, it is recommended that pre-construction bat surveys be conducted by a qualified biologist for activities that may affect bat roosting habitat. •If evidence of special-status mammal borrows or denning activity is observed, it is recommended that pre-construction surveys be conducted by a qualified biologist for activities that may affect den sites. No special-status mammals were observed during the biological site assessment. No evidence of special-status mammal species was observed during the biological site visit. 6.3 Wildlife Corridors No change to foraging or wintering habitat for migratory birds is expected as a result of the proposed project. Additionally, no significant impacts to migratory corridors for amphibian, aquatic, avian, mammalian, or reptilian species is expected as a result of the project. 6.4 Critical Habitat The Study Area does not contain and is not adjacent to critical habitat for any Federal or State- listed species (Appendix E: USFWS IPAC Official Species List). Page 439 of 800 Page 31 of 101 Section 7.0: References Baicich, P. J., Harrison, J. O. 2005. Nests, Eggs, and Nestlings of North American Birds (2nd Edition). Princeton University Press. Baldwin, B.G., D.H. Goldman, D.J. Keil, R. Patterson, T.J. Rosatti, and D.H. Wilken (eds.). 2012. The Jepson Manual: Vascular Plants of California, 2nd Edition. University of California Press, Berkeley, CA. Barbour, M., T. Keeler-Wolf, and A. A. Schoenherr (eds.). 2007. Terrestrial Vegetation of California (3rd Edition). University of California Press. Barbour, M. G. and J. Major. Terrestrial Vegetation of California. 1998. The California Native Plant Society. Behler, J. L. and F. W. King. 1979. National Audubon Society Field Guide to North American Reptiles and Amphibians. Alfred A. Knopf, Inc. New York, NY. Best, T. L., Kiser, W. M., Freeman, P. W. 1996. Eumops perotis. American Society of Mammalogists. Mammalian Species 534:1-8. Bjornn, T. C., Reiser, D. 1991. Habitat Requirements of Salmonids in Streams. American Fisheries Society Special Publication. 19. Bourque, R. 2018. Lecture: Spatial Ecology: Movement. Presented at Foothill Yellow-legged Frog: Ecology, Management, and Regulation Workshop. Presented by The Wildlife Society. Humboldt State University, Arcata, CA. California Department of Fish and Wildlife. California Interagency Wildlife Task Group. 2014. CWHR version 9.0 personal computer program. Sacramento, CA. California Department of Fish and Wildlife. 2021. California Natural Diversity Database (CNDDB) Quick Viewer (online edition, v5.94.01). Sacramento, CA. Accessed on February 2, 2021 from: https://www.wildlife.ca.gov/Data/CNDDB/Maps-and- Data#43018410-cnddb-quickview-tool California Department of Fish and Wildlife. 2021. California Natural Diversity Database (CNDDB) BIOS Commercial/Spotted Owl Viewer (online edition, v5.94.01). Sacramento, CA. Accessed on February 2, 2021 from: https://www.wildlife.ca.gov/Data/CNDDB/Maps-and-Data#43018408-cnddb-in-bios California Department of Fish and Wildlife. 2021. California Natural Diversity Database (CNDDB) BIOS Commercial/Spotted Owl Viewer (online edition, v5.94.01) California Wildlife Habitat Relationships (CWHR) 2016. Accessed on February 2, 2021 from: https://www.wildlife.ca.gov/Data/CNDDB/Maps-and-Data#43018408-cnddb-in-bios Page 440 of 800 Page 32 of 101 California Department of Fish and Wildlife. 2021. California Streams v3. Last updated on November 20, 2020. Accessed on February 2, 2021 from https://data.cnra.ca.gov/dataset/california-streams California Department of Fish and Wildlife. 2021. List of Vegetation Alliances and Associations. Vegetation Classification and Mapping Program, California Department of Fish and Game, Sacramento, CA. Updated September 4, 2020. Accessed on February 2, 2021. https://nrm.dfg.ca.gov/FileHandler.ashx?DocumentID=153398&inline California Department of Fish and Wildlife. 2018. Protocols for Surveying and Evaluating Impacts to Special Status Native Plant Populations and Natural Communities. Accessed on February 2, 2021 from: http://nrm.dfg.ca.gov/FileHandler.ashx?DocumentID=18959. California Department of Fish and Wildlife. 2009. Protocols for Surveying and Evaluating Impacts to Special Status Native Plant Populations and Natural Communities. California Department of Fish and Wildlife. September 2003. List of California Terrestrial Natural Communities Recognized by the California Natural Diversity Database. Biogeographic Data Branch, Vegetation Classification and Mapping Program. Sacramento, CA. California Department of Fish and Wildlife. 2000. Guidelines for Assessing the Effects of Proposed Developments on Rare, Threatened and Endangered Plants and Plant Communities. The Resources Agency, California Department of Fish and Game. Sacramento, CA. California Native Plant Society (CNPS). 2021a. Inventory of Rare and Endangered Plants (online edition, v8-03 0.39). California Native Plant Society. Sacramento, CA. Accessed on February 2, 2021 from: http://www.cnps.org/inventory. California Native Plant Society (CNPS). 2021b. A Manual of California Vegetation (online edition). California Native Plant Society. Sacramento, CA. Accessed February 2, 2021 from: http://vegetation.cnps.org/. California Native Plant Society (CNPS). 2001. Botanical Survey Guidelines. California Native Plant Society. Sacramento, CA. California Native Plant Society (CNPS). 1998. Policy on Mitigation Guidelines Regarding Impacts to Rare, Threatened and Endangered Plants. California Native Plant Society. Sacramento, CA. Call, M. W. 1978. Nesting Habits and Survey Techniques for Common Western Raptors. U.S. Department of Interior, Bureau of Land Management, Portland, OR. Technical Note. No. 316. 115pp. Page 441 of 800 Page 33 of 101 CalFlora Database at www.calflora.org/ Accessed for descriptions, and habitat ranges and site suitability of rare, threatened or endangered plants found on CNPS and CNDDB queries. Accessed on February 8, 2021. CalPhoto Database at http://elib.cs.berkeley.edu/photos/flora/, for photos, descriptions, and habitat ranges of rare, threatened or endangered plants found on CNPS and CNDDB queries. Accessed on February 8, 2021. Cogswell, H. L. 1977. Water birds of California. University of California Press, Berkeley. 399pp. Consortium of California Herbaria (CCH). 2012. Data provided by the participants of the Consortium of California Herbaria. Available at: http://ucjeps.berkeley.edu/consortium. Accessed on February 8, 2021. Fellers, G. M., Pierson, E. D. 2002. Habitat Use and Foraging Behavior of Townsend’s Big- Eared Bat (Corynorhinus townsendii) in Coastal California. Journal of Mammalogy. 83, Issue 1: 167-177. Available online at: https://academic.oup.com/jmammal/article/83/1/167/2372774#38014831 Fiedler, P. L. 1996. Common Wetland Plants of Central California. Army Core of Engineers. Goulsen, D. 2003. Bumblebees: their behavior and ecology. Oxford University Press, Oxford, England. Grinnell, J., J. S. Dixon, J. M. Linsdale. 1937. Fur-bearing mammals of California. 2 Vols. University of California Press, Berkeley, CA. 777 pp. Heinrich, B. 2004. Bumblebee economics. Harvard University Press, Cambridge, Massachusetts. 245 pp. Holland, R. F. 1986. Preliminary Descriptions of the Terrestrial Natural Communities of California. Nongame- Heritage Program, California Department of Fish and Game. Sacramento, CA. 156 pp. Jepson Flora Project (JFP) (eds.). Last updated December 21, 2020. Jepson eFlora. Accessed on February 8, 2021 from: http://ucjeps.berkeley.edu/eflora/ Kupferberg, S. 2018. Lecture: Natural and Unnatural History. Presented at Foothill Yellow- legged Frog: Ecology, Management, and Regulation Workshop. Presented by The Wildlife Society. Humboldt State University, Arcata, CA. Little, E. L. 2000. National Audubon Society Field Guide: Trees of the Western Region. New York. Alfred A. Knopf. Page 442 of 800 Page 34 of 101 Mayer, K. E. and W. F. Laudenslayer. 1988. A Guide to Wildlife Habitats of California. State of California, Sacramento, CA. Miller, D. J. and R. N. Lea. 1972. Guide to the Coastal Marine Fishes of California, Fish Bulletin No. 157. California Department of Fish and Game, Sacramento, CA. Moyle, P. B., J. E. Williams, and E. D. Wirkamanayake. 1989. Fish species of special concern of California. Final report submitted to California Dept. of Fish and Game, Inland Fisheries Division, Rancho Cordova. 222 pp. Moyle, P. B. 1976. Inland Fishes of California. University of California Press, Berkeley, CA. National Marine Fisheries Service (NMFS). 1996. Proposed endangered status for five ESUs of Steelhead and proposed threatened status for five ESUs of steelhead in Washington, Oregon, Idaho, and California. Federal Register 61(155):41541-61. NatureServe. 2021. NatureServe Explorer: An online encyclopedia of life [web application]. NatureServe, Arlington, Virginia. Updated on September 4, 2020. Accessed on February 7, 2021 from: http://explorer.natureserve.org Pierson, E. D., Rainey, W. E. 1998. Western mastiff bat, Eumops perotis. Terrestrial Mammal Species of Special Concern in California, Bolster, B. C., Ed., 1998. Peterson, R. T. 1990. A Field Guide to Western Birds. Houghton Mifflin Co., Boston, MA. Remsen, J. V. 1978. Bird species of special concern in California. California Department of Fish and Game, Sacramento. Wildlife Management Administrative Report. No. 78(1) 54 pp. Sawyer, J. O. and T. Keeler-Wolfe. 2019. A Manual of California Vegetation. Online Edition. California Native Plant Society. [Accessed on February 2, 2021]. Sawyer, J. O. and T. Keeler-Wolfe and J.M. Evans. 2009, Second Addition. A Manual of California Vegetation. California Native Plant Society. Sacramento, CA. Sawyer, J. O. and T. Keeler-Wolfe. 2008. A Manual of California Vegetation. California Native Plant Society. Sacramento, CA. Sawyer, J. O. and T. Keeler-Wolfe. 1995. A Manual of California Vegetation. California Native Plant Society. Sacramento, CA. 471 pp. Sibley, D. A. 2000. The Sibley Guide to Birds. National Audubon Society. Alfred A. Knopf, New York, NY. Page 443 of 800 Page 35 of 101 Squires, J. R., Reynolds, R. T. 1997. Northern Goshawk (Acipiter gentilis), version 2.0. The Birds of North America (A. F. Poole and F. B. Gill, Editors). Cornell Lab of Ornithology, Ithaca, NY, USA. Accessed on February 2, 2021 from: https://doi.org/10.2173/bna.298 Stebbins, Robert C, and McGinnis, Samuel M. Field Guide to Amphibians and Reptiles of California: Revised Edition. (California Natural History Guides). University of California Press. 2012. Thomson, C. R, Wright, A. N., and Shaffer, H. B. 2016. California Amphibian and Reptile Species of Special Concern. University of California Press. Oakland, CA. 390 pp. Thorne, Robert F. 1976. The vascular plant communities of California. In: Latting, June, ed. Symposium proceedings: Plant communities of southern California; 1974 May 4; Fullerton, CA. Special Publication No. 2. Berkeley, CA: California Native Plant Society: 1-31. [3289] Udvardy, M. D. F. 1994. National Audubon Society Field Guide to North America Birds. Alfred A. Knopf, Inc. New York, NY. 822pp. USDA Natural Resources Conservation Service Web Soil Survey 2021. Soil compositions for specific locations in the United States. Accessed on February 2, 2021 from: https://websoilsurvey.se.egov.usda.gov USDA. CalVeg Existing Vegetation: North Coast Mid. Last updated January 18, 2018. [February 2, 2021] US Climate Data. 2021. Version 3.0. https://www.usclimatedata.com/ Accessed February 8, 2021. U.S. Fish and Wildlife Service (USFWS). 2004. Twelve month finding for a Petition to List the West Coast Distinct Population Segment of the Fisher (Martes pennant); proposed rule. Federal Register 69(68): 18769-18792. U. S. Fish and Wildlife Service (USFWS). 1991. Guidelines for Surveying Proposed Management Activities that may Impact Northern Spotted Owls. U. S. Fish and Wildlife Service (USFWS). Information for Planning and Consultation (IPAC System). Accessed on February 8, 2021 from https://ecos.fws.gov/ipac/ U. S. Fish and Wildlife Service (USFWS). National Wetlands Inventory (NWI) Wetlands Mapper. Last updated: October 1, 2020. Accessed on February 24, 2021 from https://www.fws.gov/wetlands/data/Mapper.html U.S. Geological Survey (USGS). 2012. Ukiah quadrangle. 7.5 minute topographic map. Page 444 of 800 Page 36 of 101 Waian, L. B., Stendell, R. C. 1970. The white-tailed kite in California with observations of the Santa Barbara population. California Fish and Game 56: 188-198. Western Bat Working Group (WBWG). 2020. Species Accounts. Accessed on February 2, 2021 from: http://wbwg.org/western-bat-species/ The Xerces Society for Invertebrate Conservation. 2020. Species Accounts. Accessed on February 2, 2021 from: https://xerces.org/ Zeiner, D. C., W. F. Laudenslayer Jr., and K. E. Mayer. 1988. California’s Wildlife Volume I – Amphibians and Reptiles. State of California Department of Fish and Game. 272pp. Zeiner, D. C., W. F. Laudenslayer Jr., K. E. Mayer, and M. White. 1990a. California’s Wildlife Volume II – Birds. State of California Department of Fish and Game. 732pp. Zeiner, D. C., W. F. Laudenslayer Jr., K. E. Mayer, and M. White. 1990b. California’s Wildlife Volume III – Mammals. State of California Department of Fish and Game. 407pp Report Author: Alicia Ives Ringstad Alicia Ives Ringstad received a B.S. in Wildlife Management and Conservation from Humboldt State University in 2007, with studies including plant taxonomy. She is a Consulting Senior Wildlife Biologist with over 15 years professional wildlife biology, forestry, botany and environmental planning experience. Ms. Ives Ringstad provides Botanical surveys and Biological Assessments for large and small projects requiring compliance with the California Environmental Quality Act (CEQA), these projects include timber harvesting, land conversion, minor and major subdivisions, and development plans/permits. Ms. Ives Ringstad’s experience includes conducting wetland delineations that met the requirements of the US Army Corps of Engineers Technical Report (Y-87-1) Page 445 of 800 Appendix A: Table of Potential for Special-Status Plants and Wildlife within the Study Area Page 446 of 800 Page 1 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Amphibians California giant salamander Dicamptodon ensatus CDFW: SSC IUCN: NT California giant salamanders are year-round residents of California and were split into two species – California giant salamander (Dicamptodon ensatus) occurring south of the Mendocino County line and the coastal giant salamander (Dicamptodon tenebrosus) occurring in the north. D. ensatus are found in meadows and seeps, north coast coniferous forest and riparian forested habitats. D. ensatus occur in wet coastal forests in or near clear, cold permanent and semi-permanent streams and seepages. Adults leave terrestrial habitats to reproduce and both the reproduction and larval stages are aquatic with breeding occurring mostly in the spring. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. northern red-legged frog Rana aurora CDFW: SSC IUCN: LC USFS: S R. aurora are often observed within humid forests, woodlands, wetlands, grasslands and stream-sides in northwestern California, usually near dense riparian cover. This species is generally found near permanent water but can be found far from water in damp woods and meadows during the non-breeding season. Typical habitat types include Klamath/North coast flowing waters, riparian forest and woodland. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. Page 447 of 800 Page 2 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS foothill yellow-legged frog Rana boylii BLM: S CDFW: SSC IUCN: NT USFS: S R. boylii occupy a diverse range of ephemeral and permanent streams, rivers, and adjacent moist terrestrial habitats. Occupied streams are often partly shaded, low gradient, and dominated by coarse, unconsolidated rocky substrates. Adults breed and tadpoles develop in slow water velocity habitats. Dispersing juvenile and adult frogs will seek refugia in Class II streams pre-and-post breeding, opposite of salmonids. Unlikely. Habitat within the Study Area is ranked Low (0.33) in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area itself does not contain suitable habitat for this species, although potential suitable breeding habitat may be in Doolin Creek a Class I watercourse located approximately 2,230 feet south of the Study Area. A Class II watercourse located approximately 225 feet north of the Study Area may be suitable winter refugia habitat as well. Not Observed. This species was not observed during the biological assessment. There are no recommendations for this species. red-bellied newt Taricha rivularis CDFW: SSC IUCN: LC T. rivularis inhabits coastal forests, typically in redwood (Sequoia sempervirens) forest habitat although also found in other forest types (hardwood etc.). Adults are terrestrial and fossorial. Transformed juveniles leave aquatic environments and go into hiding in underground shelters, often until ready to reproduce. Breeding occurs in streams often with relatively strong flows. High Potential. Habitat within the Study Area is ranked High (1.00) in suitability according to the CWHR Predicted Habitat Suitability Map. Aquatic habitat is not present within the Study Area; however, the Study Area may be used for migration and refugia. There is a known occurrence of this species approximately 0.7 miles northwest from the Study Area along Gibson Creek according to CNDDB. Not Observed. This species was not observed during the biological assessment. It is recommended to survey for this species prior to ground disturbance. Page 448 of 800 Page 3 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Avifauna northern goshawk Accipiter gentilis BLM: S CDF: S CDFW: SSC IUCN: LC USFS: S A. gentilis are often found in dense, mature and old growth stands of conifer and deciduous habitats. Younger seral stands that include larger residual or defective trees are also used. Nest often on cooler (northerly or easterly) moderate slopes in dense vegetation or within riparian zones, but close to openings. Nest sites are often located next to water, which may provide a break in canopy for easy access to the nest stand or may influence microclimate or prey distribution. High Potential. Habitat within the Study Area is ranked Medium (0.44) and High (1.00) in suitability according to the CWHR Predicted Habitat Suitability Map. There are no stands of dense, mature and old growth conifer or deciduous forest in the immediate vicinity of the Study Area; however, areas withing the Study Area does contain conifer and deciduous forest stands. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. tricolored blackbird Agelaius tricolor SCE BLM: S CDFW: SSC IUCN: EN NABCI: RWL USFWS: BCC A. tricolor breed and forage in a variety of habitats including salt marshes, moist grasslands, freshwater marshes, bay-shore habitats, riparian forests and oak savannahs. A. tricolor use dense riparian vegetation such as Himalayan blackberry (Rubus armeniacus) for nesting and forage in cultivated fields, wetlands, and feedlots associated with dairy farms. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Riparian forests with dense vegetation are not present within the Study Area. Not Present. There are no recommendations for this species. Page 449 of 800 Page 4 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS grasshopper sparrow Ammodramus savannarum CDFW: SSC IUCN: LC A. savannarum are an uncommon and local, summer resident in foothills and lowlands west of the Cascade- Sierra Nevada crest from Mendocino and Trinity Counties south to San Diego County. A. savannarum nests on the ground in grasslands, prairie, cultivated fields, and grassy clearings in forests; particularly in areas with a variety of grasses and tall forbs and scattered shrubs for singing perches. Nests are typically found at the base of a small clump of overhanging grass or other vegetation. No Potential. The Study Area does not have suitable habitat present according to the CWHR Predicted Habitat Suitability Map. Small patches of suitable habitat are present within the surrounding area. Not Present. There are no recommendations for this species. golden eagle Aquila chrysaetos BLM: S CDF: S CDFW: FP, WL IUCN: LC USFWS: BCC A. chrysaetos is an uncommon permanent resident in northern California. This species ranges from sea level up to 11,500 feet inhabiting rolling foothills, mountain areas, sage-juniper flats and desert. This species frequently nests in secluded cliffs of all heights with overhanging ledges and in large trees in open areas. High Potential. Habitat within the Study Area is ranked Moderate (0.44) and High (1.00) in suitability according to the CWHR Predicted Habitat Suitability Map. There are no stands of dense, mature and old growth conifer or deciduous forest in the immediate vicinity of the Study Area; however, areas withing the Study Area does contain conifer and deciduous forest stands. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. great blue heron Ardea herodias CDF: S IUCN: LC A. herodias are commonly found in shallow estuaries and fresh and saline emergent wetlands. Foraging areas include river and creek banks, ponds, lakes, and watercourses in mountainous areas. This species often nests in colonies within a rookery tree. Unlikely. Habitat within the Study Area is ranked not suitable (0) to Low (0.22) to Moderate (0.44) in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area itself contains no nesting or foraging habitat suited for this species. Not Present. There are no recommendations for this species. Page 450 of 800 Page 5 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS oak titmouse Baeolophus inornatus IUCN: LC NABCI: YWL USFWS: BCC B. inornatus are cavity-nesters found within oak or oak-pine woodlands, and many will use scrub oaks or other brush with woodlands nearby. This species occurs within montane hardwood-conifer, montane hardwood, oak woodlands (Quercus agrifolia, Q. douglasii, Q. lobata). B. inornatus typically eats seeds, various plant materials, insects and other invertebrates, foraging from the ground floor up to approximately 30 ft off the ground. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. western snowy plover Charadrius alexandrinus nivosus FT CDFW: SSC NABCI: RWL USFWS: BCC C. alexandrinus nivosus inhabit barren to sparsely vegetated sandy beaches, salt pond levees, Great Basin standing waters, wetlands and shores of large alkali lakes. Nesting habitat consists of sandy, gravelly or friable soils usually within a natural or scraped depression on dry ground. Diet consists of terrestrial and aquatic invertebrates. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. northern harrier Circus hudsonius CDFW: SSC IUCN: LC C. hudsonius are year-long residents of Mendocino and Lake County. They frequent meadows, alpine meadows, grasslands, open rangelands, desert sinks, fresh and saltwater emergent wetlands and are seldom found in wooded areas. Usually hunts by flying low over fields, scanning the ground for small prey including mammals (voles, rats, other rodents), bird species ranging from songbirds to small ducks and large insects. Breeding occurs on meadows and marshland, both salt and freshwater. Nests on ground in shrubby vegetation, usually at marsh edge; nest built of a large mound of sticks in wet areas. No Potential. The Study Area does not have suitable habitat present according to the CWHR Predicted Habitat Suitability Map. Small patches of Low (0.22) suitable habitat are present within the surrounding area. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. Page 451 of 800 Page 6 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS yellow-billed cuckoo Coccyzus americanus FT SE BLM: S NABCI: RWL USFS: S USFWS: BCC C. americanus use wooded habitat with dense cover and water nearby, including woodlands with low, scrubby vegetation, overgrown orchards, abandoned farmland, and dense thickets along streams and marshes. This species makes their nests along horizontal branches or the fork of a tree or large shrub, often between 3 to 90 feet (1 to 28 meters). Trees are often oak (Quercus sp.), beech, hawthorn (Crataegus sp.) and ash, often with lower story of blackberry, nettles or wild grapes. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. white-tailed kite Elanus leucurus BLM: S CDFW: FP IUCN: LC Often found in coastal, valley lowlands and agricultural areas, E. leucurus inhabit herbaceous and open stages of most habitats especially in cismontane California. This species’ primary diet consists of small mammals (voles and other rodents), found in undisturbed, open grasslands, meadows, farmlands, and emergent wetlands (Waian et. al. 1970). Nests are often found in isolated, dense-topped trees. No Potential. The Study Area does not have suitable habitat present according to the CWHR Predicted Habitat Suitability Map. Small patches of Low (0.32) suitable habitat are present within the surrounding area. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. yellow-breasted chat Icteria virens CDFW: SSC IUCN: LC I. virens inhabit riparian thickets of willow and other brushy tangles near watercourses. Required habitat for this species is riparian forest, woodland, or scrub. Nests in low, dense riparian habitat often consisting of willow, blackberry, and wild grape within 10ft. of the ground. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. Page 452 of 800 Page 7 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Lewis’ woodpecker Melanerpes lewis CDFW: SSC IUCN: LC NABCI: YWL USFWS: BCC M. lewis often inhabit oak savannahs, broken deciduous, and coniferous habitats. Nests are made at the forest edge (especially ponderosa pine) or in groves or scattered trees and requires snags for nest cavities. M. lewis’ primary diet consists of insects, nuts, and fruits. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. osprey Pandion haliaetus CDF: S CDFW: WL IUCN: LC P. haliaetus are strictly associated with large, fish-bearing waters, primarily in ponderosa pine and mixed conifer stands. Foraging habitat consists of open, clear waters, rivers, lakes, reservoirs, estuaries, lagoons, swamps, marshes, and bays. Diet consists almost exclusively live fish. Large trees, snags, and blown-out treetops are used for cover and nesting. Nests are located on or near the tops of trees, snags, cliffs, or human-made structures. High Potential. Habitat within the Study Area is ranked Moderate (0.44) and High (0.77) in suitability according to the CWHR Predicted Habitat Suitability Map. There are no stands of dense, mature and old growth conifer or deciduous forest in the immediate vicinity of the Study Area; however, areas withing the Study Area does contain conifer and deciduous forest stands. Not Observed. This species or nests were not observed during the biological assessment. No trees are proposed for removal; however, it is recommended to survey for this species within 500 feet of ground disturbance activities. yellow warbler Setophaga petechia CDFW: SSC USFWS: BCC S. petechia often inhabits riparian deciduous habitats in summer: willows, alders, cottonwoods, and other small trees and shrubs typical of low, open canopy riparian woodland. This species will also breed in montane shrubbery in open conifer forest. S. petechia migrates through woodland, forest and shrub habitats. Nests above ground in a deciduous dappling or shrub. Moderate Potential. Habitat within the Study Area is ranked Low (0.22) to Moderate (0.44) in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area contains does contain montane shrubs in open conifer and deciduous forest that may be potential habitat for this species. Not Observed. This species was not observed during the biological assessment. It is recommended that nesting bird surveys be conducted prior to vegetation removal. Page 453 of 800 Page 8 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS northern spotted owl Strix occidentalis caurina FT, ST CDF: S IUCN: NT NABCI: YWL S. occidentalis caurina are year-round residents in dense, structurally complex forests, primarily with old-growth conifers. Nests on snags and within tree cavities, and often is associated with existing structures (old raptor nests, squirrel nests and A. pomo nests). Moderate Potential. The Study Area is approximately 4.3 miles southeast from the closest NSO Activity Center and 4.5 miles northeast from the nearest critical habitat as identified by the USFWS. The Study Area is located within suitable habitat according to the CWHR Predicted Habitat Suitability Map. The Study Area does not contain large conifers for nesting but may provide suitable foraging habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. Trees are not proposed for removal; therefore, there are no recommendations for this species. Fish Pacific lamprey Entosphenus tridentatus AFS: VU BLM: S CDFW: SSC USFS: S E. tridentatus are anadromous, but also with a number of permanent freshwater resident populations. This species is parasitic as adults, feeding on blood and body fluids of its prey. To breed, E. tridentatus migrate into fresh water and dig nests. Adults die post-breeding. Larvae/juveniles live 5-6 years in freshwater before returning to the ocean. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. Not Present. There are no recommendations for this species. Clear Lake tule perch Hysterocarpus traskii lagunae CDFW: SSC H. traskii lagunae are endemic to three (3) highly altered lakes (Clear Lake, Lower Blue Lake, and Upper Blue Lake); however, it is expected that they are only commonly found in Upper Blue Lake as the other lakes have already lost a majority of their native fishes. A key habitat requirement of H. traskii lagunae is cover, especially for pregnant females and small juveniles. This species is typically found in small shoals in deep (3+ m) tule beds, among rocks (especially along steep rocky shores), or among the branches of fallen trees. No Potential. The Study Area is outside of the Clear Lake watershed and the current known distribution for this species according to the FSSC Range Map. Not Present. There are no recommendations for this species. Page 454 of 800 Page 9 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Russian River tule perch Hysterocarpus traskii pomo AFS: VU CDFW: SSC H. traskii pomo inhabits clear, flowing streams and rivers, and occupy deep pools that have complex cover in the form of aquatic and overhanging vegetation. This species is endemic to the Russian River and the lower parts of its tributaries. They feed on invertebrates, plants, and zooplankton. Mating occurs in July-Sept. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. Not Present. There are no recommendations for this species. Navarro roach Lavinia symmetricus navarroensis CDFW: SSC L. symmetricus navarroensis are generally found in small, warm intermittent streams, and dense populations are frequently found in isolated pools. They are most abundant in mid- elevation streams in the Sierra foothills and in the lower reaches of some coastal streams. Roach are tolerant of relatively high temperatures (30-35 C) and low oxygen levels (1-2 ppm). However, they are habitat generalists, also being found in cold, well- aerated clear "trout" streams, in human- modified habitats and in the main channels of rivers, such as the Russian and Tuolumne. This form appears to be abundant in both the Russian and Navarro rivers. No Potential. The Study Area is outside of the Navarro River watershed and current known distribution for this species according to the FSSC Range Map. Not Present. There are no recommendations for this species. Clear Lake – Russian River roach Lavinia symmetricus ssp. 4 CDFW: SSC L. symmetricus are generally found in small, warm intermittent streams, and dense populations are frequently found in isolated pools. Roach are tolerant of relatively high temperatures (30-35 C) and low oxygen levels (1-2 ppm). However, they are habitat generalists, also being found in cold, well- aerated clear "trout" streams, in human- modified habitats and in the main channels of rivers. Clear Lake roach are restricted to the tributaries of Clear Lake, where they are widely distributed in the basin’s seven major drainages. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. Not Present. There are no recommendations for this species. Page 455 of 800 Page 10 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS coho salmon – southern Oregon / northern California ESU Oncorhynchus kisutch pop. 2 FT ST AFS: TH O. kisutch are anadromous, migrating and spawning in streams that flow directly into the ocean or tributaries of larger rivers. Migration peaks between mid-May and mid-June. Coho lay egg masses (redds), often located between a pool and a riffle. This evolutionarily significant unit, or ESU, includes naturally spawned coho salmon originating from coastal streams and rivers between Cape Blanco, Oregon, and Punta Gorda, California. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. According to the CWHR Predicted Habitat Suitability Map, Doolin Creek (approximately 2,230 feet south) and an unnamed watercourse (approximately 225 north) do not have Intrinsic Potential to contain this species. Not Present. There are no recommendations for this species. coho salmon – central California coast ESU Oncorhynchus kisutch pop. 4 FE SE AFS EN Coho are anadromous, migrating and spawning in streams that flow directly into the ocean or tributaries of larger rivers. Migration peaks mid-May till mid-June. The fish will spend two to three years at sea before migrating back to their natal stream to spawn. Coho lay egg masses (redds), often located between a pool and a riffle. This evolutionarily significant unit, or ESU, includes naturally spawned coho salmon originating from rivers south of Punta Gorda, California, to and including Aptos Creek, as well as such coho salmon originating from tributaries to San Francisco Bay. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. According to the CWHR Predicted Habitat Suitability Map, Doolin Creek (approximately 2,230 feet south) and an unnamed watercourse (approximately 225 north) have Intrinsic Potential to contain this species. Not Present. There are no recommendations for this species. Page 456 of 800 Page 11 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS steelhead – northern California DPS Oncorhynchus mykiss irideus pop. 16 FT AFS: TH O. mykiss irideus are anadromous coastal rainbow trout. As adults, this species requires high flows, with depths of at least 18cm for passage. Clean well-aerated gravel beds, typically in steep, rocky reaches of upper tributaries are needed for spawning. This distinct population segment, or DPS, includes naturally spawned anadromous steelhead (Oncorhynchus mykiss) originating below natural and manmade impassable barriers in California coastal river basins from Redwood Creek to and including the Gualala River. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. According to the CWHR Predicted Habitat Suitability Map, Doolin Creek (approximately 2,230 feet south) and an unnamed watercourse (approximately 225 north) do not have Intrinsic Potential to contain this species. Not Present. There are no recommendations for this species. steelhead - central California coast DPS Oncorhynchus mykiss irideus pop. 8 FT AFS: TH O. mykiss irideus are anadromous coastal rainbow trout. As adults, this species requires high flows, with depths of at least 18cm for passage. Clean well-aerated gravel beds, typically in steep, rocky reaches of upper tributaries are needed for spawning. The central California coast DPS are found from the Russian River south to Soquel Creek and to, but not including Pajaro River. Also San Francisco and San Pablo Bay basins. This DPS does not include summer-run steelhead. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. According to the CWHR Predicted Habitat Suitability Map, Doolin Creek (approximately 2,230 feet south) and an unnamed watercourse (approximately 225 north) have Intrinsic Potential to contain this species. Not Present. There are no recommendations for this species. Page 457 of 800 Page 12 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS chinook salmon – California coastal ESU Oncorhynchus tshawytscha pop. 17 FT AFS: TH The California coastal ESU includes all naturally spawned populations of Chinook salmon from the Klamath River (exclusive) to the Russian River (inclusive). Adult numbers depend on pool depth and volume, amount of cover, and proximity to gravel. Water temperatures greater than 27°C are lethal. No Potential. The Study Area does not contain fish bearing water bodies suitable for this species and does provide suitable habitat for this species. According to the CWHR Predicted Habitat Suitability Map, an unnamed watercourse (approximately 225 north) and Doolin Creek (approximately 2,230 feet south) do not have Intrinsic Potential to contain this species. Not Present. There are no recommendations for this species. Insects obscure bumble bee Bombus caliginosus IUCN: VU B. caliginosus are often found in coastal areas from Santa Barbara county north to Washington state. Food plant genera includes Baccharis, Cirisum, Lupinus, Lotus, Grindelia, and Phacelia. Moderate Potential. The Study Area contains suitable habitat and food plant genera for this species. Not Observed. This species was not observed during the biological assessment. Brush and grassland are proposed for removal; however, there is adequate potential habitat surrounding the Study Area. There are no recommendations for this species. Page 458 of 800 Page 13 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS western bumble bee Bombus occidentalis SCE USFS: S Xerces: IM B. occidentalis are formerly common throughout much of western North America; however, populations from southern British Columbia to central California have nearly disappeared. They occur in a variety of habitat types and are generalist pollinators. B. occidentalis are commonly encountered along stream banks, meadows, disturbed areas, or on flowers by roadsides. Moderate Potential. The Study Area contains suitable habitat and food plant genera for this species. Not Observed. This species was not observed during the biological assessment. Brush and grassland are proposed for removal; however, there is adequate potential habitat surrounding the Study Area. There are no recommendations for this species. Mollusks western ridged mussel Gonidea angulata G. angulata inhabits cold creeks and streams from low-to-mid elevations that are seasonally and not continuously turbid. G. angulata requires a host species to reproduce and disperse and can be found in diverse substrates from firm mud to coarse particles. Documented fish hosts for this species include hardhead (Mylopharodon conocephalus), pit sculpin (Cottus pitensis), and Tule perch (Hysterocarpus traski). No Potential. The Study Area does not contain fish bearing water bodies suitable for this species. The Russian River within roughly 500 feet of the Study Area does provide aquatic habitat for this species, but the Study Area contains no tributary watercourses. Not Present. There are no recommendations for this species. Mammals pallid bat Antrozous pallidus BLM: S CDFW: SSC IUCN: LC USFS: S WBWG: H A. pallidus are found in deserts, grasslands, shrublands, woodlands, and forests. Most commonly forages along open river channels. Roosting sites include crevices in rocky outcrops and cliffs, caves, mines, basal hollows in large conifers and various human structures such as bridges, barns, and buildings (including occupied buildings). Roosts must protect bats from high temperatures. Very sensitive to disturbance of roosting sites. Unlikely. Habitat within the Study Area ranks Low (0.11) in suitability according to the CWHR Predicted Habitat Suitability Map. Suitable foraging is present within grassland habitat throughout the Study Area; however, roosting habitat is limited. Not Observed. This species or evidence of this species was not observed during the biological assessment. There are no further recommendations for this species. Page 459 of 800 Page 14 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Sonoma tree vole Arborimus pomo CDFW: SSC IUCN: NT A. pomo lives in humid coastal forests consisting of Douglas-fir, grand fir, western hemlock, and/or Sitka spruce. This species requires Douglas-fir and grand fir needles as a food source and nesting materials. Nests are frequently found in trees along the bole, in branch crotches, or in the top of snags. Nests are most often found along roads, skid trails, or forest edges; however, they could exist further in the forest with dense canopies making nest identification difficult. This species is distributed along the North Coast from Sonoma County north to the Oregon border, being practically restricted to the fog belt. Moderate Potential. Habitat within the Study Area is not suitable in some areas, ranks Low (0.33) withing Montane Hardwood-Conifer habitat and High (1) within Conifer Forest habitat according to the CWHR Predicted Habitat Suitability Map. The Study Area does contain Douglas-fir trees and map provide suitable habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. Trees are not proposed for removal, but if trees were to be removed, it is recommended to survey those trees for this species. Townsend’s big-eared bat Corynorhinus townsendii BLM: S CDFW: SSC IUCN: LC USFS: S WBWG: H C. townsendii is associated with a wide variety of habitats from deserts to mid-elevation mixed coniferous-deciduous forest, basal hollows in large conifers. Females form maternity colonies in buildings, caves and mines and males roost singly or in small groups. Foraging occurs in open forest habitats where they glean moths from vegetation. Unlikely. Habitat within the Study Area ranks Low (0.11) in suitability according to the CWHR Predicted Habitat Suitability Map. Suitable foraging is present within grassland habitat throughout the Study Area; however, roosting habitat is limited. Not Observed. This species or evidence of this species was not observed during the biological assessment. There are no further recommendations for this species. North American porcupine Erethizon dorsatum IUCN: LC E. dorsatum are commonly found in coniferous and mixed forested areas, and can also inhabit shrublands, tundra and deserts, albeit less frequently as this species tends to spend much of its time in trees. This species makes its dens in hollow trees, decaying logs and caves in rocky areas. Recognized as primarily solitary and nocturnal, E. dorsatum may be seen foraging during daytime. Moderate Potential. Habitat within the Study Area is ranked Low (0.33) within the Montane Hardwood habitat to Moderate (0.55) within the Hardwood-Montane Conifer habitat in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area may contain suitable habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. It is recommended to survey for this survey prior to ground disturbance. Page 460 of 800 Page 15 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS western mastiff bat Eumops perotis californicus CDFW: SSC BLM:S WBWG:H Uncommon resident in southeastern San Joaquin Valley and Coastal Ranges from Monterey Co. southward through southern California, from the coast eastward to the Colorado Desert. Occurs in many open, semi- arid to arid habitats, including conifer and deciduous woodlands, coastal scrub, annual and perennial grasslands, palm oases, chaparral, desert scrub, and urban. No Potential. The Study Area is outside the known distribution range for this species according to the CWHR Predicted Habitat Suitability Map. Not Present. There are no recommendations for this species. western red bat Lasiurus blossevillii CDFW: SSC IUCN: LC WBWG: H L. blossevillii roosts primarily in trees, often 2- 40ft above the ground from sea level through mixed conifer forests. Typical habitats include cismontane woodland, lower montane coniferous forest, riparian forests and woodlands. This species prefers habitat edges and mosaics with trees that are protected from above and open below with open areas for foraging. Moderate Potential. Habitat within the Study Area is ranked Moderate (0.66) within the Hardwood-Montane Conifer habitat in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area may contain suitable habitat for this species. Not Observed. This species or evidence of this species was not observed during the biological assessment. There are no further recommendations for this species. hoary bat Lasiurus cinereus CDFW: SSC IUCN: LC WBWG: M L. cinereus are yearlong residents of Mendocino County. This bat is one of the few bats knows to both migrate south for winter and to hibernate locally. Hoary bat daytime roosts are typically dense foliage of medium to large sized trees. This bat occupies a variety of habitats including dense forest, forest edges, coniferous forests, deserts, and broadleaf forests. Moderate Potential. Habitat within the Study Area is ranked Moderate (0.55) within the Hardwood-Montane Conifer habitat in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area may contain suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. It is recommended to survey for this survey prior to ground disturbance. Page 461 of 800 Page 16 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS little brown bat Myotis lucifugus CDFW: SSC IUCN: LC WBWG: M M. lucifugus is found in most of the United States and Canada, except for the south central and southeastern United States and northern Alaska and Canada. M. lucifugus typically lives and feeds in forested areas near or over water. The little brown bat lives in three different roosting sites throughout the year: day roosts, night roosts, and hibernation roosts. Stable, ambient temperatures greatly influence site selection. Human-made structures are often selected, however both day and night roosts may be found in trees, under rocks, and in piles of wood. Day roosts provide excellent shelter, limited to no light, and typically have southwestern exposure. Night roosts are larger areas these bats can use when outside temperatures necessitate communal congregation for warmth. Hibernaculum habitats tend to include mines and caves and are typically warmer and more humid. Unlikely. Habitat within the Study Area is ranked Low (0.11) in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area does not contain structures, mines or caves that this species could use for breeding sites. This species may forage over the Study Area. Not Observed. This species was not observed during the biological assessment. There are no further recommendations for this species. Yuma myotis Myotis yumanensis CDFW: SSC BLM: S IUCN: LC WBWG: LM M. yumanensis commonly inhabits open forests and woodlands from British Columbia across the western U.S. and south into Baja and southern Mexico. This species will use a variety of lowland habitats from scrub to coniferous forest, always near slow-moving or standing water habitats. Foraging occurs almost exclusively over water, with distribution being closely tied to bodies of water. Typical roosting habitat are caves, mines, buildings, under bridges and in cliff and tree crevices. Maternity colonies are often in caves, mines, buildings and crevices. Unlikely. Habitat within the Study Area is ranked Low (0.22) in suitability according to the CWHR Predicted Habitat Suitability Map. The Study Area does not contain structures, mines or caves that this species could use for breeding sites. The Study Area does not contain bodies of water for foraging habitat. Not Observed. This species was not observed during the biological assessment. There are no further recommendations for this species. Page 462 of 800 Page 17 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS fisher [West Coast DPS] Pekania pennanti ST CDFW: SSC USFS: S P. pennanti are primarily solitary, except during breeding season (February – April) and they inhabit forest stands with late- successional characteristics including intermediate-to-large tree stages of coniferous forest and deciduous-riparian areas with high percent canopy closure. Den site and prey availability are often associated with these characteristics. P. pennanti use cavities, snags, logs and rocky areas for cover and denning and require large areas of mature, dense forest. Moderate Potential. Habitat within the Study Area is ranked from no suitable habitat (0) to High (1) in suitability according to the CWHR Predicted Habitat Suitability Map and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. Trees present within the Study Area do not exhibit late successional characteristics and none are not proposed for removal for this project. There are no further recommendations for this species. American badger Taxidea taxus CDFW: SSC IUCN: LC T. taxus are most abundant in drier open stages of most shrub, forest and herbaceous habitats, with friable soils (Zeiner et al. 1990b). T. taxus dig burrows in the friable soils and frequently reuse old burrows. They prey on burrowing rodents, especially ground squirrels and pocket gophers, also on birds, insects, reptiles and carrion. Their diet shifts seasonally depending on the availability of prey. T. taxus are non- migratory and are found throughout most of California, except the northern North Coast area. No Potential. The Study Area does not have suitable habitat present according to the CWHR Predicted Habitat Suitability Map. Small patches of suitable habitat are present within the surrounding area. Not Present. There are no recommendations for this species. Reptiles western pond turtle Emys marmorata BLM: S CDFW: SSC IUCN: VU USFS: S E. marmorata are associated with permanent ponds, lakes, streams, stock ponds, marshes, seasonal wetlands, artificial areas including reservoirs or irrigation ditches, or permanent pools along intermittent streams in a wide variety of habitats. This species requires basking sites in the aquatic environment or upland, grassy openings with loose soil for nesting and overwintering. Nest sites can be found from 100-500 meters from aquatic habitat. Unlikely. Habitat within the Study Area is ranked Low (0.33) according to the CWHR Predicted Habitat Suitability Map. There are no watercourses or ponds located within the Study Area. The Study Area does not provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. There are no further recommendations for this species. Page 463 of 800 Page 18 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Plants Raiche’s manzanita Arctostaphylos stanfordiana ssp. raichei Rank 1B.1 Chaparral, lower montane coniferous forest (openings), rocky, serpentine sites, often on slopes and ridges. A. stanfordiana ssp. raichei has a serpentine affinity of 2.6 (strong indicator). Elevation ranges from 1591 to 3511 feet (485 to 1070 meters). A perennial evergreen shrub, the blooming period is from Feb-Apr. No Potential. The required habitat or soil (serpentine) for this species is not present within Study Area. The Study Area does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Brewer's milk-vetch Astragalus breweri Rank 4.2 Chaparral, cismontane woodland, meadows and seeps, valley and foothill grassland. Often in grassy flats, meadows moist in spring, and open slopes in chaparral. Commonly on or near volcanic or serpentine sites. A. breweri has a serpentine affinity of 3.2 (strong indicator). Elevation ranges from 296 to 2395 feet (90 to 730 meters). An annual herb, the blooming period is from Apr-Jun. Unlikely. The Study Area does contain open grassland and cismontane woodland; however, the area does not contain serpentine or volcanic soils and is unlikely to provide suitable habitat for this species. Not Present. There are no recommendations for this species. Sonoma sunshine Blennosperma bakeri Rank 1B.1 Vernal pools, swales (mesic areas), valley and foothill grasslands (wetlands, riparian). Elevation ranges from 33 to 952 feet (10 to 290 meters). An annual herb, the blooming period is from Mar-May. No Potential. The Study Area does not contain the required habitat (wet areas) for this species and is unlikely to provide suitable habitat for this species. Not Present. There are no recommendations for this species. watershield Brasenia schreberi Rank 2B.3 Freshwater marshes and swamps. Aquatic, known from water bodies both natural and artificial. Elevation ranges from 3 to 7152 feet (1 to 2180 meters). A perennial rhizomatous herb (aquatic), the blooming period is from Jun-Sep. No Potential. The Study Area does not contain the required habitat (wet areas) for this species and is unlikely to provide suitable habitat for this species. Not Present. There are no recommendations for this species. bristly sedge Carex comosa Rank 2B.1 Marshes and swamps, coastal prairie, valley and foothill grasslands, lake margins, wetlands. Elevation ranges from 17 to 3314 feet (5 to 1010 meters). A perennial rhizomatous herb, the blooming period is from May-Sep. Unlikely. The Study Area does contain grassland habitat; however, wet areas or wetlands are not present for this species and is unlikely to provide suitable habitat for this species. Not Present. There are no recommendations for this species. Page 464 of 800 Page 19 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Rincon Ridge ceanothus Ceanothus confusus Rank 1B.1 Closed-cone coniferous forest, chaparral, cismontane woodland, known from volcanic or serpentine soils, dry shrubby slopes. C. confusus has a serpentine affinity of 1.3 (weak indicator/indifferent). Elevation ranges from 492 to 4200 feet (150 to 1280 meters). A shrub, the blooming period is from Feb-Jun. Unlikely. The Study Area does contain cismontane woodland; however, does not have volcanic or serpentine soils and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Jepson’s dodder Cuscata jepsonii Rank 1B.2 Upper montane coniferous forest, lower montane coniferous forest, broadleaved upland forest, on primary host species (Ceanothus diversifolius and Ceanothus prostratus). Elevation ranges from 3937 to 9006 feet (1200 to 2745 meters). An annual herb or vine, the blooming period is from Jul-Sep. Unlikely. Ceanothus sp. is present within the Study Area; however, the Study Area is located outside of the elevation range of this species. Not Present. There are no recommendations for this species. California lady’s- slipper Cypripedium californicum Rank 4.2 Lower montane coniferous forest, bogs and fens, wetlands, often found in perennial seepages on serpentine substrate and in gravel along creek margins (ultramafic). This species has a serpentine affinity of 4.5 (broad endemic). Elevation ranges from 99 to 9023 feet (30 to 2750 meters). A perennial herb (rhizomatous), the blooming period is from Apr-Aug. No Potential. The Study Area does not contain serpentine soil or wet areas and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. mountain lady’s-slipper Cypripedium montanum Rank 4.2 Lower montane coniferous forest, broadleaved upland forest, cismontane woodland, north coast coniferous forest, often on dry, undisturbed slopes. Elevation ranges from 607 to 7300 feet (185 to 2225 meters). A perennial herb (rhizomatous), the blooming period is from Mar-Aug. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period for this species. It is recommended that a botanical survey is conducted for this species during the appropriate blooming period (Mar- Aug). Page 465 of 800 Page 20 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Koch’s cord moss Entosthodon kochii Rank 1B.3 Cismontane woodland, often growing on soil over riverbanks. Elevation ranges from 607 to 1198 feet (185 to 365 meters). A moss, there is no distinct blooming period. Moderate Potential. Cismontane woodland is present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment and there are no recommendations for this species. bare monkeyflower Erythranthe nudata Rank 4.3 Chaparral, cismontane woodland, moist areas, often along drainages and roadsides in serpentine seeps. This species has a serpentine affinity of 5.6 (strict endemic). Elevation ranges from 820 to 2297 feet (250 to 700 meters). An annual herb, the blooming period is from May-Jun. Unlikely. Cismontane woodland is present within the Study Area; however, serpentine soil is not present. The Study Area does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. minute pocket moss Fissidens pauperculus Rank 1B.2 North coast coniferous forest, redwoods, moss growing on damp soil along the coast, sometimes in dry streambeds and along stream banks. Elevation ranges from 99 to 3363 feet (30 to 1025 meters). A moss, there is no distinct blooming period. Unlikely. Small patches of redwood trees are present within the Study Area; however, the Study Are is not located within North coast coniferous forest required for this species. Not Present. There are no recommendations for this species. stinkbells Fritillaria agrestis Rank 4.2 Cismontane woodland, chaparral, valley and foothill grassland, pinyon and juniper woodland, sometimes on serpentine soil, mostly found in non-native grassland or in grassy openings in clay soil. This species has a serpentine affinity of 2.7 (strong indicator). Elevation ranges from 33 to 5102 feet (10 to 1555 meters). A perennial bulbiferous herb, the blooming period is from Mar-Jun. Moderate Potential. Cismontane woodland is present within the Study Area. This species is sometime found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Mar-Jun). Page 466 of 800 Page 21 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Purdy's fritillary Fritillaria purdyi Rank 4.3 Chaparral, cismontane woodland, lower montane coniferous forest, usually on serpentine soil. F. fritillary has a serpentine affinity of 4.5 (broad endemic). Elevation ranges from 574 to 7399 feet (175 to 2255 meters). A perennial bulbiferous herb, the blooming period is from Mar-Jun. Unlikely. Cismontane woodland is present within the Study Area; however, this species has a strong affinity to serpentine soil. The Study Area does not contain serpentine soil and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Roderick’s fritillary Fritillaria roderickii Rank 1B.1 Coastal bluff scrub, coastal prairie, valley and foothill grassland, often on grassy slopes, mesas. Elevation ranges from 66 to 2002 feet (20 to 610 meters). A perennial herb (bulb), the blooming period is from Mar-May. Moderate Potential. Grassland habitat is present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Mar-May). Boggs Lake hedge- hyssop Gratiola heterosepala Rank 1B.2 Marshes and swamps (freshwater), vernal pools, often found in clay soils, usually in vernal pools or sometimes lake margins. Elevation ranges from 13 to 7907 feet (4 to 2410 meters). An annual herb, the blooming period is from Apr-Aug. No Potential. The Study Area does not contain the required habitat (aquatic or vernal pools) suitable for this species. Not Present. There are no recommendations for this species. Toren’s grimmia Grimmia torenii Rank 1B.3 Cismontane woodland, lower montane coniferous forest, chaparral, often found in openings, rocky, boulder and rock walls, carbonate, volcanic. Elevation ranges from 1067 to 3806 feet (325 to 1160 meters). A moss, no distinct blooming period. Unlikely. Cismontane woodland is present within the Study Area; however, does not contain carbonate or volcanic soil and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Page 467 of 800 Page 22 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Mendocino tarplant Hemizonia congesta ssp. calyculata Rank 4.3 Cismontane woodland, valley and foothill grassland, open woods and forests, sometimes on serpentine. H. congesta ssp. calyculata has a serpentine affinity of 1.5 (weak indicator). Elevation ranges from 738 to 4593 feet (225 to 1400 meters). An annual herb, the blooming period is from Jul-Nov. Moderate Potential. Cismontane woodland and grassland habitat are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Jul-Nov). congested-headed hayfield tarplant Hemizonia congesta ssp. congesta Rank 1B.2 Valley and foothill grassland, often in fallow fields, sometimes along roadsides. H. congesta ssp. congesta has a serpentine affinity (1.3, weak indicator/indifferent). Elevation ranges from 17 to 1706 feet (5 to 520 meters). An annual herb, the blooming period is from Apr- Nov. Moderate Potential. Grassland habitat is present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-Nov). Tracy’s tarplant Hemizonia congesta ssp. tracyi Rank 4.3 Coastal prairie, north coast coniferous forest, lower montane coniferous forest, often found in openings and sometimes on serpentine (ultramafic). H. congesta ssp. tracyi has a serpentine affinity of 1.8 (weak indicator). Elevation ranges from 394 to 3937 feet (120 to 1200 meters). An annual herb, the blooming period is from May-Oct. No Potential. The Study Area does not contain the required habitat (coastal prairie, North coast coniferous forest or lower montane coniferous forest) suitable for this species. Not Present. There are no recommendations for this species. glandular western flax Hesperolinon adenophyllum Rank 1B.2 Chaparral, cismontane woodland, valley and foothill grassland, serpentine soils, generally found in serpentine chaparral. H. adenophyllum has a serpentine affinity of 5.7 (strict endemic). Elevation ranges from 1395 to 4413 feet (425 to 1345 meters). An annual herb, the blooming period is from May-Aug. Unlikely. Cismontane woodland and grassland habitat is present within the Study Area; however, does not contain serpentine soil. The Study Area does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Page 468 of 800 Page 23 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Bolander’s horkelia Horkelia bolanderi Rank 1B.2 Lower montane coniferous forest, chaparral, meadows and seeps, valley and foothill grassland, often found in grassy margins of vernal pools and meadows. Elevation ranges from 1493 to 2805 feet (455 to 855 meters). A perennial herb, the blooming period is from Jun-Aug. Unlikely. Grassland habitat is present within the Study Area; however, does not contain vernal pools and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. small groundcone Kopsiopsis hookeri Rank 2B.3 North coast coniferous forest, open woods, shrubby places, generally on Gaultheria shallon. Elevation ranges from 394 to 4708 feet (120 to 1435 meters). A perennial herb, the blooming period is from Apr-Aug. No Potential. The Study Area does not contain the required habitat (North coast coniferous forest along the coast) suitable for this species. Not Present. There are no recommendations for this species. Burke’s goldfields Lasthenia burkei FE Rank 1B.1 Found in vernal pools and swales, meadows and seeps. Elevation ranges from 49 to 1969 feet (15 to 600 meters). An annual herb, the blooming period is from Apr-Jun. No Potential. The Study Area does not contain the required habitat (vernal pools or wet areas) for this species. Not Present. There are no recommendations for this species. Contra Costa goldfields Lasthenia conjugens FE Rank 1B.1 Valley and foothill grassland, vernal pools, alkaline playas, cismontane woodlands, often found in swales and low depressions in open grassy areas. Elevation ranges from 4 to 1477 feet (1 to 450 meters). An annual herb, the blooming period is from Mar-Jun. Moderate Potential. The Study Area contains the required habitat (cismontane woodland and grassland habitat) and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period for this species. It is recommended that a botanical survey during the appropriate blooming period for this species is conducted (Mar-Jun). Page 469 of 800 Page 24 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Colusa layia Layia septentrionalis Rank 1B.2 Chaparral, cismontane woodland, valley and foothill grassland, scattered colonies in fields and grassy slopes in sandy or serpentine soil. This species has a serpentine affinity of 3.2 (strong indicator). Elevation ranges from 49 to 3609 feet (15 to 1100 meters). An annual herb, the blooming period is from Apr-May. Unlikely. Cismontane woodland is present within the Study Area; however, the area does not contain serpentine soil The Study Area is unlikely to provide suitable habitat for this species. Not Present. There are no recommendations for this species. bristly leptosiphon Leptosiphon acicularis Rank 4.2 Chaparral, cismontane woodland, coastal prairie, valley and foothill grassland. Elevation ranges from 181 to 4922 feet (55 to 1500 meters). An annual herb, the blooming period is from Apr-Jul. Moderate Potential. The Study Area contains the required habitat (cismontane woodland) and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period for this species. It is recommended that a botanical survey during the appropriate blooming period for this species is conducted (Apr-Jul). broad-lobed leptosiphon Leptosiphon latisectus Rank 4.3 Broadleaved upland forest, cismontane woodland. L. latisectus has a serpentine affinity of 2.0 (weak indicator). Elevation ranges from 558 to 4922 feet (170 to 1500 meters). An annual herb, the blooming period is from Apr-Jun. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-Jun). Page 470 of 800 Page 25 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS woolly-headed lessingia Lessingia hololeuca Rank 3 Coastal scrub, lower montane coniferous forest, valley and foothill grassland, broadleaved upland forests, often on clay or serpentine along fields and roadsides. L. hololeuca has a serpentine affinity of 2.5 (strong indicator). Elevation ranges from 49 to 1001 feet (15 to 305 meters). An annual herb, the blooming period is from Jun-Oct. Unlikely. Grassland habitat is present within the Study Area; however, does not contain serpentine soil and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. redwood lily Lilium rubescens Rank 4.2 Chaparral, lower montane coniferous forest, broadleaved upland forest, upper montane coniferous forest, north coast coniferous forest, sometimes on serpentine. L. rubescens has a serpentine affinity of 2 (weak indicator). Elevation ranges from 99 to 6267 feet (30 to 1910 meters). A perennial herb (bulb), the blooming period is from Apr-Aug. Moderate Potential. Broadleaved upland forest is present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-Aug). Baker’s meadowfoam Limnanthes bakeri Rank 1B.1 Marshes and swamps, valley and foothill grassland, meadows and seeps, vernal pools, seasonally moist or saturated sites within grassland, also in swales, roadside ditches and margins of freshwater marshy areas. Elevation ranges from 574 to 3002 feet (175 to 915 meters). An annual herb, the blooming period is from Apr-May. Unlikely. Grassland habitat is present within the Study Area; however, does not contain wet/marshy areas and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Mendocino bush- mallow Malacothamnus mendocinensis Rank 1A Chaparral, open roadside banks. Elevation ranges from 1395 to 1887 feet (425 to 575 meters). A shrub, the blooming period is from May-Jun. No Potential. The Study Area does not contain the required habitat (Chaparral) for this species. Not Present. There are no recommendations for this species. Page 471 of 800 Page 26 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS green monardella Monardella viridis Rank 4.3 Broadleaved upland forest, chaparral, cismontane woodland. Elevation ranges from 328 to 3314 feet (100 to 1010 meters). A perennial herb, the blooming period is from Jun-Sep. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-Jun). Baker’s navarretia Navarretia leucocephala ssp. bakeri Rank 1B.1 Cismontane woodland, meadows and seeps, vernal pools and swales, valley and foothill grassland, lower montane coniferous forest, adobe or alkaline soils. Elevation ranges from 10 to 5512 feet (3 to 1680 meters). An annual herb, the blooming period is from Apr-Jul. Unlikely. Cismontane woodland and grassland habitat are present within the Study Area; however, does not contain adobe or alkaline soils and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. California Gairdner’s yampah Perideridia gairdneri ssp. gairdneri Rank 4.2 Broadleaved upland forest, chaparral, coastal prairie, valley and foothill grassland, vernal pools. Often found on adobe flats or grasslands, wet meadows and vernal pools, under Pinus radiata along the coast, mesic sites. Elevation ranges from 0 to 2002 feet (0 to 610 meters). A perennial herb, the blooming period is from Jun-Oct. Unlikely. Grassland habitat and broadleaved upland forest are present within the Study Area; however, is not located along the coast and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. white-flowered rein orchid Piperia candida Rank 1B.2 North Coast coniferous forest, lower montane coniferous forest, broadleaved upland forest, sometimes on serpentine. Often found in forest duff, mossy banks, ultramafic (serpentine) rock outcrops and muskeg. P. candida has a serpentine affinity of 1.2 (weak indicator/indifferent). Elevation ranges from 66 to 5299 feet (20 to 1615 meters). A perennial herb, the blooming period is from May-Sep. Moderate Potential. Cismontane woodland and broadleaved upland forest are present within the Study Area. This species is sometimes found in serpentine soil, but not always; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (May-Sep). Page 472 of 800 Page 27 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Mayacamas popcornflower Plagiobothrys lithocaryus Rank 1A Chaparral, cismontane woodland, valley and foothill grassland, moist sites. Elevation ranges from 985 to 1477 feet (300 to 450 meters). An annual herb, the blooming period is from Apr- May. Moderate Potential. Cismontane woodland and grassland habitat are present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-May). North Coast semaphore grass Pleuropogon hooverianus Rank 1B.1 Broadleaved upland forest, meadows and seeps, north coast coniferous forest, often found in wet, grassy, shady areas, sometimes freshwater marsh. Often associated with forest environments (wetland-riparian areas). Elevation ranges from 148 to 3806 feet (45 to 1160 meters). A perennial rhizomatous herb, the blooming period is from Apr-Jun. Unlikely. Broadleaved upland forest and grassland habitat are present within the Study Area; however, does not contain wet areas and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Lobb’s aquatic buttercup Ranunculus lobbii Rank 4.2 Cismontane woodland, valley and foothill grassland, vernal pools, north coast coniferous forest (mesic sites). Elevation ranges from 50 to 1542 feet (15 to 470 meters). An annual herb (aquatic), the blooming period is from Feb-May. Unlikely. Cismontane woodland and grassland habitat are present within the Study Area; however, does not contain wet areas and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. great burnet Sanguisorba officinalis Rank 2B.2 Bogs and fens, meadows and seeps, broadleaved upland forest, marshes and swamps, north coast coniferous forest, riparian forest, rocky serpentine seepage areas and along streams. Elevation ranges from 17 to 4593 feet (5 to 1400 meters). A perennial rhizomatous herb, the blooming period is from Jul-Oct. Unlikely. Cismontane woodland and broadleaved upland forest are present within the Study Area; however, does not contain wet areas or streams and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Page 473 of 800 Page 28 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Hoffman’s bristly jewelflower Streptanthus glandulosus ssp. hoffmanii Rank 1B.3 Chaparral, cismontane woodland, valley and foothill grassland, moist, steep rocky banks in serpentine and non-serpentine soils. Elevation ranges from 197 to 2510 feet (60 to 765 meters). An annual herb, the blooming period is from Mar-Jul. Unlikely. Cismontane woodland is present within the Study Area and this species is sometimes found in serpentine soil, but not always. However, moist rocky banks are not present within the Study Area and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. beaked tracyina Tracyina rostrata Rank 1B.2 USFS: S Cismontane woodland, valley and foothill grassland, chaparral, often observed in open grassy meadows commonly within oak woodland and grassland habitats. Elevation ranges from 492 to 2609 feet (150 to 795 meters). An annual herb, the blooming period is from May-Jun. Moderate Potential. Cismontane woodland and grassland habitat are present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (May-Jun). showy Indian clover Trifolium amoenum FE Rank 1B.1 Valley and foothill grassland, coastal bluff scrub, sometimes on serpentine soils (ultramafic), open sunny sites, swales, along roadsides and eroding cliff faces. T. amoenum has an ultramafic affinity (1.3, weak indicator, indifferent). Elevation ranges from 17 to 1017 feet (5 to 310 meters). An annual herb, the blooming period is from Apr-Jun. Moderate Potential. Grassland habitat is present within the Study Area and this species is sometimes found in serpentine soil, but not always. The Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (Apr-Jun). Page 474 of 800 Page 29 of 101 SPECIES STATUS* HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA RECOMMENDATIONS Santa Cruz clover Trifolium buckwestiorum Rank 1B.1 Coastal prairie, broadleaved upland forest, cismontane woodland, often found in moist grasslands along gravelly margins. Elevation ranges from 99 to 2641 feet (30 to 805 meters). An annual herb, the blooming period is from Apr-Oct. Unlikely. Cismontane woodland, grassland habitat and broadleaved upland forest are present within the Study Area; however, does not contain wet areas and does not provide suitable habitat for this species. Not Present. There are no recommendations for this species. Methuselah’s beard lichen Usnea longissima Rank 4.2 North coast coniferous forest, broadleaved upland forest. Often grows in the “redwood zone” on tree branches of a variety of trees, including bigleaf maple (Acer macrophyllum), various oaks (Quercus spp.), ash (Fraxinus spp.), Douglas-fir (Pseudotsuga menziesii) and California bay (Umbellularia californica). Elevation ranges from 148 to 4807 feet (45 to 1465 meters). Moderate Potential. Broadleaved upland forest is present within the Study Area; therefore, the Study Area may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment. Trees are not proposed for removal; therefore, there are no recommendations for this species. oval-leaved viburnum Viburnum ellipticum Rank 2B.3 Chaparral, cismontane woodland, lower montane coniferous forest. Elevation ranges from 706 to 4593 feet (215 to 1400 meters). A shrub, the blooming period is from May-Jun. Moderate Potential. Cismontane woodland is present within the Study Area and may provide suitable habitat for this species. Not Observed. This species was not observed during the biological assessment; however, the biological assessment was not conducted during the blooming period. It is recommended to survey for this species during the appropriate blooming period (May-Jun). Page 475 of 800 Page 30 of 101 TERRESTRIAL OR AQUATIC COMMUNITY HABITAT REQUIREMENTS POTENTIAL TO OCCUR IN THE STUDY AREA AND RECOMMENDATIONS Northern Interior Cypress Forest – Terrestrial (Holland 1986) Description: An open, fire-maintained scrubby “forest” similar to Knobcone Pine Forest but dominated by one of several Cupressus species. These stands may be as much as 15m tall, but usually are lower. Site Factors: On dry, rocky, sterile, often ultramafic soils, frequently associated with Serpentine Chaparral. Intergrades on less sever sites with Upper Sonoran Mixed Chaparral, Montane Chaparral, or Knobcone Pine Forest; and on more mesic site with Mixed Evergreen Forest or Montane Coniferous Forest. Characteristic Species: Cupressus abramsiana (Santa Cruz Mountains, on sandstone), C. bakeri (Cascade and northern Sierra Nevada, on serpentine or aerated basic sites), C. macnabiana (North Coast Ranges and northern Sierra Nevada, on serpentine), C. sargentii (North and South Coast ranges, on serpentine), Pinus attenuata, Quercus durata Distribution: Scattered through the Siskiyou Mountains, North and South Coast Ranges, Cascades and northern Sierra Nevada. Combining the four species into a single element is open to question but does reflect a common pattern of occurring on serpentine or other sterile substrate and moisture status intermediate between mesic Coastal Closed Cone Conifer Forests and xeric Southern Interior Cypress Forests. Unlikely. The Study Area is located predominantly within cismontane woodland and valley and foothill grassland and does contain Knobcone pine; however, serpentine soil or chaparral habitat is not present. It is unlikely for this terrestrial community to be present within the Study Area. This community was not observed during the biological assessment. There are no further recommendations for this community. Serpentine Bunchgrass (Holland 1986) Description: An open grassland dominated by perennial bunchgrasses. Total cover typically is low but is markedly dominated by native species (usually much more so than in Valley Needlegrass Grassland or Non-native Grasslands. Site Factors: Restricted to serpentine sites. Characteristic Species: Bromus hordeaceus, Calamagrostis ophiditis, Eschscholtzia californica, Pestuca grayii, Hemizonia luzulaefolia, Lotus subpinnatus, Melica californica, Poa scabrella, Stipa cernua, S. lepida, S. pulchra, Vulpia microstachys Distribution: Scattered widely through the Coast Ranges, less common in the Sierra Nevada and southern California mountains. No Potential. The Study Area is located within cismontane woodland, broadleaved upland forest and valley and foothill grassland; however, serpentine soil is not present. It is unlikely for this terrestrial community to be present within the Study Area. This community was not observed during the biological assessment. There are no further recommendations for this community. Page 476 of 800 Page 31 of 101 Abbreviation Organization FC Federal Candidate FE Federal Endangered FT Federal Threatened FPE Federally Proposed for listing as Endangered FPT Federally Proposed for listing as Threatened FPD Federally Proposed for delisting SC State Candidate SE State Endangered ST State Threatened SCE State Candidate for listing as Endangered SCT State Candidate for listing as Threatened SCD State Candidate for delisting Rank 1A CRPR Rank 1A: Presumed extirpated in California and either rare or extinct elsewhere Rank 1B CRPR Rank 1B: Plants rare, threatened or endangered in California and elsewhere Rank 2B CRPR Rank 2B: Plants rare, threatened, or endangered in California, but more common elsewhere Rank 3 CRPR Rank 3: Plants about which CNPS needs more information (a review list) Rank 4 CRPR Rank 4: Plants of limited distribution – a watch list Potential to Occur: No Potential. Habitat on and within 100 feet adjacent to the site is clearly unsuitable for the species requirements (cover, substrate, elevation, hydrology, plant community, site history, disturbance regime). Unlikely. Few of the habitat components meeting the species requirements are present, and/or the majority of habitat on and within 100 feet adjacent to the site is unsuitable or of very poor quality. The species is not likely to be found on the site. Moderate Potential. Some of the habitat components meeting the species requirements are present, and/or only some of the habitat on or within 100 feet adjacent to the site is unsuitable. The species has a moderate probability of being found on the site. High Potential. All of the habitat components meeting the species requirements are present and/or most of the habitat on or within 100 feet adjacent to the site is highly suitable. The species has a high probability of being found on the site.  Results and Recommendations: Present. Species was observed on the site or has been recorded (i.e. CNDDB, other reports) on the site recently. Not Present. Species is assumed to not be present due to a lack of key habitat components. Not Observed. Species was not observed during surveys.   Page 477 of 800 Page 32 of 101   Abbreviation Organization AFS_EN American Fisheries Society - Endangered AFS_TH American Fisheries Society - Threatened AFS_VU American Fisheries Society – Vulnerable BLM_S Bureau of Land Management – Sensitive BCC USFWS Birds of Conservation Concern CDF_S Calif. Dept. of Forestry & Fire Protection – Sensitive CDFW_SSC Calif. Dept. of Fish & Wildlife – Species of Special Concern CDFW_FP Calif. Dept. of Fish & Wildlife – Fully Protected CDFW_WL Calif. Dept. of Fish & Wildlife – Watch List IUCN_CR IUCN – Critically Endangered IUCN_EN IUCN – Endangered IUCN_NT IUCN – Near Threatened IUCN_VU IUCN – Vulnerable IUCN_LC IUCN – Least Concern IUCN_DD IUCN – Data Deficient IUCN_CD IUCN – Conservation Dependent NABCI_RWL North American Bird Conservation Initiative – Red Watch List NABCI_YWL North American Bird Conservation Initiative – Yellow Watch List NMFS_SC National Marine Fisheries Service – Species of Concern USFS_S U. S. Forest Service - Sensitive USFWS_BCC U. S. Fish & Wildlife Service Birds of Conservation Concern WBWG_H Western Bat Working Group – High Priority WBWG_MH Western Bat Working Group – Medium-High Priority WBWG_M Western Bat Working Group – Medium Priority WBWG_LM Western Bat Working Group – Low-Medium Priority Xerces: CI Xerces Society – Critically Imperiled Xerces: IM Xerces Society – Imperiled Xerces: VU Xerces Society – Vulnerable Xerces: DD Xerces Society – Data Deficient Page 478 of 800 Page 33 of 101 Ultramafic (serpentine) Affinity ≥ 5.5 strict endemic taxa with 95% of their occurrences on ultramafics < 5.5 ≥ 4.5 broad endemic taxa with 85-94% of their occurrences on ultramafics < 4.5 ≥ 3.5 transition from broad endemic to strong indicator taxa with 75-84% of their occurrences on ultramafics < 3.5 ≥ 2.5 strong indicator taxa with 65-74% of their occurrences on ultramafics < 2.5 ≥ 1.5 weak indicator taxa with 55-64% of their occurrences on ultramafics < 1.5 ≥ 1.0 weak indicator / indifferent taxa with 50-54% of their occurrences on ultramafics Page 479 of 800 Page 34 of 101 Appendix B: List of Species Observed Page 480 of 800 Page 35 of 101 SCIENTIFIC NAME COMMON NAME Plants Acer macrophyllum bigleaf maple Achillea millefolium common yarrow Acmispon brachycarpus short-podded lotus Adenostoma fasciculatum chamise Adiantum jordanii maiden hair fern Anaphalis margaritacea pearly everlasting Arbutus menziesii Pacific madrone Arctostaphylos canescens ssp. canescens hoary manzanita Arctostaphylos glandulosa ssp. glandulosa Eastwood manzanita Arctostaphylos manzanita spp. manzanita common manzanita Avena barbata slender wild oat Baccharis pilularis coyote bush Cardamine californica milk maids Cardamine hirsuta hairy bittercress Cardamine oligosperma Idaho bittercress Carduus pycnocephalus Italian thistle Ceanothus cuneatus var. cuneatus buckbrush Ceanothus foliosus var. foliosus wavyleaf ceanothus Cerastium glomeratum mouseear chickweed Cercocarpus betuloides mountain mahogany Chlorogalum pomeridianum var. pomeridianum wavyleaf soap plant Claytonia perfoliata miners lettuce Cynoglossum grande Pacific houndstongue Cynosurus echinatus bristly dogtail grass Delphinium nudicaule red larkspur Dichelostemma capitatum blue dicks Diplacus aurantiacus sticky mnkey flower Dryopteris arguta California wood fern Elymus glaucus blue wild rye Eriophyllum lanatum common woolly sunflower Erodium moschatum storks bill Erodium spp. geranium Erythronium californicum California fawn lily Festuca microstachys small fescue Festuca perennis Italian rye Fritillaria affinis checker lily Galium aparine cleavers Galium bolanderi Bolander's bedstraw Gastridium phleoides nit grass Page 481 of 800 Page 36 of 101 SCIENTIFIC NAME COMMON NAME Genista monspessulana french broom Geranium molle woodland geranium Heteromeles arbutifolia toyon Hieracium spp. hawkweed Holodiscus discolor oceanspray Hordeum brachyantherum common barley Hypericum concinnum goldwire Hypochaeris glabra smooth cats ear Iris macrosiphon ground iris Lomatum dasycarpum hog fennel Lonicera spp. honeysuckle Lotus corniculatus birdsfoot trefoil Lithophragma affine common woodland star Luzula comosa hairy wood rush Lysimachia latifolia Pacific star flower Medicago polymorpha bur clover Micranthes californica Greene's saxifrage Microcarpus californicus q-tips Mimulus aurantiacus sticky monkey flower Nemophila heterophylla small baby blue eyes Notholithocarpus densiflorus tanoak Pedicularis densiflora warrior's plume Pentagramma triangularis goldenback fern Phoradendron leucarpum ssp. tomentosum mistletoe Pinus attenuata knobcone pine Plagiobothrys tenellus slender popcorn flower Plantago lancelota English plantain Polypodium californicum California polypody Polypodium glycyrrhiza licorice fern Primula hendersonii Henderson's shooitng star Pseudotsuga menziesii Douglas-fir Pteridium aquilinum var. pubescens bracken fern Quercus berberidifolia scrub oak Quercus garryana Oregon white oak Page 482 of 800 Page 37 of 101 SCIENTIFIC NAME COMMON NAME Quercus kelloggii California black oak Quercus parvula var. shrevei Shreve oak Quercus wislizeni var. wislizeni interior live oak Ranunculus occidentalis western buttercup Rosa gymnocarpa wood rose Rumex acetosa sorrel Sanicula crassicaulis Pacific sanicle Scutellaria tuberosa skullcap Sequoia sempervirens coast redwood Stachys spp. hedgenettle Stellaria media chickweed Symphoricarpos albus snowberry Torreya californica California nutmeg Toxicodendron diversilobum poison oak Trientalis latifolia western star flower Trifolium microcephalum small headed clover Umbellularia californica California bay laurel Vicia americana American vetch Whipplea modesta modesty Wyethia glabra smooth mule ears Wildlife Amphibians N/A - Avifauna Aphelocoma californica western scrub jay Buteo jamaicensis red tailed hawk Buteo lineatus red-shouldered hawk Cathartes aura turkey vulture Colaptes auratus northern flicker Corvus corax common raven Junco hyemalis dark-eyed junco Melanerpes formicivorous acorn woodpecker Page 483 of 800 Page 38 of 101 SCIENTIFIC NAME COMMON NAME Fish N/A - Insects N/A - Mammals Odocoileus hemionus mule deer Mollusks N/A - Reptiles N/A - Page 484 of 800 Page 39 of 101 Appendix C: Photographs Page 485 of 800 Page 40 of 101 Photo 1: Overview of Study Area. Photo facing North. Date: February 5, 2021 Page 486 of 800 Page 41 of 101 Photo 2: Overview of Study Area. Photo facing East. Date: February 5, 2021 Page 487 of 800 Page 42 of 101 Photo 3: Overview of Study Area. Photo facing West. Date: February 5, 2021 Page 488 of 800 Page 43 of 101 Photo 4: Overview of Study Area. Photo facing Northwest. Date: February 5, 2021 Photo 5: Overview of Study Area. Photo facing Southwest. Date: February 5, 2021 Page 489 of 800 Page 44 of 101 Photo 6: Cleared area within Study Area. Photo facing Northwest. Date: February 5, 2021 Page 490 of 800 Page 45 of 101 Photo 7: Overview of Study Area. Photo facing Northeast. Date: February 5, 2021 Page 491 of 800 Page 46 of 101 Photo 8: Overview of Study Area. Photo facing North. Date: February 5, 2021 Page 492 of 800 Page 47 of 101 Photo 9: Overview of Study Area. Photo facing East. Date: February 5, 2021 Page 493 of 800 Page 48 of 101 Photo 10: Overview of Study Area. Photo facing Southeast. Date: February 5, 2021 Page 494 of 800 Page 49 of 101 Photo 11: Overview of Study Area. Photo facing West. Date: February 5, 2021 Page 495 of 800 Page 50 of 101 Photo 12: Overview of Study Area. Photo facing West. Date: February 5, 2021 Page 496 of 800 Page 51 of 101 Photo 13: Overview of Study Area. Photo facing West. Date: February 5, 2021 Page 497 of 800 Page 52 of 101 Photo 14: Overview of Study Area. Photo facing South. Date: February 5, 2021 Page 498 of 800 Page 53 of 101 Photo 15: Overview of Study Area. Photo facing Southwest. Date: February 5, 2021 Page 499 of 800 Page 54 of 101 Photo 15: Clearing within Study Area. Photo facing North. Date: February 5, 2021 Page 500 of 800 Page 55 of 101 Photo 17: Overview of Study Area (at edge looking towards Ukiah). Photo facing East. Date: February 5, 2021 Page 501 of 800 Page 56 of 101 Photo 18: Within a clearing in Study Area (and looking past). Photo facing Northeast. Date: February 5, 2021 Page 502 of 800 Page 57 of 101 Photo 19: Overview of Study Area. Photo facing North. Date: February 5, 2021 Page 503 of 800 Page 58 of 101 Photo 20: Overview of Study Area (showing road). Photo facing West. Date: February 5, 2021 Page 504 of 800 Page 59 of 101 Photo 21: Overview of Study Area (showing cleared area). Photo facing West. Date: February 5, 2021 Page 505 of 800 Page 60 of 101 Photo 22: Overview of Study Area (showing road). Photo facing West. Date: February 5, 2021 Page 506 of 800 Page 61 of 101 Photo 23: Overview of Study Area. Photo facing East. Date: February 5, 2021 Page 507 of 800 Page 62 of 101 Photo 24: Overview of Study Area. Photo facing West. Date: February 5, 2021 Page 508 of 800 Page 63 of 101 Appendix D: Maps Page 509 of 800 ! ! ! ! !! !! !! !! !! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !! !! !! !! !!!!!! !!!! ! ! ! ! !! ! ! ! ! !! !! ! ! !!!! !! !! !!!! !! !! !! !! !!!! ! ! !! !!!! !! !! !! !! !! !! !! !! !! !! ! ! !!!!! ! !! ! !!! !! !! ! ! !! ! ! ! ! ! ! ! ! !! !!!!!!!!!!!! ! ! ! ! ! ! !!!!!! !! !! !! !! !!!! ! ! ! ! !! !!!! !! ! ! !! !! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! 15707002 0031900115707001 00104083 Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap contributors, and the GIS User Community1 inch = 500 feet 0 500250 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 Study Area Topographic Map Parcels Proposed subdivision area Existing Roads ! ! !Class III watercourse ! !! !Class II watercourse ! !Class I watercourse Page 510 of 800 !! !! !! !! !! !! !!!!!!!!!! !! !!!! ! ! ! ! ! ! !! !! !! ! ! ! ! ! ! !! !! !! !! !! !! !!!! !! !! !! !! !! !! !! !! !! !! !! !! !!!!!!!!!!!!!! !! !! !!!! !! !! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! !!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! !! !! !! !! !! !!!!!!!!!!!!! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community1 inch = 300 feet 0 300150 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 Study Area Aerial Map Proposed subdivision area Existing Roads ! ! !Class III watercourse ! !! !Class II watercourse ! !Class I watercourse Page 511 of 800 Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap contributors, and the GIS User Community1 inch = 9,000 feet 0 9,0004,500 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 CNDDB Vicinity Map Proposed subdivision area 5 mile radius Plant (80m) Plant (specific) Plant (non-specific) Plant (circular) Animal (80m) Animal (specific) Animal (non-specific) Animal (circular) Terrestrial Comm. (80m) Terrestrial Comm. (specific) Terrestrial Comm. (non-specific) Terrestrial Comm. (circular) Aquatic Comm. (80m) Aquatic Comm. (specific) Aquatic Comm. (non-specific) Aquatic Comm. (circular) Multiple (80m) Multiple (specific) Multiple (non-specific) Multiple (circular) Sensitive EO's (Commercial only) Page 512 of 800 Soil Map—Mendocino County, Eastern Part and Southwestern Part of Trinity County, California (City of Ukiah-Hull Property) Natural Resources Conservation Service Web Soil Survey National Cooperative Soil Survey 3/8/2021 Page 1 of 3 43 3 1 8 0 0 43 3 1 9 0 0 43 3 2 0 0 0 43 3 2 1 0 0 43 3 2 2 0 0 43 3 2 3 0 0 43 3 1 8 0 0 43 3 1 9 0 0 43 3 2 0 0 0 43 3 2 1 0 0 43 3 2 2 0 0 43 3 2 3 0 0 480200 480300 480400 480500 480600 480700 480800 480900 481000 481100 480200 480300 480400 480500 480600 480700 480800 480900 481000 481100 39° 8' 24'' N 12 3 ° 1 3 ' 4 6 ' ' W 39° 8' 24'' N 12 3 ° 1 3 ' 5 ' ' W 39° 8' 4'' N 12 3 ° 1 3 ' 4 6 ' ' W 39° 8' 4'' N 12 3 ° 1 3 ' 5 ' ' W N Map projection: Web Mercator Corner coordinates: WGS84 Edge tics: UTM Zone 10N WGS84 0 200 400 800 1200Feet 0 50 100 200 300Meters Map Scale: 1:4,480 if printed on A landscape (11" x 8.5") sheet. Soil Map may not be valid at this scale. Page 513 of 800 MAP LEGEND MAP INFORMATION Area of Interest (AOI) Area of Interest (AOI) Soils Soil Map Unit Polygons Soil Map Unit Lines Soil Map Unit Points Special Point Features Blowout Borrow Pit Clay Spot Closed Depression Gravel Pit Gravelly Spot Landfill Lava Flow Marsh or swamp Mine or Quarry Miscellaneous Water Perennial Water Rock Outcrop Saline Spot Sandy Spot Severely Eroded Spot Sinkhole Slide or Slip Sodic Spot Spoil Area Stony Spot Very Stony Spot Wet Spot Other Special Line Features Water Features Streams and Canals Transportation Rails Interstate Highways US Routes Major Roads Local Roads Background Aerial Photography The soil surveys that comprise your AOI were mapped at 1:24,000. Warning: Soil Map may not be valid at this scale. Enlargement of maps beyond the scale of mapping can cause misunderstanding of the detail of mapping and accuracy of soil line placement. The maps do not show the small areas of contrasting soils that could have been shown at a more detailed scale. Please rely on the bar scale on each map sheet for map measurements. Source of Map: Natural Resources Conservation Service Web Soil Survey URL: Coordinate System: Web Mercator (EPSG:3857) Maps from the Web Soil Survey are based on the Web Mercator projection, which preserves direction and shape but distorts distance and area. A projection that preserves area, such as the Albers equal-area conic projection, should be used if more accurate calculations of distance or area are required. This product is generated from the USDA-NRCS certified data as of the version date(s) listed below. Soil Survey Area: Mendocino County, Eastern Part and Southwestern Part of Trinity County, California Survey Area Data: Version 15, Jun 1, 2020 Soil map units are labeled (as space allows) for map scales 1:50,000 or larger. Date(s) aerial images were photographed: May 5, 2019—Jun 3, 2019 The orthophoto or other base map on which the soil lines were compiled and digitized probably differs from the background imagery displayed on these maps. As a result, some minor shifting of map unit boundaries may be evident. Soil Map—Mendocino County, Eastern Part and Southwestern Part of Trinity County, California (City of Ukiah-Hull Property) Natural Resources Conservation Service Web Soil Survey National Cooperative Soil Survey 3/8/2021 Page 2 of 3Page 514 of 800 Map Unit Legend Map Unit Symbol Map Unit Name Acres in AOI Percent of AOI 141 Hopland loam, 30 to 50 percent slopes, high ffd 18.6 31.4% 151 Hopland-Wohly loams, 50 to 75 percent slopes 40.6 68.6% Totals for Area of Interest 59.2 100.0% Soil Map—Mendocino County, Eastern Part and Southwestern Part of Trinity County, California City of Ukiah-Hull Property Natural Resources Conservation Service Web Soil Survey National Cooperative Soil Survey 3/8/2021 Page 3 of 3 Page 515 of 800 !!!! !! !! !! !! !! !! !! !! !! ! ! ! ! ! ! ! ! ! ! !! !! !! ! ! !! !!!! !! !! !! !! !! !!!!!!!! !! !! !! !! !! !! !!!!!!!!!!!!!! !! !! !!!! !! !! !! !! !!!!!! !!!! ! ! ! ! !! ! ! ! ! !! !! ! ! !!!! !! !! !!!! !! !! !! !! !!!! ! ! !! !!!! !! !! !! !! !! !! !! !! !! !! ! ! !!!!! ! !! ! !!! !! !! ! ! !! ! ! ! ! ! ! ! ! !! !!!!!!!!!!!! ! ! ! ! ! ! !!!!!! !! !! !!!!!!!!!! ! ! !! !!!! !! ! ! !! !! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap contributors, and the GIS User Community1 inch = 500 feet 0 500250 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 Intrinsic Potential Map Proposed subdivision area Central Coast Steelhead Intrinsic Potential ! ! !Class III watercourse ! !! !Class II watercourse ! !Class I watercourse Page 516 of 800 !!!! !! !! !! !! !! !! !! !! !! ! ! ! ! ! ! ! ! ! ! !! !! !! ! ! !! !!!! !! !! !! !! !! !!!!!!!! !! !! !! !! !! !! !!!!!!!!!!!!!! !! !! !!!! !! !! !! !! !!!!!! !!!! ! ! ! ! !! ! ! ! ! !! !! ! ! !!!! !! !! !!!! !! !! !! !! !!!! ! ! !! !!!! !! !! !! !! !! !! !! !! !! !! ! ! !!!!! ! !! ! !!! !! !! ! ! !! ! ! ! ! ! ! ! ! !! !!!!!!!!!!!! ! ! ! ! ! ! !!!!!! !! !! !!!!!!!!!! ! ! !! !!!! !! ! ! !! !! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap contributors, and the GIS User Community1 inch = 500 feet 0 500250 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 Intrinsic Potential Map Proposed subdivision area Coho Intrinsic Potential ! ! !Class III watercourse ! !! !Class II watercourse ! !Class I watercourse Page 517 of 800 Pacific Douglas-Fir Douglas-Fir - Ponderosa Pine Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood ChamiseChamise Chamise Chamise Chamise Chamise Chamise Chamise Chamise Chamise Pacific Douglas-Fir Pacific Douglas-Fir Pacific Douglas-Fir Pacific Douglas-Fir Pacific Douglas-Fir Pacific Douglas-Fir Pacific Douglas-Fir Douglas-Fir - Ponderosa Pine Douglas-Fir - Ponderosa Pine Pacific Douglas-Fir Oregon White Oak Oregon White Oak Oregon White Oak Oregon White Oak Oregon White Oak Oregon White Oak Oregon White Oak Oregon White Oak Oregon White Oak Black Oak Interior Live Oak Interior Live Oak Interior Live Oak Interior Live Oak Interior Live Oak Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Interior Mixed Hardwood Source: Esri, DigitalGlobe, GeoEye, Earthstar Geographics, CNES/Airbus DS, USDA, USGS, AeroGRID, IGN, and the GIS User Community1 inch = 300 feet 0 300150 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 CALVEG Classification Map Proposed subdivision area Black Oak Chamise Douglas-Fir - Ponderosa Pine Interior Live Oak Interior Mixed Hardwood Oregon White Oak Pacific Douglas-Fir Page 518 of 800 !!! !!! !!!!!! !!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !! !! !! !! !! !!!!!!!!!! !!!!!!!!!!!!!!!! !! !! !! !!!!!!!!!!!!!!!!!!!!!!!!!!!! !! !! !! !! !! !! !! !! !! !! !! !! !! !! !! ! ! ! ! !! !! !! !! !! !! !! !! !! !! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !!!!!!!!!!!!!!!!!! !! !! !! !! !!!!!!!!!! !! !! !!!!!!!!!!!!!!!!!! !! !! !! !! !!!!!!!!!!!!!!!!!! !! !! !! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! !! !! !!!!!!!!!!!!!! 6RXUFH(VUL'LJLWDO*OREH*HR(\H(DUWKVWDU*HRJUDSKLFV&1(6$LUEXV'686'$86*6$HUR*5,' ,*1DQGWKH*,68VHU&RPPXQLW\ IHHW ¯%LRORJLFDO5HVRXUFH$VVHVVPHQW $31V   6HFWLRQV 715:0'%0 8NLDK86*60LQXWH4XDGUDQJOH 0+ 0&9&ODVVLILFDWLRQ0DS 3URSRVHGVXEGLYLVLRQDUHD !! !! !!&ODVV,,ZDWHUFRXUVH !! ! !!!&ODVV,,,ZDWHUFRXUVH ([LVWLQJ5RDGV 0&9 %ODFN2DN:RRGODQG &DOLIRUQLD%D\:RRGODQG 'RXJODVILU)RUHVW .QREFRQH3LQH)RUHVW :KLWH2DN:RRGODQG Page 519 of 800 !!!! !! !! !! !! !! !! !! !! !! ! ! ! ! ! ! ! ! ! ! !! !! !! ! ! !! !!!! !! !! !! !! !! !!!!!!!! !! !! !! !! !! !! !!!!!!!!!!!!!! !! !! !!!! !! !! !! !! !!!!!! !!!! ! ! ! ! !! ! ! ! ! !! !! ! ! !!!! !! !! !!!! !! !! !! !! !!!! ! ! !! !!!! !! !! !! !! !! !! !! !! !! !! ! ! !!!!! ! !! ! !!! !! !! ! ! !! ! ! ! ! ! ! ! ! !! !!!!!!!!!!!! ! ! ! ! ! ! !!!!!! !! !! !!!!!!!!!! ! ! !! !!!! !! ! ! !! !! ! ! ! ! ! ! ! ! ! ! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap contributors, and the GIS User Community1 inch = 500 feet 0 500250 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 NWIC Wetlands Map Proposed subdivision area NWIC Wetlands Page 520 of 800 !!!! !! !! !! !! !! !! !! !! !! ! ! ! ! ! ! ! ! !! !! !! !! ! ! !! !!!! !! !! !! !! !! !!!!!!!! !! !! !! !! !! !! !!!! !!!!!!!!!! !! !! !!!! !! !! !! !! !!!!!! !!!! ! ! ! ! !! ! ! ! ! !! !! !! !!!! !! !! !!!! !! !! !! !!!!!!!!!! !!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! !! !!!!!!!!!!!! ! ! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! ! ! !! ! ! ! ! ! ! ! ! !!!!!! ! ! !!!!!! ! !!!!! !!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! Sources: Esri, HERE, Garmin, Intermap, increment P Corp., GEBCO, USGS, FAO, NPS, NRCAN, GeoBase, IGN, Kadaster NL, Ordnance Survey, Esri Japan, METI, Esri China (Hong Kong), swisstopo, © OpenStreetMap contributors, and the GIS User Community1 inch = 500 feet 0 500250 feet ¯Biological Resource Assessment APNs: 001-040-83, 157-01, 157-070-02 & 003-190-01 Sections 19 & 30, T15N, R12W, MDBM Ukiah USGS 7.5 Minute Quadrangle AIR 03/05/2021 FEMA National Flood Hazard Layer Map Proposed subdivision area 100 YEAR FLOOD ZONE Page 521 of 800 Page 64 of 101 Appendix E: Supporting Documents Page 522 of 800 February 23, 2021 United States Department of the Interior FISH AND WILDLIFE SERVICE Arcata Fish And Wildlife Office 1655 Heindon Road Arcata, CA 95521-4573 Phone: (707) 822-7201 Fax: (707) 822-8411 In Reply Refer To: Consultation Code: 08EACT00-2021-SLI-0169 Event Code: 08EACT00-2021-E-00382 Project Name: City of Ukiah Subject:List of threatened and endangered species that may occur in your proposed project location or may be affected by your proposed project To Whom It May Concern: The enclosed species list identifies threatened, endangered, proposed and candidate species, as well as proposed and final designated critical habitat, that may occur within the boundary of your proposed project and/or may be affected by your proposed project. The species list fulfills the requirements of the U.S. Fish and Wildlife Service (Service) under section 7(c) of the Endangered Species Act (Act) of 1973, as amended (16 U.S.C. 1531 et seq.). New information based on updated surveys, changes in the abundance and distribution of species, changed habitat conditions, or other factors could change this list. Please feel free to contact us if you need more current information or assistance regarding the potential impacts to federally proposed, listed, and candidate species and federally designated and proposed critical habitat. Please note that under 50 CFR 402.12(e) of the regulations implementing section 7 of the Act, the accuracy of this species list should be verified after 90 days. This verification can be completed formally or informally as desired. The Service recommends that verification be completed by visiting the ECOS-IPaC website at regular intervals during project planning and implementation for updates to species lists and information. An updated list may be requested through the ECOS-IPaC system by completing the same process used to receive the enclosed list. The purpose of the Act is to provide a means whereby threatened and endangered species and the ecosystems upon which they depend may be conserved. Under sections 7(a)(1) and 7(a)(2) of the Act and its implementing regulations (50 CFR 402 et seq.), Federal agencies are required to utilize their authorities to carry out programs for the conservation of threatened and endangered species and to determine whether projects may affect threatened and endangered species and/or designated critical habitat. A Biological Assessment is required for construction projects (or other undertakings having similar physical impacts) that are major Federal actions significantly affecting the quality of the human environment as defined in the National Environmental Policy Act (42 U.S.C. 4332(2) Page 523 of 800 02/23/2021 Event Code: 08EACT00-2021-E-00382   2    ▪ (c)). For projects other than major construction activities, the Service suggests that a biological evaluation similar to a Biological Assessment be prepared to determine whether the project may affect listed or proposed species and/or designated or proposed critical habitat. Recommended contents of a Biological Assessment are described at 50 CFR 402.12. If a Federal agency determines, based on the Biological Assessment or biological evaluation, that listed species and/or designated critical habitat may be affected by the proposed project, the agency is required to consult with the Service pursuant to 50 CFR 402. In addition, the Service recommends that candidate species, proposed species and proposed critical habitat be addressed within the consultation. More information on the regulations and procedures for section 7 consultation, including the role of permit or license applicants, can be found in the "Endangered Species Consultation Handbook" at: http://www.fws.gov/endangered/esa-library/pdf/TOC-GLOS.PDF Please be aware that bald and golden eagles are protected under the Bald and Golden Eagle Protection Act (16 U.S.C. 668 et seq.), and projects affecting these species may require development of an eagle conservation plan (http://www.fws.gov/windenergy/eagle_guidance.html). Additionally, wind energy projects should follow the wind energy guidelines (http://www.fws.gov/windenergy/) for minimizing impacts to migratory birds and bats. Guidance for minimizing impacts to migratory birds for projects including communications towers (e.g., cellular, digital television, radio, and emergency broadcast) can be found at: http://www.fws.gov/migratorybirds/CurrentBirdIssues/Hazards/towers/towers.htm; http://www.towerkill.com; and http:// www.fws.gov/migratorybirds/CurrentBirdIssues/Hazards/towers/comtow.html. We appreciate your concern for threatened and endangered species. The Service encourages Federal agencies to include conservation of threatened and endangered species into their project planning to further the purposes of the Act. Please include the Consultation Tracking Number in the header of this letter with any request for consultation or correspondence about your project that you submit to our office. Attachment(s): Official Species List Page 524 of 800 02/23/2021 Event Code: 08EACT00-2021-E-00382   1    Official Species List This list is provided pursuant to Section 7 of the Endangered Species Act, and fulfills the requirement for Federal agencies to "request of the Secretary of the Interior information whether any species which is listed or proposed to be listed may be present in the area of a proposed action". This species list is provided by: Arcata Fish And Wildlife Office 1655 Heindon Road Arcata, CA 95521-4573 (707) 822-7201 This project's location is within the jurisdiction of offices which do not participate in IPaC's automated species list delivery. Please contact the following offices directly for more information: Red Bluff Fish And Wildlife Office 10950 Tyler Road Red Bluff, CA 96080-7762 (530) 527-3043 Page 525 of 800 02/23/2021 Event Code: 08EACT00-2021-E-00382   2    Project Summary Consultation Code:08EACT00-2021-SLI-0169 Event Code:08EACT00-2021-E-00382 Project Name:City of Ukiah Project Type:LAND - ACQUISITION Project Description:Parcel line adjustment to create 7 lots within approximately 55 acres Project Location: Approximate location of the project can be viewed in Google Maps: https:// www.google.com/maps/@39.13734495,-123.22381603736494,14z Counties:Mendocino County, California Page 526 of 800 02/23/2021 Event Code: 08EACT00-2021-E-00382   3    1. Endangered Species Act Species There is a total of 7 threatened, endangered, or candidate species on this species list. Species on this list should be considered in an effects analysis for your project and could include species that exist in another geographic area. For example, certain fish may appear on the species list because a project could affect downstream species. IPaC does not display listed species or critical habitats under the sole jurisdiction of NOAA Fisheries , as USFWS does not have the authority to speak on behalf of NOAA and the Department of Commerce. See the "Critical habitats" section below for those critical habitats that lie wholly or partially within your project area under this office's jurisdiction. Please contact the designated FWS office if you have questions. NOAA Fisheries, also known as the National Marine Fisheries Service (NMFS), is an office of the National Oceanic and Atmospheric Administration within the Department of Commerce. Birds NAME STATUS Northern Spotted Owl Strix occidentalis caurina There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/1123 Threatened Western Snowy Plover Charadrius nivosus nivosus Population: Pacific Coast population DPS-U.S.A. (CA, OR, WA), Mexico (within 50 miles of Pacific coast) There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/8035 Threatened Yellow-billed Cuckoo Coccyzus americanus Population: Western U.S. DPS There is proposed critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/3911 Threatened Amphibians NAME STATUS California Red-legged Frog Rana draytonii There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/2891 Threatened 1 Page 527 of 800 02/23/2021 Event Code: 08EACT00-2021-E-00382   4    Flowering Plants NAME STATUS Burke's Goldfields Lasthenia burkei No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/4338 Endangered Contra Costa Goldfields Lasthenia conjugens There is final critical habitat for this species. The location of the critical habitat is not available. Species profile: https://ecos.fws.gov/ecp/species/7058 Endangered Showy Indian Clover Trifolium amoenum No critical habitat has been designated for this species. Species profile: https://ecos.fws.gov/ecp/species/6459 Endangered Critical habitats THERE ARE NO CRITICAL HABITATS WITHIN YOUR PROJECT AREA UNDER THIS OFFICE'S JURISDICTION. Page 528 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  &1''%4XDG6SHFLHV/LVW UHFRUGV (OHPHQW 7\SH 6FLHQWLILF1DPH &RPPRQ1DPH (OHPHQW&RGH )HGHUDO 6WDWXV 6WDWH 6WDWXV &'): 6WDWXV &$5DUH 3ODQW 5DQN 4XDG &RGH 4XDG1DPH 'DWD6WDWXV 7D[RQRPLF6RUW $QLPDOV $PSKLELDQV 'LFDPSWRGRQ HQVDWXV &DOLIRUQLDJLDQWVDODPDQGHU $$$$+ 1RQH 1RQH 66&   /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV$PSKLELDQV 'LFDPSWRGRQWLGDH 'LFDPSWRGRQHQVDWXV $QLPDOV $PSKLELDQV 5DQDDXURUD QRUWKHUQUHGOHJJHGIURJ $$$%+ 1RQH 1RQH 66&   /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDDXURUD $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   /$8*+/,1 5$1*( 0DSSHGDQG 8QSURFHVVHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   5(':22' 9$//(< 0DSSHGDQG 8QSURFHVVHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   3277(5 9$//(<0DSSHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   2556 635,1*6 0DSSHGDQG 8QSURFHVVHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   8.,$+ 0DSSHGDQG 8QSURFHVVHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   &2: 02817$,1 0DSSHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   %2219,//( 0DSSHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   (//('*( 3($. 0DSSHGDQG 8QSURFHVVHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 5DQDER\OLL IRRWKLOO\HOORZOHJJHGIURJ $$$%+ 1RQH (QGDQJHUHG 66&   385'<6 *$5'(16 0DSSHG $QLPDOV$PSKLELDQV 5DQLGDH5DQDER\OLL $QLPDOV $PSKLELDQV 7DULFKDULYXODULV UHGEHOOLHGQHZW $$$$) 1RQH 1RQH 66&   %2219,//( 0DSSHG $QLPDOV$PSKLELDQV 6DODPDQGULGDH7DULFKD ULYXODULV $QLPDOV $PSKLELDQV 7DULFKDULYXODULV UHGEHOOLHGQHZW $$$$) 1RQH 1RQH 66&   (//('*( 3($.0DSSHG $QLPDOV$PSKLELDQV 6DODPDQGULGDH7DULFKD ULYXODULV $QLPDOV $PSKLELDQV 7DULFKDULYXODULV UHGEHOOLHGQHZW $$$$) 1RQH 1RQH 66&   &2: 02817$,1 0DSSHG $QLPDOV$PSKLELDQV 6DODPDQGULGDH7DULFKD ULYXODULV $QLPDOV $PSKLELDQV 7DULFKDULYXODULV UHGEHOOLHGQHZW $$$$) 1RQH 1RQH 66&   8.,$+ 0DSSHGDQG 8QSURFHVVHG $QLPDOV$PSKLELDQV 6DODPDQGULGDH7DULFKD ULYXODULV $QLPDOV $PSKLELDQV 7DULFKDULYXODULV UHGEHOOLHGQHZW $$$$) 1RQH 1RQH 66&   2556 635,1*6 0DSSHG $QLPDOV$PSKLELDQV 6DODPDQGULGDH7DULFKD ULYXODULV $QLPDOV $PSKLELDQV 7DULFKDULYXODULV UHGEHOOLHGQHZW $$$$) 1RQH 1RQH 66&   /$8*+/,1 5$1*(0DSSHG $QLPDOV$PSKLELDQV 6DODPDQGULGDH7DULFKD ULYXODULV $QLPDOV %LUGV $FFLSLWHUJHQWLOLV QRUWKHUQJRVKDZN $%1.& 1RQH 1RQH 66&   3277(5 9$//(<0DSSHG $QLPDOV%LUGV $FFLSLWULGDH$FFLSLWHU JHQWLOLV Page 529 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  $QLPDOV %LUGV $TXLODFKU\VDHWRV JROGHQHDJOH $%1.& 1RQH 1RQH )3 :/  &2: 02817$,1 8QSURFHVVHG $QLPDOV%LUGV $FFLSLWULGDH$TXLOD FKU\VDHWRV $QLPDOV %LUGV $TXLODFKU\VDHWRV JROGHQHDJOH $%1.& 1RQH 1RQH )3 :/  385'<6 *$5'(16 8QSURFHVVHG $QLPDOV%LUGV $FFLSLWULGDH$TXLOD FKU\VDHWRV $QLPDOV %LUGV &LUFXVKXGVRQLXV QRUWKHUQKDUULHU $%1.& 1RQH 1RQH 66&   385'<6 *$5'(16 8QSURFHVVHG $QLPDOV%LUGV $FFLSLWULGDH&LUFXV KXGVRQLXV $QLPDOV %LUGV (ODQXVOHXFXUXV ZKLWHWDLOHGNLWH $%1.& 1RQH 1RQH )3   5(':22' 9$//(<8QSURFHVVHG $QLPDOV%LUGV $FFLSLWULGDH(ODQXV OHXFXUXV $QLPDOV %LUGV $UGHDKHURGLDV JUHDWEOXHKHURQ $%1*$ 1RQH 1RQH    8.,$+ 8QSURFHVVHG $QLPDOV%LUGV$UGHLGDH $UGHDKHURGLDV $QLPDOV %LUGV $JHODLXVWULFRORU WULFRORUHGEODFNELUG $%3%;% 1RQH 7KUHDWHQHG 66&   3277(5 9$//(<0DSSHG $QLPDOV%LUGV,FWHULGDH $JHODLXVWULFRORU $QLPDOV %LUGV ,FWHULDYLUHQV \HOORZEUHDVWHGFKDW $%3%; 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV%LUGV,FWHULLGDH ,FWHULDYLUHQV $QLPDOV %LUGV ,FWHULDYLUHQV \HOORZEUHDVWHGFKDW $%3%; 1RQH 1RQH 66&   5(':22' 9$//(<8QSURFHVVHG $QLPDOV%LUGV,FWHULLGDH ,FWHULDYLUHQV $QLPDOV %LUGV ,FWHULDYLUHQV \HOORZEUHDVWHGFKDW $%3%; 1RQH 1RQH 66&   8.,$+ 8QSURFHVVHG $QLPDOV%LUGV,FWHULLGDH ,FWHULDYLUHQV $QLPDOV %LUGV ,FWHULDYLUHQV \HOORZEUHDVWHGFKDW $%3%; 1RQH 1RQH 66&   &2: 02817$,1 8QSURFHVVHG $QLPDOV%LUGV,FWHULLGDH ,FWHULDYLUHQV $QLPDOV %LUGV ,FWHULDYLUHQV \HOORZEUHDVWHGFKDW $%3%; 1RQH 1RQH 66&   (//('*( 3($.8QSURFHVVHG $QLPDOV%LUGV,FWHULLGDH ,FWHULDYLUHQV $QLPDOV %LUGV 3DQGLRQKDOLDHWXV RVSUH\$%1.& 1RQH 1RQH :/   385'<6 *$5'(16 0DSSHG $QLPDOV%LUGV 3DQGLRQLGDH3DQGLRQ KDOLDHWXV $QLPDOV %LUGV 3DQGLRQKDOLDHWXV RVSUH\$%1.& 1RQH 1RQH :/   8.,$+ 0DSSHG $QLPDOV%LUGV 3DQGLRQLGDH3DQGLRQ KDOLDHWXV $QLPDOV %LUGV 3DQGLRQKDOLDHWXV RVSUH\$%1.& 1RQH 1RQH :/   3277(5 9$//(<8QSURFHVVHG $QLPDOV%LUGV 3DQGLRQLGDH3DQGLRQ KDOLDHWXV $QLPDOV %LUGV %DHRORSKXV LQRUQDWXV RDNWLWPRXVH $%3$: 1RQH 1RQH    8.,$+ 8QSURFHVVHG $QLPDOV%LUGV3DULGDH %DHRORSKXVLQRUQDWXV $QLPDOV %LUGV %DHRORSKXV LQRUQDWXV RDNWLWPRXVH $%3$: 1RQH 1RQH    (//('*( 3($.8QSURFHVVHG $QLPDOV%LUGV3DULGDH %DHRORSKXVLQRUQDWXV $QLPDOV %LUGV %DHRORSKXV LQRUQDWXV RDNWLWPRXVH $%3$: 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG $QLPDOV%LUGV3DULGDH %DHRORSKXVLQRUQDWXV $QLPDOV %LUGV 6HWRSKDJDSHWHFKLD \HOORZZDUEOHU $%3%; 1RQH 1RQH 66&   (//('*( 3($.8QSURFHVVHG $QLPDOV%LUGV3DUXOLGDH 6HWRSKDJDSHWHFKLD $QLPDOV %LUGV 6HWRSKDJDSHWHFKLD \HOORZZDUEOHU $%3%; 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV%LUGV3DUXOLGDH 6HWRSKDJDSHWHFKLD $QLPDOV %LUGV $PPRGUDPXV VDYDQQDUXP JUDVVKRSSHUVSDUURZ $%3%;$ 1RQH 1RQH 66&   385'<6 *$5'(16 0DSSHG $QLPDOV%LUGV 3DVVHUHOOLGDH $PPRGUDPXVVDYDQQDUXP Page 530 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  $QLPDOV %LUGV 0HODQHUSHVOHZLV /HZLV ZRRGSHFNHU $%1<) 1RQH 1RQH    (//('*( 3($.8QSURFHVVHG $QLPDOV%LUGV3LFLGDH 0HODQHUSHVOHZLV $QLPDOV %LUGV 0HODQHUSHVOHZLV /HZLV ZRRGSHFNHU $%1<) 1RQH 1RQH    8.,$+ 8QSURFHVVHG $QLPDOV%LUGV3LFLGDH 0HODQHUSHVOHZLV $QLPDOV %LUGV 6WUL[RFFLGHQWDOLV FDXULQD 1RUWKHUQ6SRWWHG2ZO $%16% 7KUHDWHQHG 7KUHDWHQHG    %2219,//( 0DSSHG $QLPDOV%LUGV6WULJLGDH 6WUL[RFFLGHQWDOLVFDXULQD $QLPDOV %LUGV 6WUL[RFFLGHQWDOLV FDXULQD 1RUWKHUQ6SRWWHG2ZO $%16% 7KUHDWHQHG 7KUHDWHQHG    2556 635,1*6 0DSSHG $QLPDOV%LUGV6WULJLGDH 6WUL[RFFLGHQWDOLVFDXULQD $QLPDOV %LUGV 6WUL[RFFLGHQWDOLV FDXULQD 1RUWKHUQ6SRWWHG2ZO $%16% 7KUHDWHQHG 7KUHDWHQHG    3277(5 9$//(<0DSSHG $QLPDOV%LUGV6WULJLGDH 6WUL[RFFLGHQWDOLVFDXULQD $QLPDOV %LUGV 6WUL[RFFLGHQWDOLV FDXULQD 1RUWKHUQ6SRWWHG2ZO $%16% 7KUHDWHQHG 7KUHDWHQHG    5(':22' 9$//(<0DSSHG $QLPDOV%LUGV6WULJLGDH 6WUL[RFFLGHQWDOLVFDXULQD $QLPDOV %LUGV 6WUL[RFFLGHQWDOLV FDXULQD 1RUWKHUQ6SRWWHG2ZO $%16% 7KUHDWHQHG 7KUHDWHQHG    /$8*+/,1 5$1*(0DSSHG $QLPDOV%LUGV6WULJLGDH 6WUL[RFFLGHQWDOLVFDXULQD $QLPDOV )LVK /DYLQLDV\PPHWULFXV QDYDUURHQVLV 1DYDUURURDFK $)&-% 1RQH 1RQH 66&   2556 635,1*6 8QSURFHVVHG $QLPDOV)LVK&\SULQLGDH /DYLQLDV\PPHWULFXV QDYDUURHQVLV $QLPDOV )LVK /DYLQLDV\PPHWULFXV VVS &OHDU/DNH5XVVLDQ5LYHU URDFK $)&-% 1RQH 1RQH 66&   /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK&\SULQLGDH /DYLQLDV\PPHWULFXVVVS  $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL ODJXQDH &OHDU/DNHWXOHSHUFK $)&4. 1RQH 1RQH 66&   &2: 02817$,1 0DSSHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLL ODJXQDH $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   &2: 02817$,1 8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   (//('*( 3($.8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   8.,$+ 8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   2556 635,1*6 8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   5(':22' 9$//(<8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR $QLPDOV )LVK +\VWHURFDUSXVWUDVNLL SRPR 5XVVLDQ5LYHUWXOHSHUFK $)&4. 1RQH 1RQH 66&   385'<6 *$5'(16 8QSURFHVVHG $QLPDOV)LVK (PELRWRFLGDH +\VWHURFDUSXVWUDVNLLSRPR Page 531 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  $QLPDOV )LVK (QWRVSKHQXV WULGHQWDWXV 3DFLILFODPSUH\$)%$$ 1RQH 1RQH 66&   /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK 3HWURP\]RQWLGDH (QWRVSKHQXVWULGHQWDWXV $QLPDOV )LVK (QWRVSKHQXV WULGHQWDWXV 3DFLILFODPSUH\$)%$$ 1RQH 1RQH 66&   2556 635,1*6 8QSURFHVVHG $QLPDOV)LVK 3HWURP\]RQWLGDH (QWRVSKHQXVWULGHQWDWXV $QLPDOV )LVK 2QFRUK\QFKXV NLVXWFKSRS FRKRVDOPRQVRXWKHUQ 2UHJRQQRUWKHUQ&DOLIRUQLD (68 $)&+$ 7KUHDWHQHG 7KUHDWHQHG    /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVNLVXWFKSRS  $QLPDOV )LVK 2QFRUK\QFKXV NLVXWFKSRS FRKRVDOPRQFHQWUDO &DOLIRUQLDFRDVW(68 $)&+$ (QGDQJHUHG (QGDQJHUHG    8.,$+ 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVNLVXWFKSRS  $QLPDOV )LVK 2QFRUK\QFKXV NLVXWFKSRS FRKRVDOPRQFHQWUDO &DOLIRUQLDFRDVW(68 $)&+$ (QGDQJHUHG (QGDQJHUHG    %2219,//( 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVNLVXWFKSRS  $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS  VWHHOKHDGQRUWKHUQ&DOLIRUQLD '36 $)&+$4 7KUHDWHQHG 1RQH    %2219,//( 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS  VWHHOKHDGQRUWKHUQ&DOLIRUQLD '36 $)&+$4 7KUHDWHQHG 1RQH    2556 635,1*6 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS  VWHHOKHDGQRUWKHUQ&DOLIRUQLD '36 $)&+$4 7KUHDWHQHG 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    5(':22' 9$//(<8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    2556 635,1*6 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    &2: 02817$,1 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    %2219,//( 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS Page 532 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    8.,$+ 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    (//('*( 3($.8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV P\NLVVLULGHXVSRS VWHHOKHDGFHQWUDO&DOLIRUQLD FRDVW'36 $)&+$* 7KUHDWHQHG 1RQH    385'<6 *$5'(16 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVP\NLVV LULGHXVSRS $QLPDOV )LVK 2QFRUK\QFKXV WVKDZ\WVFKDSRS FKLQRRNVDOPRQ&DOLIRUQLD FRDVWDO(68 $)&+$6 7KUHDWHQHG 1RQH    385'<6 *$5'(16 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVWVKDZ\WVFKD SRS $QLPDOV )LVK 2QFRUK\QFKXV WVKDZ\WVFKDSRS FKLQRRNVDOPRQ&DOLIRUQLD FRDVWDO(68 $)&+$6 7KUHDWHQHG 1RQH    (//('*( 3($.8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVWVKDZ\WVFKD SRS $QLPDOV )LVK 2QFRUK\QFKXV WVKDZ\WVFKDSRS FKLQRRNVDOPRQ&DOLIRUQLD FRDVWDO(68 $)&+$6 7KUHDWHQHG 1RQH    8.,$+ 8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVWVKDZ\WVFKD SRS $QLPDOV )LVK 2QFRUK\QFKXV WVKDZ\WVFKDSRS FKLQRRNVDOPRQ&DOLIRUQLD FRDVWDO(68 $)&+$6 7KUHDWHQHG 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV)LVK 6DOPRQLGDH 2QFRUK\QFKXVWVKDZ\WVFKD SRS $QLPDOV ,QVHFWV %RPEXVFDOLJLQRVXV REVFXUHEXPEOHEHH ,,+<0 1RQH 1RQH    385'<6 *$5'(16 0DSSHG $QLPDOV,QVHFWV$SLGDH %RPEXVFDOLJLQRVXV $QLPDOV ,QVHFWV %RPEXVRFFLGHQWDOLV ZHVWHUQEXPEOHEHH ,,+<0 1RQH &DQGLGDWH (QGDQJHUHG    &2: 02817$,1 0DSSHGDQG 8QSURFHVVHG $QLPDOV,QVHFWV$SLGDH %RPEXVRFFLGHQWDOLV $QLPDOV 0DPPDOV $UERULPXVSRPR 6RQRPDWUHHYROH $0$)) 1RQH 1RQH 66&   %2219,//( 0DSSHGDQG 8QSURFHVVHG $QLPDOV0DPPDOV &ULFHWLGDH$UERULPXV SRPR $QLPDOV 0DPPDOV $UERULPXVSRPR 6RQRPDWUHHYROH $0$)) 1RQH 1RQH 66&   /$8*+/,1 5$1*( 0DSSHGDQG 8QSURFHVVHG $QLPDOV0DPPDOV &ULFHWLGDH$UERULPXV SRPR $QLPDOV 0DPPDOV $UERULPXVSRPR 6RQRPDWUHHYROH $0$)) 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV &ULFHWLGDH$UERULPXV SRPR $QLPDOV 0DPPDOV (UHWKL]RQGRUVDWXP 1RUWK$PHULFDQSRUFXSLQH $0$)- 1RQH 1RQH    %2219,//( 0DSSHGDQG 8QSURFHVVHG $QLPDOV0DPPDOV (UHWKL]RQWLGDH(UHWKL]RQ GRUVDWXP $QLPDOV 0DPPDOV (UHWKL]RQGRUVDWXP 1RUWK$PHULFDQSRUFXSLQH $0$)- 1RQH 1RQH    (//('*( 3($.0DSSHG $QLPDOV0DPPDOV (UHWKL]RQWLGDH(UHWKL]RQ GRUVDWXP $QLPDOV 0DPPDOV (UHWKL]RQGRUVDWXP 1RUWK$PHULFDQSRUFXSLQH $0$)- 1RQH 1RQH    8.,$+ 0DSSHGDQG 8QSURFHVVHG $QLPDOV0DPPDOV (UHWKL]RQWLGDH(UHWKL]RQ GRUVDWXP Page 533 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  $QLPDOV 0DPPDOV (UHWKL]RQGRUVDWXP 1RUWK$PHULFDQSRUFXSLQH $0$)- 1RQH 1RQH    385'<6 *$5'(16 0DSSHG $QLPDOV0DPPDOV (UHWKL]RQWLGDH(UHWKL]RQ GRUVDWXP $QLPDOV 0DPPDOV (XPRSVSHURWLV FDOLIRUQLFXV ZHVWHUQPDVWLIIEDW $0$&' 1RQH 1RQH 66&   5(':22' 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 0RORVVLGDH(XPRSV SHURWLVFDOLIRUQLFXV $QLPDOV 0DPPDOV 3HNDQLDSHQQDQWL )LVKHU $0$-) 1RQH 1RQH 66&   5(':22' 9$//(<0DSSHG $QLPDOV0DPPDOV 0XVWHOLGDH3HNDQLD SHQQDQWL $QLPDOV 0DPPDOV 3HNDQLDSHQQDQWL )LVKHU $0$-) 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 0XVWHOLGDH3HNDQLD SHQQDQWL $QLPDOV 0DPPDOV 3HNDQLDSHQQDQWL )LVKHU $0$-) 1RQH 1RQH 66&   385'<6 *$5'(16 0DSSHG $QLPDOV0DPPDOV 0XVWHOLGDH3HNDQLD SHQQDQWL $QLPDOV 0DPPDOV 7D[LGHDWD[XV $PHULFDQEDGJHU $0$-) 1RQH 1RQH 66&   5(':22' 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 0XVWHOLGDH7D[LGHDWD[XV $QLPDOV 0DPPDOV $QWUR]RXVSDOOLGXV SDOOLGEDW $0$&& 1RQH 1RQH 66&   5(':22' 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH$QWUR]RXV SDOOLGXV $QLPDOV 0DPPDOV $QWUR]RXVSDOOLGXV SDOOLGEDW $0$&& 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH$QWUR]RXV SDOOLGXV $QLPDOV 0DPPDOV $QWUR]RXVSDOOLGXV SDOOLGEDW $0$&& 1RQH 1RQH 66&   &2: 02817$,1 0DSSHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH$QWUR]RXV SDOOLGXV $QLPDOV 0DPPDOV $QWUR]RXVSDOOLGXV SDOOLGEDW $0$&& 1RQH 1RQH 66&   385'<6 *$5'(16 8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH$QWUR]RXV SDOOLGXV $QLPDOV 0DPPDOV &RU\QRUKLQXV WRZQVHQGLL 7RZQVHQG VELJHDUHGEDW $0$&& 1RQH 1RQH 66&   385'<6 *$5'(16 0DSSHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH &RU\QRUKLQXVWRZQVHQGLL $QLPDOV 0DPPDOV &RU\QRUKLQXV WRZQVHQGLL 7RZQVHQG VELJHDUHGEDW $0$&& 1RQH 1RQH 66&   5(':22' 9$//(< 0DSSHGDQG 8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH &RU\QRUKLQXVWRZQVHQGLL $QLPDOV 0DPPDOV &RU\QRUKLQXV WRZQVHQGLL 7RZQVHQG VELJHDUHGEDW $0$&& 1RQH 1RQH 66&   3277(5 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH &RU\QRUKLQXVWRZQVHQGLL $QLPDOV 0DPPDOV &RU\QRUKLQXV WRZQVHQGLL 7RZQVHQG VELJHDUHGEDW $0$&& 1RQH 1RQH 66&   /$8*+/,1 5$1*(8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH &RU\QRUKLQXVWRZQVHQGLL $QLPDOV 0DPPDOV /DVLXUXVEORVVHYLOOLL ZHVWHUQUHGEDW $0$&& 1RQH 1RQH 66&   5(':22' 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH/DVLXUXV EORVVHYLOOLL $QLPDOV 0DPPDOV /DVLXUXVFLQHUHXV KRDU\EDW $0$&& 1RQH 1RQH    3277(5 9$//(<8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH/DVLXUXV FLQHUHXV $QLPDOV 0DPPDOV 0\RWLVOXFLIXJXV OLWWOHEURZQEDW $0$&& 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH0\RWLV OXFLIXJXV Page 534 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  $QLPDOV 0DPPDOV 0\RWLV\XPDQHQVLV <XPDP\RWLV $0$&& 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG $QLPDOV0DPPDOV 9HVSHUWLOLRQLGDH0\RWLV \XPDQHQVLV $QLPDOV 0ROOXVNV *RQLGHDDQJXODWD ZHVWHUQULGJHGPXVVHO ,0%,9 1RQH 1RQH    &2: 02817$,1 0DSSHG $QLPDOV0ROOXVNV 8QLRQLGDH*RQLGHD DQJXODWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   &2: 02817$,1 0DSSHGDQG 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   %2219,//( 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   (//('*( 3($.0DSSHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   8.,$+ 0DSSHGDQG 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   3277(5 9$//(< 0DSSHGDQG 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   2556 635,1*6 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   5(':22' 9$//(<0DSSHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   /$8*+/,1 5$1*( 0DSSHGDQG 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD $QLPDOV 5HSWLOHV (P\VPDUPRUDWD ZHVWHUQSRQGWXUWOH $5$$' 1RQH 1RQH 66&   385'<6 *$5'(16 0DSSHGDQG 8QSURFHVVHG $QLPDOV5HSWLOHV (P\GLGDH(P\V PDUPRUDWD &RPPXQLW\ 7HUUHVWULDO 1RUWKHUQ,QWHULRU &\SUHVV)RUHVW 1RUWKHUQ,QWHULRU&\SUHVV )RUHVW &77&$ 1RQH 1RQH    385'<6 *$5'(16 0DSSHG &RPPXQLW\7HUUHVWULDO 1RUWKHUQ,QWHULRU&\SUHVV )RUHVW &RPPXQLW\ 7HUUHVWULDO 6HUSHQWLQH %XQFKJUDVV 6HUSHQWLQH%XQFKJUDVV &77&$ 1RQH 1RQH    385'<6 *$5'(16 0DSSHG &RPPXQLW\7HUUHVWULDO 6HUSHQWLQH%XQFKJUDVV 3ODQWV %U\RSK\WHV (QWRVWKRGRQNRFKLL .RFK VFRUGPRVV 1%0863 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV%U\RSK\WHV )XQDULDFHDH(QWRVWKRGRQ NRFKLL 3ODQWV %U\RSK\WHV *ULPPLDWRUHQLL 7RUHQ VJULPPLD 1%086 1RQH 1RQH  %  (//('*( 3($.0DSSHG 3ODQWV%U\RSK\WHV *ULPPLDFHDH*ULPPLD WRUHQLL 3ODQWV %U\RSK\WHV *ULPPLDWRUHQLL 7RUHQ VJULPPLD 1%086 1RQH 1RQH  %  &2: 02817$,1 0DSSHG 3ODQWV%U\RSK\WHV *ULPPLDFHDH*ULPPLD WRUHQLL 3ODQWV /LFKHQV 8VQHDORQJLVVLPD 0HWKXVHODK VEHDUGOLFKHQ 1//(&3 1RQH 1RQH    2556 635,1*6 0DSSHG 3ODQWV/LFKHQV 3DUPHOLDFHDH8VQHD ORQJLVVLPD Page 535 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  3ODQWV 9DVFXODU 3HULGHULGLDJDLUGQHUL VVSJDLUGQHUL &DOLIRUQLD*DLUGQHU V\DPSDK 3'$3,1 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG 3ODQWV9DVFXODU $SLDFHDH3HULGHULGLD JDLUGQHULVVSJDLUGQHUL 3ODQWV 9DVFXODU %OHQQRVSHUPDEDNHUL 6RQRPDVXQVKLQH 3'$67$ (QGDQJHUHG (QGDQJHUHG  %  /$8*+/,1 5$1*(0DSSHG 3ODQWV9DVFXODU $VWHUDFHDH%OHQQRVSHUPD EDNHUL 3ODQWV 9DVFXODU +HPL]RQLDFRQJHVWD VVSFDO\FXODWD 0HQGRFLQRWDUSODQW 3'$675 1RQH 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH+HPL]RQLD FRQJHVWDVVSFDO\FXODWD 3ODQWV 9DVFXODU +HPL]RQLDFRQJHVWD VVSFDO\FXODWD 0HQGRFLQRWDUSODQW 3'$675 1RQH 1RQH    2556 635,1*6 8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH+HPL]RQLD FRQJHVWDVVSFDO\FXODWD 3ODQWV 9DVFXODU +HPL]RQLDFRQJHVWD VVSFDO\FXODWD 0HQGRFLQRWDUSODQW 3'$675 1RQH 1RQH    &2: 02817$,1 8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH+HPL]RQLD FRQJHVWDVVSFDO\FXODWD 3ODQWV 9DVFXODU +HPL]RQLDFRQJHVWD VVSFDO\FXODWD 0HQGRFLQRWDUSODQW 3'$675 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH+HPL]RQLD FRQJHVWDVVSFDO\FXODWD 3ODQWV 9DVFXODU +HPL]RQLDFRQJHVWD VVSWUDF\L 7UDF\ VWDUSODQW 3'$675 1RQH 1RQH    %2219,//( 8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH+HPL]RQLD FRQJHVWDVVSWUDF\L 3ODQWV 9DVFXODU +HPL]RQLDFRQJHVWD VVSWUDF\L 7UDF\ VWDUSODQW 3'$675 1RQH 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH+HPL]RQLD FRQJHVWDVVSWUDF\L 3ODQWV 9DVFXODU /DVWKHQLDEXUNHL %XUNH VJROGILHOGV 3'$67/ (QGDQJHUHG (QGDQJHUHG  %  8.,$+ 0DSSHG 3ODQWV9DVFXODU $VWHUDFHDH/DVWKHQLD EXUNHL 3ODQWV 9DVFXODU /D\LDVHSWHQWULRQDOLV &ROXVDOD\LD 3'$671) 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU $VWHUDFHDH/D\LD VHSWHQWULRQDOLV 3ODQWV 9DVFXODU /HVVLQJLDKROROHXFD ZRROO\KHDGHGOHVVLQJLD 3'$676 1RQH 1RQH    %2219,//( 8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH/HVVLQJLD KROROHXFD 3ODQWV 9DVFXODU 7UDF\LQDURVWUDWD EHDNHGWUDF\LQD 3'$67' 1RQH 1RQH  %  5(':22' 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH7UDF\LQD URVWUDWD 3ODQWV 9DVFXODU 7UDF\LQDURVWUDWD EHDNHGWUDF\LQD 3'$67' 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHGDQG 8QSURFHVVHG 3ODQWV9DVFXODU $VWHUDFHDH7UDF\LQD URVWUDWD 3ODQWV 9DVFXODU 3ODJLRERWKU\V OLWKRFDU\XV 0D\DFDPDVSRSFRUQIORZHU 3'%2593 1RQH 1RQH  $  5(':22' 9$//(<0DSSHG 3ODQWV9DVFXODU %RUDJLQDFHDH 3ODJLRERWKU\VOLWKRFDU\XV 3ODQWV 9DVFXODU 3ODJLRERWKU\V OLWKRFDU\XV 0D\DFDPDVSRSFRUQIORZHU 3'%2593 1RQH 1RQH  $  3277(5 9$//(<0DSSHG 3ODQWV9DVFXODU %RUDJLQDFHDH 3ODJLRERWKU\VOLWKRFDU\XV 3ODQWV 9DVFXODU 6WUHSWDQWKXV JODQGXORVXVVVS KRIIPDQLL +RIIPDQ VEULVWO\MHZHOIORZHU 3'%5$*- 1RQH 1RQH  %  &2: 02817$,1 0DSSHG 3ODQWV9DVFXODU %UDVVLFDFHDH 6WUHSWDQWKXVJODQGXORVXV VVSKRIIPDQLL Page 536 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  3ODQWV 9DVFXODU %UDVHQLDVFKUHEHUL ZDWHUVKLHOG 3'&$% 1RQH 1RQH  %  /$8*+/,1 5$1*(0DSSHG 3ODQWV9DVFXODU &DERPEDFHDH%UDVHQLD VFKUHEHUL 3ODQWV 9DVFXODU 9LEXUQXPHOOLSWLFXP RYDOOHDYHGYLEXUQXP 3'&35 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU &DSULIROLDFHDH9LEXUQXP HOOLSWLFXP 3ODQWV 9DVFXODU &DUH[FRPRVD EULVWO\VHGJH 30&<3< 1RQH 1RQH  %  &2: 02817$,1 0DSSHG 3ODQWV9DVFXODU &\SHUDFHDH&DUH[ FRPRVD 3ODQWV 9DVFXODU $UFWRVWDSK\ORV VWDQIRUGLDQDVVS UDLFKHL 5DLFKH VPDQ]DQLWD 3'(5,* 1RQH 1RQH  %  &2: 02817$,1 0DSSHG 3ODQWV9DVFXODU (ULFDFHDH$UFWRVWDSK\ORV VWDQIRUGLDQDVVSUDLFKHL 3ODQWV 9DVFXODU $UFWRVWDSK\ORV VWDQIRUGLDQDVVS UDLFKHL 5DLFKH VPDQ]DQLWD 3'(5,* 1RQH 1RQH  %  (//('*( 3($.0DSSHG 3ODQWV9DVFXODU (ULFDFHDH$UFWRVWDSK\ORV VWDQIRUGLDQDVVSUDLFKHL 3ODQWV 9DVFXODU $UFWRVWDSK\ORV VWDQIRUGLDQDVVS UDLFKHL 5DLFKH VPDQ]DQLWD 3'(5,* 1RQH 1RQH  %  8.,$+ 0DSSHG 3ODQWV9DVFXODU (ULFDFHDH$UFWRVWDSK\ORV VWDQIRUGLDQDVVSUDLFKHL 3ODQWV 9DVFXODU $UFWRVWDSK\ORV VWDQIRUGLDQDVVS UDLFKHL 5DLFKH VPDQ]DQLWD 3'(5,* 1RQH 1RQH  %  2556 635,1*6 0DSSHG 3ODQWV9DVFXODU (ULFDFHDH$UFWRVWDSK\ORV VWDQIRUGLDQDVVSUDLFKHL 3ODQWV 9DVFXODU $UFWRVWDSK\ORV VWDQIRUGLDQDVVS UDLFKHL 5DLFKH VPDQ]DQLWD 3'(5,* 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU (ULFDFHDH$UFWRVWDSK\ORV VWDQIRUGLDQDVVSUDLFKHL 3ODQWV 9DVFXODU $VWUDJDOXVEUHZHUL %UHZHU VPLONYHWFK 3')$%)- 1RQH 1RQH    3277(5 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU )DEDFHDH$VWUDJDOXV EUHZHUL 3ODQWV 9DVFXODU 7ULIROLXP EXFNZHVWLRUXP 6DQWD&UX]FORYHU 3')$%: 1RQH 1RQH  %  /$8*+/,1 5$1*(0DSSHG 3ODQWV9DVFXODU )DEDFHDH7ULIROLXP EXFNZHVWLRUXP 3ODQWV 9DVFXODU 0RQDUGHOODYLULGLV JUHHQPRQDUGHOOD 3'/$04 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG 3ODQWV9DVFXODU /DPLDFHDH0RQDUGHOOD YLULGLV 3ODQWV 9DVFXODU )ULWLOODULDDJUHVWLV VWLQNEHOOV 30/,/9 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU/LOLDFHDH )ULWLOODULDDJUHVWLV 3ODQWV 9DVFXODU )ULWLOODULDSXUG\L 3XUG\ VIULWLOODU\30/,/9+ 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU/LOLDFHDH )ULWLOODULDSXUG\L 3ODQWV 9DVFXODU )ULWLOODULDSXUG\L 3XUG\ VIULWLOODU\30/,/9+ 1RQH 1RQH    3277(5 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU/LOLDFHDH )ULWLOODULDSXUG\L 3ODQWV 9DVFXODU )ULWLOODULDSXUG\L 3XUG\ VIULWLOODU\30/,/9+ 1RQH 1RQH    5(':22' 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU/LOLDFHDH )ULWLOODULDSXUG\L 3ODQWV 9DVFXODU )ULWLOODULDURGHULFNLL 5RGHULFN VIULWLOODU\30/,/90 1RQH (QGDQJHUHG  %  /$8*+/,1 5$1*(0DSSHG 3ODQWV9DVFXODU/LOLDFHDH )ULWLOODULDURGHULFNLL 3ODQWV 9DVFXODU /LOLXPUXEHVFHQV UHGZRRGOLO\30/,/$1 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG 3ODQWV9DVFXODU/LOLDFHDH /LOLXPUXEHVFHQV 3ODQWV 9DVFXODU /LPQDQWKHVEDNHUL %DNHU VPHDGRZIRDP 3'/,0 1RQH 5DUH  %  8.,$+ 0DSSHG 3ODQWV9DVFXODU /LPQDQWKDFHDH /LPQDQWKHVEDNHUL Page 537 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  3ODQWV 9DVFXODU +HVSHUROLQRQ DGHQRSK\OOXP JODQGXODUZHVWHUQIOD[ 3'/,1 1RQH 1RQH  %  &2: 02817$,1 0DSSHG 3ODQWV9DVFXODU/LQDFHDH +HVSHUROLQRQ DGHQRSK\OOXP 3ODQWV 9DVFXODU +HVSHUROLQRQ DGHQRSK\OOXP JODQGXODUZHVWHUQIOD[ 3'/,1 1RQH 1RQH  %  3277(5 9$//(<0DSSHG 3ODQWV9DVFXODU/LQDFHDH +HVSHUROLQRQ DGHQRSK\OOXP 3ODQWV 9DVFXODU +HVSHUROLQRQ DGHQRSK\OOXP JODQGXODUZHVWHUQIOD[ 3'/,1 1RQH 1RQH  %  /$8*+/,1 5$1*(0DSSHG 3ODQWV9DVFXODU/LQDFHDH +HVSHUROLQRQ DGHQRSK\OOXP 3ODQWV 9DVFXODU 0DODFRWKDPQXV PHQGRFLQHQVLV 0HQGRFLQREXVKPDOORZ 3'0$/4' 1RQH 1RQH  $  (//('*( 3($.0DSSHG 3ODQWV9DVFXODU 0DOYDFHDH 0DODFRWKDPQXV PHQGRFLQHQVLV 3ODQWV 9DVFXODU &\SULSHGLXP FDOLIRUQLFXP &DOLIRUQLDODG\ VVOLSSHU 3025&4 1RQH 1RQH    (//('*( 3($.8QSURFHVVHG 3ODQWV9DVFXODU 2UFKLGDFHDH&\SULSHGLXP FDOLIRUQLFXP 3ODQWV 9DVFXODU &\SULSHGLXP FDOLIRUQLFXP &DOLIRUQLDODG\ VVOLSSHU 3025&4 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU 2UFKLGDFHDH&\SULSHGLXP FDOLIRUQLFXP 3ODQWV 9DVFXODU &\SULSHGLXP PRQWDQXP PRXQWDLQODG\ VVOLSSHU 3025&4 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU 2UFKLGDFHDH&\SULSHGLXP PRQWDQXP 3ODQWV 9DVFXODU &\SULSHGLXP PRQWDQXP PRXQWDLQODG\ VVOLSSHU 3025&4 1RQH 1RQH    2556 635,1*6 8QSURFHVVHG 3ODQWV9DVFXODU 2UFKLGDFHDH&\SULSHGLXP PRQWDQXP 3ODQWV 9DVFXODU &\SULSHGLXP PRQWDQXP PRXQWDLQODG\ VVOLSSHU 3025&4 1RQH 1RQH    (//('*( 3($.8QSURFHVVHG 3ODQWV9DVFXODU 2UFKLGDFHDH&\SULSHGLXP PRQWDQXP 3ODQWV 9DVFXODU 3LSHULDFDQGLGD ZKLWHIORZHUHGUHLQRUFKLG 3025&; 1RQH 1RQH  %  2556 635,1*6 0DSSHG 3ODQWV9DVFXODU 2UFKLGDFHDH3LSHULD FDQGLGD 3ODQWV 9DVFXODU .RSVLRSVLVKRRNHUL VPDOOJURXQGFRQH 3'252 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU 2UREDQFKDFHDH .RSVLRSVLVKRRNHUL 3ODQWV 9DVFXODU (U\WKUDQWKHQXGDWD EDUHPRQNH\IORZHU 3'6&5% 1RQH 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG 3ODQWV9DVFXODU 3KU\PDFHDH(U\WKUDQWKH QXGDWD 3ODQWV 9DVFXODU *UDWLRODKHWHURVHSDOD %RJJV/DNHKHGJHK\VVRS 3'6&55 1RQH (QGDQJHUHG  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU 3ODQWDJLQDFHDH*UDWLROD KHWHURVHSDOD 3ODQWV 9DVFXODU 3OHXURSRJRQ KRRYHULDQXV 1RUWK&RDVWVHPDSKRUHJUDVV 3032$< 1RQH 7KUHDWHQHG  %  2556 635,1*6 0DSSHGDQG 8QSURFHVVHG 3ODQWV9DVFXODU3RDFHDH 3OHXURSRJRQKRRYHULDQXV 3ODQWV 9DVFXODU 3OHXURSRJRQ KRRYHULDQXV 1RUWK&RDVWVHPDSKRUHJUDVV 3032$< 1RQH 7KUHDWHQHG  %  (//('*( 3($.0DSSHG 3ODQWV9DVFXODU3RDFHDH 3OHXURSRJRQKRRYHULDQXV 3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    (//('*( 3($.8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV 3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV Page 538 of 800 ,0$363ULQW3UHYLHZ KWWSVDSSVZLOGOLIHFDJRYELRVSULQW7DEOH3UHYLHZKWPO  3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    3277(5 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV 3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    2556 635,1*6 8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV 3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV 3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    5(':22' 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV 3ODQWV 9DVFXODU /HSWRVLSKRQ DFLFXODULV EULVWO\OHSWRVLSKRQ 3'3/0 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQDFLFXODULV 3ODQWV 9DVFXODU /HSWRVLSKRQ ODWLVHFWXV EURDGOREHGOHSWRVLSKRQ 3'3/0 1RQH 1RQH    /$8*+/,1 5$1*(8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQODWLVHFWXV 3ODQWV 9DVFXODU /HSWRVLSKRQ ODWLVHFWXV EURDGOREHGOHSWRVLSKRQ 3'3/0 1RQH 1RQH    2556 635,1*6 8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQODWLVHFWXV 3ODQWV 9DVFXODU /HSWRVLSKRQ ODWLVHFWXV EURDGOREHGOHSWRVLSKRQ 3'3/0 1RQH 1RQH    3277(5 9$//(<8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQODWLVHFWXV 3ODQWV 9DVFXODU /HSWRVLSKRQ ODWLVHFWXV EURDGOREHGOHSWRVLSKRQ 3'3/0 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH /HSWRVLSKRQODWLVHFWXV 3ODQWV 9DVFXODU 1DYDUUHWLD OHXFRFHSKDODVVS EDNHUL %DNHU VQDYDUUHWLD 3'3/0&( 1RQH 1RQH  %  8.,$+ 0DSSHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH1DYDUUHWLD OHXFRFHSKDODVVSEDNHUL 3ODQWV 9DVFXODU 1DYDUUHWLD OHXFRFHSKDODVVS EDNHUL %DNHU VQDYDUUHWLD 3'3/0&( 1RQH 1RQH  %  /$8*+/,1 5$1*(0DSSHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH1DYDUUHWLD OHXFRFHSKDODVVSEDNHUL 3ODQWV 9DVFXODU 1DYDUUHWLD OHXFRFHSKDODVVS EDNHUL %DNHU VQDYDUUHWLD 3'3/0&( 1RQH 1RQH  %  5(':22' 9$//(<0DSSHG 3ODQWV9DVFXODU 3ROHPRQLDFHDH1DYDUUHWLD OHXFRFHSKDODVVSEDNHUL 3ODQWV 9DVFXODU 5DQXQFXOXVOREELL /REE VDTXDWLFEXWWHUFXS 3'5$1/- 1RQH 1RQH    8.,$+ 8QSURFHVVHG 3ODQWV9DVFXODU 5DQXQFXODFHDH 5DQXQFXOXVOREELL 3ODQWV 9DVFXODU 5DQXQFXOXVOREELL /REE VDTXDWLFEXWWHUFXS 3'5$1/- 1RQH 1RQH    385'<6 *$5'(16 8QSURFHVVHG 3ODQWV9DVFXODU 5DQXQFXODFHDH 5DQXQFXOXVOREELL 3ODQWV 9DVFXODU &HDQRWKXVFRQIXVXV 5LQFRQ5LGJHFHDQRWKXV 3'5+$ 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU 5KDPQDFHDH&HDQRWKXV FRQIXVXV 3ODQWV 9DVFXODU +RUNHOLDERODQGHUL %RODQGHU VKRUNHOLD 3'526: 1RQH 1RQH  %  385'<6 *$5'(16 0DSSHG 3ODQWV9DVFXODU 5RVDFHDH+RUNHOLD ERODQGHUL Page 539 of 800 &136,QYHQWRU\5HVXOWV ZZZUDUHSODQWVFQSVRUJUHVXOWKWPO"DGY W TXDG  ,QYHQWRU\RI5DUHDQG(QGDQJHUHG3ODQWV 7KHGDWDEDVHXVHGWRSURYLGHXSGDWHVWRWKH2QOLQH,QYHQWRU\LVXQGHU FRQVWUXFWLRQ9LHZXSGDWHVDQGFKDQJHVPDGHVLQFH0D\KHUH 3ODQW/LVW PDWFKHVIRXQGClick on scientific name for details 6HDUFK&ULWHULD )RXQGLQ4XDGVDQG 0RGLI\6HDUFK&ULWHULD ([SRUWWR([FHO 0RGLI\&ROXPQV 0RGLI\6RUW 'LVSOD\3KRWRV 6FLHQWLILF1DPH &RPPRQ1DPH )DPLO\/LIHIRUP %ORRPLQJ 3HULRG &$5DUH3ODQW 5DQN 6WDWH 5DQN *OREDO 5DQN $UFWRVWDSK\ORVVWDQIRUGLDQDVVS UDLFKHL 5DLFKH VPDQ]DQLWD (ULFDFHDH SHUHQQLDOHYHUJUHHQVKUXE )HE$SU %6*7 $VWUDJDOXVEUHZHUL %UHZHU VPLONYHWFK )DEDFHDH DQQXDOKHUE $SU-XQ 6* %OHQQRVSHUPDEDNHUL 6RQRPDVXQVKLQH $VWHUDFHDH DQQXDOKHUE 0DU0D\%6* %UDVHQLDVFKUHEHUL ZDWHUVKLHOG &DERPEDFHDH SHUHQQLDOUKL]RPDWRXVKHUE DTXDWLF -XQ6HS %6* &DUH[FRPRVD EULVWO\VHGJH &\SHUDFHDH SHUHQQLDOUKL]RPDWRXVKHUE 0D\6HS %6* &HDQRWKXVFRQIXVXV 5LQFRQ5LGJHFHDQRWKXV 5KDPQDFHDH SHUHQQLDOHYHUJUHHQVKUXE )HE-XQ %6* &XVFXWDMHSVRQLL -HSVRQ VGRGGHU &RQYROYXODFHDH DQQXDOYLQH SDUDVLWLF -XQ -XO6HS %6* &\SULSHGLXPFDOLIRUQLFXP &DOLIRUQLDODG\ VVOLSSHU 2UFKLGDFHDH SHUHQQLDOUKL]RPDWRXVKHUE $SU$XJ 6HS 6* &\SULSHGLXPPRQWDQXP PRXQWDLQODG\ VVOLSSHU 2UFKLGDFHDH SHUHQQLDOUKL]RPDWRXVKHUE 0DU$XJ 6* (QWRVWKRGRQNRFKLL .RFK VFRUGPRVV )XQDULDFHDH PRVV %6* )LVVLGHQVSDXSHUFXOXV PLQXWHSRFNHWPRVV )LVVLGHQWDFHDH PRVV %6*" )ULWLOODULDURGHULFNLL 5RGHULFN VIULWLOODU\/LOLDFHDH SHUHQQLDOEXOELIHURXVKHUE 0DU0D\%6*4 *UDWLRODKHWHURVHSDOD %RJJV/DNHKHGJHK\VVRS 3ODQWDJLQDFHDH DQQXDOKHUE $SU$XJ %6* Page 540 of 800 &136,QYHQWRU\5HVXOWV ZZZUDUHSODQWVFQSVRUJUHVXOWKWPO"DGY W TXDG  *ULPPLDWRUHQLL 7RUHQ VJULPPLD *ULPPLDFHDH PRVV %6* +HPL]RQLDFRQJHVWDVVS FRQJHVWD FRQJHVWHGKHDGHGKD\ILHOG WDUSODQW $VWHUDFHDH DQQXDOKHUE $SU1RY %6*7 +HVSHUROLQRQDGHQRSK\OOXP JODQGXODUZHVWHUQIOD[/LQDFHDH DQQXDOKHUE 0D\$XJ %66** +RUNHOLDERODQGHUL %RODQGHU VKRUNHOLD 5RVDFHDH SHUHQQLDOKHUE 0D\ -XQ $XJ %6* .RSVLRSVLVKRRNHUL VPDOOJURXQGFRQH 2UREDQFKDFHDH SHUHQQLDOUKL]RPDWRXVKHUE SDUDVLWLF $SU$XJ %66*" /DVWKHQLDEXUNHL %XUNH VJROGILHOGV $VWHUDFHDH DQQXDOKHUE $SU-XQ %6* /D\LDVHSWHQWULRQDOLV &ROXVDOD\LD $VWHUDFHDH DQQXDOKHUE $SU0D\%6* /LOLXPUXEHVFHQV UHGZRRGOLO\/LOLDFHDH SHUHQQLDOEXOELIHURXVKHUE $SU$XJ 6HS 6* /LPQDQWKHVEDNHUL %DNHU VPHDGRZIRDP /LPQDQWKDFHDH DQQXDOKHUE $SU0D\%6* 0DODFRWKDPQXVPHQGRFLQHQVLV 0HQGRFLQREXVKPDOORZ 0DOYDFHDH SHUHQQLDOGHFLGXRXVVKUXE 0D\-XQ $6;*;4 0RQDUGHOODYLULGLV JUHHQPRQDUGHOOD /DPLDFHDH SHUHQQLDOUKL]RPDWRXVKHUE -XQ6HS 6* 1DYDUUHWLDOHXFRFHSKDODVVS EDNHUL %DNHU VQDYDUUHWLD 3ROHPRQLDFHDH DQQXDOKHUE $SU-XO %6*7 3HULGHULGLDJDLUGQHULVVSJDLUGQHUL *DLUGQHU V\DPSDK $SLDFHDH SHUHQQLDOKHUE -XQ2FW 66*77 3LSHULDFDQGLGD ZKLWHIORZHUHGUHLQRUFKLG 2UFKLGDFHDH SHUHQQLDOKHUE 0DU 0D\ 6HS %6* 3ODJLRERWKU\VOLWKRFDU\XV 0D\DFDPDVSRSFRUQIORZHU %RUDJLQDFHDH DQQXDOKHUE $SU0D\$6+*+ 3OHXURSRJRQKRRYHULDQXV 1RUWK&RDVWVHPDSKRUHJUDVV 3RDFHDH SHUHQQLDOUKL]RPDWRXVKHUE $SU-XQ %6* 5DQXQFXOXVOREELL /REE VDTXDWLFEXWWHUFXS 5DQXQFXODFHDH DQQXDOKHUE DTXDWLF )HE0D\6* 6DQJXLVRUEDRIILFLQDOLV JUHDWEXUQHW 5RVDFHDH SHUHQQLDOUKL]RPDWRXVKHUE -XO2FW %6*" 6WUHSWDQWKXVJODQGXORVXVVVS KRIIPDQLL +RIIPDQ VEULVWO\MHZHOIORZHU %UDVVLFDFHDH DQQXDOKHUE 0DU-XO %6*7 7UDF\LQDURVWUDWD EHDNHGWUDF\LQD $VWHUDFHDH DQQXDOKHUE 0D\-XQ %6* 7ULIROLXPEXFNZHVWLRUXP 6DQWD&UX]FORYHU )DEDFHDH DQQXDOKHUE $SU2FW %6* 8VQHDORQJLVVLPD 0HWKXVHODK VEHDUGOLFKHQ 3DUPHOLDFHDH IUXWLFRVHOLFKHQ HSLSK\WLF 6* 9LEXUQXPHOOLSWLFXP RYDOOHDYHGYLEXUQXP $GR[DFHDH SHUHQQLDOGHFLGXRXVVKUXE 0D\-XQ %6"** 6XJJHVWHG&LWDWLRQ &DOLIRUQLD1DWLYH3ODQW6RFLHW\5DUH3ODQW3URJUDP,QYHQWRU\RI5DUHDQG(QGDQJHUHG3ODQWVRI&DOLIRUQLD RQOLQHHGLWLRQY :HEVLWH KWWSZZZUDUHSODQWVFQSVRUJ>DFFHVVHG)HEUXDU\@ Page 541 of 800 &136,QYHQWRU\5HVXOWV ZZZUDUHSODQWVFQSVRUJUHVXOWKWPO"DGY W TXDG  6HDUFKWKH,QYHQWRU\ 6LPSOH6HDUFK $GYDQFHG6HDUFK *ORVVDU\ ,QIRUPDWLRQ $ERXWWKH,QYHQWRU\ $ERXWWKH5DUH3ODQW3URJUDP &136+RPH3DJH $ERXW&136 -RLQ&136 &RQWULEXWRUV 7KH&DOIORUD'DWDEDVH 7KH&DOLIRUQLD/LFKHQ6RFLHW\ &DOLIRUQLD1DWXUDO'LYHUVLW\'DWDEDVH 7KH-HSVRQ)ORUD3URMHFW 7KH&RQVRUWLXPRI&DOLIRUQLD+HUEDULD &DO3KRWRV 4XHVWLRQVDQG&RPPHQWV UDUHSODQWV#FQSVRUJ ‹&RS\ULJKW&DOLIRUQLD1DWLYH3ODQW6RFLHW\$OOULJKWVUHVHUYHG Page 542 of 800 Re: Biological Resource Assessment Addendum Rare Plant Assessment and Botanical Survey Prepared for: City of Ukiah Department of Community Development 300 Seminary Avenue Ukiah, CA 95482 APN: 001-040-83, 157-070-01, 157-070-02, 003-190-01 Prepared by: Becca Cosmero Environmental Technician Jacobszoon & Associates, Inc. 117 Cara Ave Ukiah, CA 95482 (209) 482-6311 becca@jaforestry.com 07/9/2021 ATTACHMENT B1 Page 543 of 800 Survey Objectives: Rare plant assessments and botanical surveys are conducted to maximize the likelihood of locating rare, threatened, or endangered plants and plant communities that may be present within a Study Area. Survey findings are useful in assessing the potential for significant adverse impacts on botanical resources and critical in mitigating those impacts. If special-status plant species are located during a survey, mitigation measures will be recommended to avoid or minimized damage to the species. The Rare Plant Assessment and Botanical Survey for the City of Ukiah constitutes a seasonally appropriate floristic survey and was conducted during appropriate blooming periods for all potentially occurring rare plant species within a nine-quad scoping range of the project area. Every plant taxon encountered during the survey was identified to the taxonomic level necessary to determine rarity and listing status. Habitat requirements for special-status species and their potential to occur within the Study Area are discussed in Appendix A: Table of Potential for Special-Status Plants and Wildlife within the Study Area, of the Biological Resource Assessment. The survey employs the methods and guidance outlined in the Protocols for Surveying and Evaluating Impacts to Special Status Native Plant Populations and Natural Communities (CDFW 2018). The Study Area referred to in this report includes areas shown in the Biological Resource Assessment Figure 2: Biological Assessment Map, Aerial. Botanical Survey Results: Field surveys within the Study Area were conducted on 03/30/2021 by Miles Hartnett, Staff Biologist/Botanist and Becca Cosmero, Environmental Technician. Jacobszoon and Associates Environmental Technician, Becca Cosmero conducted field surveys on 5/17/2021 and 7/9/2021. Survey protocol was based on Protocols for Surveying and Evaluating Impacts to Special Status Native Plant Populations and Natural Communities (CDFW 2018). An intuitively controlled, seasonally appropriate, floristic survey was performed, which was moderate in coverage density (60-80%) in the potential rare plant habitat areas. A complete list of all plant species observed within the Study Area during the Botanical Survey is included in Table 1: List of Observed Taxa within the Study Area. Plants listed in Table 1 were identified using The Jepson Manual: Vascular Plants of California 2nd Edition (Baldwin et al. 2012) to the taxonomic level necessary to determine rarity. The names provided in the Rare Plant Assessment and Botanical Survey follow The Jepson Flora Project. Page 544 of 800 The Rare Plant Assessment and Botanical Survey identified a total of 96 plant taxa within the Study Area including both native and introduced species. (Table 1: List of Observed Taxa). Of the 96 species observed, none were special-status, rare, threatened, or endangered species. Table 1: List of Observed Taxa within the Study Area Species name Common name Acer macrophyllum bigleaf maple Acmispon brachycarpus Short-podded lotus Adenostoma fasciculatum chamise Adiantum jordanii maiden hair fern Aesculus californica California buckeye Arbutus menziesii Pacific madrone Arctostaphylos canescens ssp. canescens hoary manzanita Arctostaphylos glandulosa Eastwood manzanita Arctostaphylos glandulosa ssp. glandulosa Eastwood manzanita Arctostaphylos glauca Bigberry manzanita Arctostaphylos manzanita ssp. manzanita common manzanita Arctostaphylos patula greenleaf manzanita Baccharis pilularis coyote bush Calochortus tolmiei pussy ears Cardamine californica milk maids Cardamine hirsuta hairy bittercress Cardamine oligosperma Idaho bittercress Ceanothus cuneatus var. cuneatus buckbrush Ceanothus foliosus var. foliosus wavyleaf ceanothus Centaurea melitensis Maltese star-thistle Cerastium glomeratum mouseear chickweed Cercocarpus betuloides mountain mahogany Chlorogalum pomeridianum Wavy leaf soaproot Claytonia perfoliata miner’s lettuce Collomia heterophylla variable leaf collomia Crocanthemum scoparium peak rushrose Cynoglossum grande Pacific houndstongue Cynosurus echinatus bristly dogtail Delphinium nudicaule red larkspur Dichelostemma capitatum blue dicks Dichelostemma ida-maia firecracker flower Diplacus aurantiacus sticky monkeyflower Dittrichia graveolens stinkwort Page 545 of 800 Species name Common name Dryopteris arguta California wood fern Elymus glaucus blue wild rye Eriophyllum lanatum common woolly sunflower Erythronium californicum California fawn lily Euphorbia oblongata eggleaf spurge Festuca arundinacea tall fescue Festuca microstachys small fescue Festuca perennis Italian rye Festuca temulenta darnel Galium aparine cleavers Galium bolanderi Bolander's bedstraw Gastridium phleoides nit grass Genista monspessulana french broom Geranium molle woodland geranium Hesperolinon dwarf-flax Heteromeles arbutifolia toyon Hieracium spp hawkweed Holodiscus discolor oceanspray Hordeum brachyantherum common barley Hypericum concinnum goldwire Iris macrosiphon ground iris Lithophragma affine common woodland star Lonicera hispidula pink honeysuckle Luzula comosa hairy wood rush Lysimachia latifolia Pacific star flower Madia gracilis grassy tarweed Marrubium vulgare white horehound Micranthes californica Greene's saxifrage Micropus californicus Q tips Nemophila heterophylla small baby blue eyes Notholithocarpus densiflorus tanoak Pedicularis densiflora warrior's plume Pentagramma triangularis goldenback fern Phacelia imbricata mountain phacelia Pinus attenuata knobcone pine Plagiobothrys tenellus slender popcorn flower Polygala californica California milkwort Polypodium glycyrrhiza licorice fern Polystichum munitum western sword fern Primula hendersonii Henderson's shooting star Pseudotsuga menziesii Douglas-fir Page 546 of 800 Species name Common name Pteridium aquilinum var. pubescens bracken fern Quercus berberidifolia scrub oak Quercus garryana Oregon white oak Quercus kelloggii California black oak Quercus parvula var. shrevei Shreve oak Quercus wislizeni var. wislizeni interior live oak Ranunculus occidentalis western buttercup Rosa gymnocarpa wood rose Sanicula crassicaulis Pacific sanicle Scutellaria tuberosa blue skullcap Sequoia sempervirens redwood Sidalcea diploscypha fringed checkerbloom Symphoricarpos albus snowberry Tauschia spp. umbrellawort Torreya californica California nutmeg Toxicodendron diversilobum poison oak Trifolium hirtum rose clover Trifolium microcephalum small headed clover Umbellularia californica bay laurel Vicia americana American vetch Whipplea modesta modesty Wyethia glabra smooth mule ears No special status plant species were observed during the Rare Plant Assessment and Botanical Survey. Recommendations: No special status plant species were observed during the Rare Plant Assessment and Botanical Survey. There are no recommendations for special status plant species at this time. Page 547 of 800 Report Author: Becca Cosmero Becca Cosmero is an environmental technician at Jacobszoon and Associates Inc. with three years of professional experience in fisheries management, biological monitoring, and ecological restoration. She received a Bachelor’s of Science in Biology with an emphasis in Ecology and Evolutionary Studies from the University of California, Merced in 2018. Prior to working with Jacobszoon and Associates Inc., Ms. Cosmero has worked with FISHBIO to monitor and study predator populations threatening salmonids within the Stanislaus and Tuolumne Rivers, Sequoia Ecological Consulting as an on-call biologist conducting compliance monitoring, and Grassroots Ecology as an AmeriCorps intern. She received a Rare Plant and Vegetation Sampling certificate from the California Native Plant Society in March 2019 and holds a Rare Plant Voucher Collecting Permit through CDFW (No. 2081 a-21-076-V). Sincerely, Becca Cosmero (she/her) Environmental Technician Jacobszoon & Associates, Inc. Page 548 of 800 $77$&+0(17& 8.,$+:(67(51+,//6 +8//3523(57,(6 23(1/$1' $&48,6,7,21$1'/,0,7(''(9(/230(17$*5((0(17 75,%$/&217$&7/,67)25$% Notices were sent to the following Tribes on December 15, 2020: &DOLIRUQLD1DWLYH$PHULFDQ+HULWDJH&RPPLVVLRQ +DUERU%OYG6XLWH :HVW6DFUDPHQWR&$ (3$'LUHFWRU(PLO\/XVFRPEH &R\RWH9DOOH\%DQGRI3RPR 32%R[ 5HGZRRG9DOOH\&$ 7ULEDO&KDLU0LFKDHO+XQWHU &R\RWH9DOOH\%DQGRI3RPR 32%R[ 5HGZRRG9DOOH\&$ (3$'LUHFWRU0H\R0DUUXIR *XLGLYLOOH,QGLDQ5DQFKHULDRI3RPR,QGLDQV 32%2; 7DOPDJH&$ 7ULEDO&KDLU0HUOHQH6DQFKH] *XLGLYLOOH,QGLDQ5HVHUYDWLRQRI3RPR,QGLDQV 32%R[ 7DOPDJH&$ (3$'LUHFWRU=DFN6DPSVHO 3LQROHYLOOH3RPR1DWLRQ %3LQROHYLOOH'U 8NLDK&$ 7+32$QJHOD-DPHV 3LQROHYLOOH3RPR1DWLRQ %3LQROHYLOOH'U 8NLDK&$ 7ULEDO&KDLU/HRQD:LOOLDPV 3LQROHYLOOH3RPR1DWLRQ %3LQROHYLOOH'U 8NLDK&$ 7ULEDO&KDLU5RPDLQH'DQLHOV <RND\D7ULEH 32%R[ Page 549 of 800 7DOPDJH&$ 7ULEDO&KDLU'HEUD5DPLUH] 5HGZRRG9DOOH\/LWWOH5LYHU%DQGRI3RPR,QGLDQV 5RDG, 5HGZRRG9DOOH\&$ 7+325DPRQ%LOO\-U +RSODQG%DQGRI3RPR,QGLDQV 6KDQHO5RDG +RSODQG&$ 7ULEDO&KDLU6DOYDGRU5RVDOHV 3RWWHU9DOOH\5DQFKHULD 66WDWH6WUHHW 8NLDK&$ 7ULEDO&KDLU6KDZQ'DYLV 6FRWWV9DOOH\%DQGRI3RPR,QGLDQV 3DUDOOHO'U /DNHSRUW&$ +DEHPHWROHO3RPRRI8SSHU/DNH 6KHUU\7UHSSD&KDLU3HUVRQ 3R%R[ 8SSHU/DNH&D On January 14, 2021, notices were sent to the following additional tribes per NAHC's recommendation: 0DQFKHVWHU%DQGRI3RPR,QGLDQVRIWKH0DQFKHVWHU5DQFKHULD -DLPH&REDUUXELD&KDLUSHUVRQ 32%R[3RLQW$UHQD&$ 3KRQH  )D[   /LQGDODZVRQ#PSDWULEDORIILFHFRP 1R\R5LYHU,QGLDQ&RPPXQLW\ 32%R[ )RUW%UDJJ&$ <RND\R7ULEH &KDLUSHUVRQ 32%R[ 7DOPDJH&$ 5RXQG9DOOH\5HVHUYDWLRQ&RYHOR,QGLDQ&RPPXQLW\ -DPHV5XVV3UHVLGHQW &RYHOR5RDG &RYHOR&$ WULEDOFRXQFLO#UYLWRUJ Page 550 of 800 $77$&+0(17' 5HVSRQVHWR&RPPHQWV5HFHLYHGRQWKH'UDIW,QLWLDO6WXG\DQG0LWLJDWHG 1HJDWLYH'HFODUDWLRQ ,601' IRUWKH 8NLDK:HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQDQG /LPLWHG'HYHORSPHQW3URMHFW 3XEOLF 5HYLHZ&(4$ *XLGHOLQHV 6HFWLRQV  DQG  GLVFXVV SXEOLF SDUWLFLSDWLRQ UHJDUGLQJ WKH UHYLHZ DQG HYDOXDWLRQ RI (QYLURQPHQWDO ,PSDFW 5HSRUWV (,5V DQG1HJDWLYH 'HFODUDWLRQV6SHFLILFDOO\6HFWLRQVWDWHVWKHIROORZLQJ ³(a) In reviewing draft EIRs, persons and public agencies should focus on the sufficiency of the document in identifying and analyzing the possible impacts on the environment and ways in which the significant effects of the project might be avoided or mitigated. Comments are most helpful when they suggest additional specific alternatives or mitigation measures that would provide better ways to avoid or mitigate the significant environmental effects. At the same time, reviewers should be aware that the adequacy of an EIR is determined in terms of what is reasonably feasible, in light of factors such as the magnitude of the project at issue, the severity of its likely environmental impacts, and the geographic scope of the project. CEQA does not require a lead agency to conduct every test or perform all research, study, and experimentation recommended or demanded by commentors. When responding to comments, lead agencies need only respond to significant environmental issues and do not need to provide all information requested by reviewers, as long as a good faith effort at full disclosure is made in the EIR (b) In reviewing negative declarations, persons and public agencies should focus on the proposed finding that the project will not have a significant effect on the environment. If persons and public agencies believe that the project may have a significant effect, they should: (1) Identify the specific effect, (2) Explain why they believe the effect would occur, and (3) Explain why they believe the effect would be significant. (c) Reviewers should explain the basis for their comments, and should submit data or references offering facts, reasonable assumptions based on facts, or expert opinion supported by facts in support of the comments. Pursuant to Section 15064, an effect shall not be considered significant in the absence of substantial evidence´ 1RWLFHRI,QWHQW7KH1RWLFHRI,QWHQWWRDGRSWWKH,601'DQGFRQGXFWDSXEOLFKHDULQJZDV SURYLGHGLQWKHIROORZLQJPDQQHULQDFFRUGDQFHZLWK8NLDK&LW\&RGH 8&& †DQG &DOLIRUQLD(QYLURQPHQWDO4XDOLW\$FW &(4$ *XLGHOLQHV6HFWLRQ •3URYLGHGWRSURSHUW\RZQHUVZLWKLQIHHWRIWKHSURMHFWSDUFHOVDVZHOODVDJHQFLHV DQGGHSDUWPHQWVZLWKMXULVGLFWLRQRULQWHUHVWRYHUWKHSURMHFWRQ$SULO-XQH DQG$XJXVW •3URYLGHGWRPHPEHUVRIWKHSXEOLFDJHQFLHVDQGLQWHUHVWHGSDUWLHVZKRVXEPLWWHG ZULWWHQFRPPHQWVRQWKH'UDIW,601'GXULQJWKHSXEOLFUHYLHZSHULRGRQ$XJXVW  •3XEOLVKHGLQWKH8NLDK'DLO\-RXUQDORQ$SULO-XQHDQG$XJXVW  •3RVWHGRQWKH3URMHFWVLWHRQ0D\-XQHDQG$XJXVW •3RVWHGDWWKH&LYLF&HQWHU JODVVFDVH KRXUVSULRUWRWKHSXEOLFKHDULQJ Page 551 of 800 •1RWLFHGIRUFRQWLQXDQFHDWWKH0D\3ODQQLQJ&RPPLVVLRQKHDULQJWRDGDWH FHUWDLQRI-XQHDQG •1RWLFHIRUFRQWLQXDQFHDWWKH-XQH3ODQQLQJ&RPPLVVLRQWRDGDWHXQFHUWDLQ ,QDGGLWLRQEDVHGRQWKHDPRXQWRILQWHUHVWLQWKH3URMHFWDQGWRUHFHLYHDVPXFKSXEOLFLQSXW DVSRVVLEOHDGGLWLRQDOSXEOLFQRWLFLQJZDVFRQGXFWHGLQWKHIROORZLQJPDQQHU •3RVWHGRQWKH&LW\RI8NLDKZHEVLWHRQ$SULODQG$XJXVW •(PDLOHGWR3ODQQLQJ&RPPLVVLRQHUVDQG&LW\&RXQFLOPHPEHUVRQ$SULODQG $XJXVW •+DQGGHOLYHUHGWRDOOUHVLGHQFHV LQDGGLWLRQWRDQGEH\RQGWKHIRRWUHTXLUHPHQW RQ5HGZRRG$YHQXHRQ0D\DQGPDLOHGWRDOOUHVLGHQFHVRQ5HGZRRG $YHQXHRQ$XJXVW 5HYLVLRQVDQG&ODULILFDWLRQV7KHEHORZOLVWLQFOXGHVDVXPPDU\RIFKDQJHVDQGRUFODULILFDWLRQV WKDWKDYHEHHQPDGHWRWKH3URMHFWVLQFHWKH'UDIW,601'ZDVFLUFXODWHGIRUSXEOLFUHYLHZ7KHVH UHYLVLRQVKDYHEHHQPDGHHLWKHUE\WKHGHYHORSHULQUHVSRQVHWRFRPPHQWVRUDUHFRUUHFWLRQV DQGFODULILFDWLRQVLGHQWLILHGE\VWDII7KHEHORZOLVWLVPHDQWWRKLJKOLJKWWKHODUJHUFKDQJHVDQG GRHVQRWLQFOXGHDOOPLQRUFKDQJHVVXFKDVJUDPPDWLFDOHUURUVRUPLQRUFODULILFDWLRQV,QIRUPDWLRQ SURYLGHGLQWKH5HVSRQVHWR&RPPHQWVVHFWLRQEHORZKDVDOVREHHQLQFRUSRUDWHGLQWRWKH)LQDO 'UDIW,601'DVDSSURSULDWH Development Parcels-7KH RULJLQDO 3URMHFW 'HVFULSWLRQ LQFOXGHGD 'HYHORSPHQW $JUHHPHQWWRDOORZ+XOO3URSHUWLHVWRLQGLYLGXDOO\VHOOVHYHQ'HYHORSPHQW3DUFHOVIRU GHYHORSPHQWRIRQHVLQJOHIDPLO\KRPH DQGWKHSRVVLELOLW\IRURQH$FFHVVRU\'ZHOOLQJ 8QLW SHUSDUFHOXSRQDQQH[DWLRQDQG3ODQQLQJ&RPPLVVLRQDSSURYDORID8VH3HUPLWWR FRQVWUXFWLQGLYLGXDOKRPHVZLWKLQWKH6LQJOH)DPLO\5HVLGHQWLDO+LOOVLGH 5+ 2YHUOD\ 'LVWULFW+RZHYHU +XOO 3URSHUWLHV LV FKRRVLQJ WR UHWDLQ WKH ULJKW WR VHOO DQGGHYHORS 'HYHORSPHQW3DUFHOVSULRUWRDQQH[DWLRQ7KH'HYHORSPHQW3DUFHOVDUHORFDWHGZLWKLQ WKH&RXQW\RI0HQGRFLQR¶VMXULVGLFWLRQZLWKLQWKH8SODQG5HVLGHQWLDODFUHPLQLPXP 85 ]RQLQJ GLVWULFW&RQVWUXFWLRQRI WKH VLQJOHIDPLO\ KRPHV ZLWKLQ WKH &RXQW\¶V MXULVGLFWLRQZRXOGEHE\ULJKWDQGQRWUHTXLUHGLVFUHWLRQDU\DSSURYDOHQYLURQPHQWDOUHYLHZ QRUWKHGHYHORSPHQWVWDQGDUGVFRQWDLQHGZLWKLQWKH&LW\¶V5+]RQLQJGLVWULFW+RZHYHU +XOO3URSHUWLHVLVFKRRVLQJWRUHTXLUHWKHVLQJOHIDPLO\KRPHVWREHFRQVWUXFWHGWR5+ VWDQGDUGVE\LQFOXGLQJWKHPLQWKH'HFODUDWLRQRI&RYHQDQWV&RQGLWLRQVDQG5HVWULFWLRQV && 5V IRU'HYHORSPHQW3DUFHOV,QDGGLWLRQDOWKRXJKQRWUHTXLUHGWKHPLWLJDWLRQ PHDVXUHVFRQWDLQHGZLWKLQWKH,601'IRUUHVLGHQWLDOGHYHORSPHQWZLOODOVREHLQFOXGHGLQ WKH&& 5V'HYHORSPHQW3DUFHOVZLOOVWLOOEHLQFOXGHGLQWKHDSSOLFDWLRQIRUDQQH[DWLRQ DQGSUH]RQHGWR5+$VGHVFULEHGLQWKHRULJLQDO3URMHFW'HVFULSWLRQWKHUHPDLQLQJ 'HYHORSPHQW3DUFHOV  ZLOOQRWEHGHYHORSHGXQWLODQQH[DWLRQLVFRPSOHWHDQGHDFK KRPHUHFHLYHV3ODQQLQJ&RPPLVVLRQDSSURYDORID8VH3HUPLWIRUFRQVWUXFWLRQZLWKLQWKH &LW\¶V5+]RQLQJGLVWULFW Lot Line Adjustment- 7KHRULJLQDO3URMHFW'HVFULSWLRQSURSRVHGDORWOLQHDGMXVWPHQWWR UHFRQILJXUHWKHH[LVWLQJSDUFHOVLQWRVHYHQ'HYHORSPHQW3DUFHOVUDQJLQJIURPWR DFUHVLQVL]HLQDFFRUGDQFHZLWKWKH5+]RQLQJGLVWULFW'UDIW,601'7DEOHLGHQWLILHG WKHH[LVWLQJDQGSURSRVHGSDUFHOVZKLOH)LJXUHVKRZHGWKHH[LVWLQJSDUFHOFRQILJXUDWLRQ DQG)LJXUHVKRZHGWKHSURSRVHGFRQILJXUDWLRQ+XOO3URSHUWLHVZLOOFRPSOHWHVHTXHQWLDO ORWOLQHDGMXVWPHQWVLQERWKWKH&LW\¶VDQG&RXQW\¶VMXULVGLFWLRQLQDFFRUGDQFHZLWKWKH Page 552 of 800 6XEGLYLVLRQ0DS$FWWRXOWLPDWHO\UHDFKWKHSURSRVHGFRQILJXUDWLRQLGHQWLILHGLQ)LJXUH $OWKRXJKWKHILQDOFRQILJXUDWLRQRIWKH'HYHORSPHQW3DUFHOVPD\YDU\VOLJKWO\WKHIRRWSULQW RIWKH UHVXOWLQJ FRQILJXUDWLRQIRUWKH 'HYHORSPHQW 3DUFHOV  DFUHV DQG QXPEHU RI SDUFHOVZLOOUHPDLQWKHVDPH LGHQWLILHGLQ\HOORZRQ)LJXUH/RFDWLRQ0DS $FRS\RI WKHILQDOUHFRUGHG/RW/LQH$GMXVWPHQWVZLOOEHVXEPLWWHGWRWKH&RPPXQLW\'HYHORSPHQW 'HSDUWPHQW SULRU WR VXEPLWWDO RI D 8VH 3HUPLW IRU VLQJOH IDPLO\ KRXVLQJ ZLWKLQWKH 'HYHORSPHQW3DUFHOV ,QDFFRUGDQFHZLWK8NLDK&LW\&RGH6HFWLRQ I ZKLFKVWDWHV³Concurrent Permit Processing: when a lot line adjustment is part of a project that requires one or more discretionary planning entitlements and the applicant does not want the lot line adjustment unless the entire project is approved, then the lot line adjustment shall be reviewed as part of the discretionary planning application. In that event, all permits and approvals, including the lot line adjustment, shall be combined into one application, processed concurrently, and acted upon by the highest review authority required by this code based on the entitlements included in the application. (Ord. 1138, §2 (Exh. A), adopted 2012)´+XOO SURSHUWLHVKDVLQGLFDWHGWKDWWKH\ZLVKWRUHFRUGWKH/RW/LQH$GMXVWPHQWVUHJDUGOHVVRI ZKHWKHURUQRWWKHRYHUDOO3URMHFWJHWVDSSURYHG$VVXFKWKH/RW/LQH$GMXVWPHQWV UHPDLQ PLQLVWHULDO DQG GR QRW UHTXLUH DSSURYDO E\ WKH KLJKHVW UHYLHZ DXWKRULW\ &LW\ &RXQFLOLQWKLVFDVH  Prezoning3UHYLRXVO\ODQGVLQWHQGHGIRURSHQVSDFHWKDWDUHORFDWHGRXWVLGHRIWKH&LW\¶V FXUUHQW6SKHUHRI,QIOXHQFH 62, ZHUHQRWSURSRVHGIRUSUH]RQLQJ+RZHYHUEDVHGRQ FRPPHQWVUHFHLYHGIURPWKH0HQGRFLQR&RXQW\/RFDO$JHQF\)RUPDWLRQ&RPPLVVLRQ /$)&R WKHVHRSHQVSDFHODQGVDUHSURSRVHGWREHSUH]RQHG3XEOLF)DFLOLWLHVFRQVLVWHQW ZLWKWKHUHPDLQLQJRSHQVSDFHODQG VHH0DVWHU5HVSRQVHEHORZIRUPRUHLQIRUPDWLRQ  Access Road7KHH[LVWLQJDFFHVVURDGZLGWKZDVSUHYLRXVO\JHQHUDOO\GHVFULEHGDVEHLQJ IWZLGH+RZHYHUWKHDFFHVVURDGZLGWKUDQJHVIURPIWWRIWZLWKWKHPDMRULW\RI LWEHLQJDPLQLPXPRIIWZLGH7KHVHFWLRQVWKDWDUHIWZLGHDUHDSSUR[LPDWHO\IW ORQJDQG KDYH ZLGHU WXUQRXWV LPPHGLDWHO\ EHIRUH RU DIWHU WKHP%RWKWKH &DOLIRUQLD 'HSDUWPHQWRI)RUHVWU\DQG)LUH3URWHFWLRQ &DO)LUH DQGWKH8NLDK9DOOH\)LUH$XWKRULW\ 89)$ KDYH UHYLHZHG WKH 3URMHFW DQG FRQGXFWHG D VLWH YLVLW 3URSRVHGURDG LPSURYHPHQWVZLOOEHLQDFFRUGDQFHZLWKDOODSSOLFDEOHILUHFRGHVDQGDFFHVVVWDQGDUGV 6HH0DVWHU5HVSRQVHEHORZIRUPRUHLQIRUPDWLRQ Utilities3UHYLRXVO\&LW\ZDWHUXWLOLWLHVZHUHSURSRVHGWREHH[WHQGHGWRWKH'HYHORSPHQW 3DUFHOV,Q DGGLWLRQ RQH  JDOORQ WDQNZDV SURSRVHG IRU DGGLWLRQDO ZDWHU VWRUDJHDQGILUHSURWHFWLRQ+RZHYHUZDWHUZLOOQRZEHSURYLGHGRQVLWHE\WKHODQG RZQHUGHYHORSHUDQGZDWHUZLOOEHVWRUHGLQWZR  JDOORQZDWHUWDQNV7KHWDQNV ZLOOEHORFDWHGLQWKHVDPHORFDWLRQDVWKHSUHYLRXVO\SURSRVHGVLQJOHJDOORQWDQN 7KHGHYHORSHUSURSRVHVWRVXSSO\WKHWDQNVZLWKZDWHUIURPWKHRQVLWHZHOOVUDWKHUWKDQ FRQVWUXFWLQJQHZERRVWHUSXPSVWDWLRQVWRSXPSZDWHUXSWRWKHWDQNVIURPWKH&LW\¶V H[LVWLQJZHOOV7KHWDQNVZLOOEHPDLQWDLQHGE\WKHIXWXUH+RPHRZQHU¶V$VVRFLDWLRQ7KH SODQIRUDQRQVLWHFRPPXQLW\VHSWLFV\VWHPUHPDLQVDVRULJLQDOO\SURSRVHG3UHYLRXVO\ WKH&LW\ZDVSURSRVLQJWRH[WHQGHOHFWULFXWLOLWLHVWRWKH'HYHORSPHQW3DUFHOVEXWQRZ HOHFWULFXWLOLWLHVZLOOEHH[WHQGHGE\ERWKWKH&LW\DQGRUWKHSURSHUW\RZQHUGHYHORSHU 8OWLPDWHO\XSRQDQQH[DWLRQWKH&LW\ZLOORZQDQGPDLQWDLQWKHHOHFWULFLQIUDVWUXFWXUH$OO XWLOLWLHVZRXOGEHORFDWHGZLWKLQWKHVDPHIRRWSULQWDVSUHYLRXVO\SURSRVHG Page 553 of 800 Biological Resources$VQRWHGLQ,601'6HFWLRQ%LRORJLFDO5HVRXUFHVERWDQLFDO VXUYH\VDUHUHTXLUHGWREHFRQGXFWHGLQDFFRUGDQFHZLWK86)LVKDQG:LOGOLIH 86):6  VXUYH\SURWRFROVZKLFKUHTXLUHVVHYHUDOVXUYH\VWKURXJKGLIIHUHQWWLPHVRIWKH\HDULQ UHODWLRQ WR GLIIHUHQW VSHFLHV¶ EORRPLQJ SHULRGV $W WKH WLPH RI FLUFXODWLRQ RI WKH 'UDIW ,601'WKHWZRRIWKUHHUHTXLUHGVXUYH\VFRPSOHWHGKDGUHVXOWHGLQQHJDWLYHILQGLQJV 3HU86):6SURWRFROVRQHDGGLWLRQDOVXUYH\ZDVUHTXLUHGGXULQJWKHEORRPLQJSHULRG 0DUFK-XO\ DQGDVQRWHGLQ'UDIW,601'0LWLJDWLRQ0HDVXUH%,2WKLVVXUYH\ZRXOG RFFXUSULRUWRDQ\JURXQGGLVWXUELQJDFWLYLWLHVDWWKHUHFRPPHQGDWLRQRIWKH%LRORJLVW +RZHYHU VLQFH WKH FLUFXODWLRQ RI WKH 'UDIW ,601' WKH ILQDO ERWDQLFDO VXUYH\ ZDV FRPSOHWHGRQ-XO\7KHVXUYH\GLGQRWUHVXOWLQWKHLGHQWLILFDWLRQRIDQ\VHQVLWLYH ERWDQLFDOVSHFLHV VHHWKH%LRORJLFDO5HVRXUFHV$VVHVVPHQW$GGHQGXPIRU5DUH3ODQW $VVHVVPHQWDQG%RWDQLFDO6XUYH\LQFOXGHGDV$WWDFKPHQW%RIWKH)LQDO'UDIW,601'  $VVXFKQRIXUWKHUERWDQLFDOVXUYH\VDUHUHTXLUHG+RZHYHULIWUHHVDUHSURSRVHGIRU UHPRYDOSUHFRQVWUXFWLRQVXUYH\VDQGFRRUGLQDWLRQZLWK&DOLIRUQLD'HSDUWPHQWRI)LVKDQG :LOGOLIH &'): VKDOOEHUHTXLUHG0LWLJDWLRQ0HDVXUH%,2KDVEHHQUHYLVHGDVIROORZV ,QDGGLWLRQ0LWLJDWLRQ0HDVXUH%,2KDVEHHQFODULILHGDVIROORZVWRHQFRPSDVVDOO VHQVLWLYH DPSKLELDQ VSHFLHV FRQVLVWHQW ZLWK ILQGLQJV LQ WKH %LRORJLFDO 5HVRXUFHV $VVHVVPHQW'HOHWHGWH[WLVVKRZQLQVWULNHWKURXJKIRQWZKLOHDGGHGWH[WLVVKRZQLQ XQGHUOLQHIRQW BIO-1: Special-Status Plants Sensitive Trees. Full USFWS protocol-level sensitive plant species surveys for Mendocino tarplant, congested headed hayfield tarplant, bristly leptosiphon, broad- lobed leptosiphon, redwood lily, green monardella, white-flowered rein orchid, Mayacamas popcornflower, beaked tracyina, showy Indian clover, and oval-leaved viburnum within the blooming period (generally March-August) shall be conducted prior to any ground disturbing activities to verify the presence of special status plants and identify additional mitigation if needed, to ensure that the Project will not result in a significant impact. If trees are proposed for removal, preconstruction surveys shall be conducted by a qualified biologist to identify Oregon white oak forest and woodland, as well as California bay forest and woodland habitat; removal of sensitive habitat shall be conducted in accordance with California Department of Fish and Wildlife (CDFW) regulations. BIO-2: Red-belly newt Sensitive Amphibian Species. A qualified biologist shall survey the area prior to any groundbreaking activities to determine the presence of Red-belly newt, or other sensitive amphibian species, and identify additional avoidance measures, if needed. A qualified biologist shall be on-site for any dewatering event to address the potential for the presence of sensitive amphibian species such as foothill yellow-legged frog (Rana boylii). 3HU&(4$*XLGHOLQHV6HFWLRQ D ³a lead agency is required to recirculate a negative declaration when the document must be substantially revised after public notice of its availability has previously been given pursuant to Section 15072, but prior to its adoption. Notice of recirculation shall comply with Sections 15072 and 15073. (b) A “substantial revision” of the negative declaration shall mean: (1) A new, avoidable significant effect is identified and mitigation measures or project revisions must be added in order to reduce the effect to insignificance, or (2) The lead agency determines that the proposed mitigation measures or project revisions will not reduce potential effects to less than significance and new measures or revisions must be required. Page 554 of 800 (c) Recirculation is not required under the following circumstances: (1) Mitigation measures are replaced with equal or more effective measures pursuant to Section 15074.1. (2) New project revisions are added in response to written or verbal comments on the project’s effects identified in the proposed negative declaration which are not new avoidable significant effects. (3) Measures or conditions of project approval are added after circulation of the negative declaration which are not required by CEQA, which do not create new significant environmental effects and are not necessary to mitigate an avoidable significant effect. (4) New information is added to the negative declaration which merely clarifies, amplifies, or makes insignificant modifications to the negative declaration.” %HFDXVHWKHFKDQJHVGHVFULEHGDERYHDQGRWKHUVPDGHLQUHVSRQVHWRSXEOLFFRPPHQWV DV GLVFXVVHGEHORZ DUHIRUFODULILFDWLRQSXUSRVHVDQGRUGRQRWUHVXOWLQDQHZVLJQLILFDQWHIIHFWWKDW ZDVSUHYLRXVO\QRWDQDO\]HGZLWKLQWKH'UDIW,601'UHFLUFXODWLRQRIWKH,601'LVQRWUHTXLUHG 5HVSRQVHWR&RPPHQWV7KH&LW\RI8NLDKUHFHLYHGFRPPHQWVRQWKH'UDIW,QLWLDO6WXG\DQG 0LWLJDWHG1HJDWLYH'HFODUDWLRQ ,601' IURPWKHLQGLYLGXDOVDQGHQWLWLHVOLVWHGLQ7DEOHEHORZ GXULQJWKHSXEOLFFRPPHQWSHULRG $SULO0D\ ,QGLYLGXDOFRPPHQWVFDQEH IRXQGLQ$WWDFKPHQWRIWKH6WDII5HSRUW &(4$*XLGHOLQHV6HFWLRQ 3XEOLF5HYLHZRID3URSRVHG1HJDWLYH'HFODUDWLRQRU0LWLJDWHG 1HJDWLYH'HFODUDWLRQ GRHVQRWUHTXLUHD/HDG$JHQF\WRSURYLGHZULWWHQUHVSRQVHVWRSXEOLF FRPPHQWZLWKWKHH[FHSWLRQRIWKRVHUDLVHGE\D5HVSRQVLEOHRUSXEOLFDJHQF\+RZHYHUWKH &LW\RI8NLDKKDVFKRVHQWRUHYLHZDQGUHVSRQGWRDOOZULWWHQSXEOLFFRPPHQWVUHFHLYHGRQWKH 'UDIW,601' Table 1, Comments Received on the Draft Initial Study and Mitigated Negative Declaration &RPPHQW /HWWHU&RPPHQWHU'DWH5HFHLYHG 0DUJR)UDQN0D\ &ULVSLQ%+ROOLQVKHDG0D\  8OOD%UXQQEHUJ5DQG0D\ $OOLH'XJJDQ0D\ :HVWHUQ+LOOV)LUH6DIH &RXQFLO0D\ &KULV:DWW0D\ -HDQQH:HW]HO&KLQQ0D\ $QGUHD9DFKRQ0D\ 0LFKDHO0D\QDUG0D\  6KDUURQ7KRPDV YLD HPDLOIURP(PLO\ 7KRPDV  0D\ $QGUHD'DYLV0D\ Page 555 of 800 0DUJR)UDQN0D\ +HDWKHU6HJJHO0D\ 7KRPDV+XQW YLDHPDLO IURP&KULV:DWW 0D\ 6WHYHDQG-HDQ/LQFROQ0D\  1RUWK&RDVW5HJLRQDO :DWHU4XDOLW\&RQWURO %RDUG 0D\ -RKQDQG'HO\QQH 5RJHUV0D\ 3LQN\.XVKQHU0D\  0HQGRFLQR&RXQW\/RFDO $JHQF\)RUPDWLRQ &RPPLVVLRQ /$)&R  0D\ +HOHQ6L]HPRUH0D\   7KHPDMRULW\RIWKHFRPPHQWVUHFHLYHGH[SUHVVHGFRQFHUQVUHJDUGLQJZLOGILUHULVN,QDGGLWLRQ PDQ\FRPPHQWHUVDSSHDUWREHRIWKHRSLQLRQWKDWWKH3URMHFWLQFOXGHVDSXEOLFSDUNZLWKSODQQHG SXEOLFDFFHVVZLWKLQWKHRSHQVSDFHDUHDZKLFKLVQRWDSDUWRIWKLVSURMHFW%HFDXVHRIWKHQDWXUH RI WKHVH UHSHDWHG WRSLFVRI FRPPHQW UHVSRQVHV WR WKHVH FRPPHQWV KDYH EHHQ DGGUHVVHG WKURXJK 0DVWHU 5HVSRQVHV DV LGHQWLILHG EHORZ 5HVSRQVHV WR LQGLYLGXDO FRPPHQW OHWWHUV UHJDUGLQJRWKHULVVXHVDUHSURYLGHGEHORZDFFRUGLQJWRWKHQXPEHULQJV\VWHPLGHQWLILHGDERYHLQ 7DEOH2WKHUFRPPHQWVH[SUHVVHGJHQHUDORSSRVLWLRQRIWKHSURMHFWEXWGRQRWUDLVHLVVXHV UHODWHGWRWKHDQDO\VLVRUDGHTXDF\RIWKH,QLWLDO6WXG\WKDWUHTXLUHDIRUPDOUHVSRQVHXQGHU&(4$ ,QIRUPDWLRQFRQWDLQHGZLWKLQWKHEHORZUHVSRQVHWRFRPPHQWVKDVEHHQLQFRUSRUDWHGLQWRWKH ,601'IRUFODULILFDWLRQSXUSRVHVDVDSSOLFDEOH6XSSRUWLQJLQIRUPDWLRQLQFOXGLQJDWRSRJUDSKLFDO PDSOHWWHUVVXEPLWWHGE\0HQGRFLQR&DO)LUH8QLW)LUH&DSWDLQ9DOOHUJDDQG8NLDK9DOOH\)LUH $XWKRULW\ 89)$ &KLHI +XWFKLVRQ DQG-DFREV]RRQ DQG $VVRFLDWHV,QFLQ UHVSRQVH WR FRPPHQWVUHFHLYHGFDQEHIRXQGLQ5HVSRQVHWR&RPPHQWV$WWDFKPHQW$ 0DVWHU5HVSRQVHV :LOGILUH7KHPDMRULW\RIWKHFRPPHQWHUVFRQFHUQVDUHODUJHO\DVVRFLDWHGZLWKH[LVWLQJ FRQGLWLRQVDQGFRQFHUQVUHJDUGLQJFRQVWUXFWLRQRIIXWXUHVLQJOHIDPLO\KRPHVZLWKLQWKH :HVWHUQ +LOOV ZKLFK LV LGHQWLILHG E\ WKH &DOLIRUQLD 'HSDUWPHQW RI )RUHVWU\ DQG )LUH 3URWHFWLRQ &DO)LUH DVD9HU\+LJK)LUH+D]DUG6HYHULW\=RQH=RQH&RPPHQWHUVDOVR H[SUHVVFRQFHUQVUHJDUGLQJWKHH[LVWLQJVKDGHGIXHOEUHDNDQGHPHUJHQF\DFFHVV 5HVSRQVH*HRJUDSKLFDODUHDVDUHGHVLJQDWHGDQGFODVVLILHGE\&DO)LUHWKURXJKWKHLU )LUH+D]DUG6HYHULW\=RQH0DSSLQJSURJUDPDV9HU\+LJK+LJKRU0RGHUDWHLQ6WDWH 5HVSRQVLELOLW\ $UHDV7KHVH ]RQHV DUH EDVHGRQIDFWRUVVXFK DVIXHO VORSHILUH ZHDWKHUHWF&RQVLVWHQWZLWKRWKHUODQGVGHVLJQDWHG9HU\+LJK)LUH+D]DUG6HYHULW\ =RQHVZLWKLQ0HQGRFLQR&RXQW\¶VMXULVGLFWLRQWKH3URMHFWDUHDLVFXUUHQWO\ORFDWHG ZLWKLQD&DO)LUH6WDWH5HVSRQVLELOLW\$UHD 65$ 2QFHDQQH[HGLQWRWKH&LW\WKH UHVSRQVLELOLW\ZLOOEHWUDQVIHUUHGWRWKH8NLDK9DOOH\)LUH$XWKRULW\ 89)$ DQGEHFRPH D/RFDO5HVSRQVLELOLW\$UHD7KH89)$KDVLQGLFDWHGLWKDVFDSDFLW\WRVHUYHWKH 3URMHFWDUHDDQGZLOOHQVXUHWKDWDOODSSOLFDEOHUHJXODWLRQVDUHPHW Page 556 of 800 Construction and Access5HTXLUHPHQWVIRUFRQVWUXFWLRQDUHGLUHFWO\UHODWHGWR)LUH +D]DUG6HYHULW\=RQH0DSSLQJDQGKHDYLO\UHJXODWHGSXUVXDQWWR&DOLIRUQLD3XEOLF 5HVRXUFHV&RGHDQGWKH&DOLIRUQLD%XLOGLQJ&RGH6SHFLILFDOO\FRQVWUXFWLRQPHWKRGV DFFHVVVWDQGDUGVDQGKD]DUGRXVYHJHWDWLRQDQGIXHOVPDQDJHPHQWUHTXLUHPHQWV LQWHQGHGWRPLWLJDWHZLOGILUHH[SRVXUHDUHFRQWDLQHGZLWKLQWKHIROORZLQJ •&DOLIRUQLD%XLOGLQJ&RGH&KDSWHU$ 0DWHULDOVDQG&RQVWUXFWLRQ0HWKRGVIRU ([WHULRU:LOGILUH([SRVXUHLQFOXGLQJ:LOGODQG8UEDQ,QWHUIDFHUHJXODWLRQV  •&DOLIRUQLD 5HVLGHQWLDO &RGH 6HFWLRQ 5 0DWHULDOV DQG &RQVWUXFWLRQ 0HWKRGVIRU([WHULRU:LOGOLIH([SRVXUH  •&DOLIRUQLD 5HIHUHQFHG 6WDQGDUGV &RGH &KDSWHU $ )LUH 5HVLVWLYH 6WDQGDUGV  •&DOLIRUQLD&RGHRI5HJXODWLRQV7LWOH'LYLVLRQ&KDSWHU6XEFKDSWHU )LUH+D]DUG5HGXFWLRQ$URXQG%XLOGLQJVDQG6WUXFWXUHV DQG •&DOLIRUQLD*RYHUQPHQW&RGH6HFWLRQ 9HU\+LJK)LUH+D]DUG6HYHULW\ =RQHV  $OWKRXJKQRWORFDWHGZLWKLQDQ65$WKH&LW\RI8NLDK 8&&† KDVDGRSWHGWKH 65$UHJXODWLRQVIRUODQGVZLWKLQWKH&LW\OLPLWVORFDWHGLQ+LJKRU9HU\+LJKILUHDUHDV ,Q DGGLWLRQ 3XEOLF 5HVRXUFHV &RGH 6HFWLRQV  DQG FRQWDLQ DGGLWLRQDO UHTXLUHPHQWVIRUODQGVZLWKLQ9HU\+LJK)LUH6HYHULW\=RQHV7KHVHLQFOXGHEXWDUH QRWOLPLWHGWRWKHIROORZLQJZKLFKDUHGHVLJQHGWRSURYLGHGHIHQVLEOHVSDFHDQGILUH SURWHFWLRQIRUQHZFRQVWUXFWLRQDQGHQVXUHDGHTXDWHHPHUJHQF\DFFHVVLQFUHDVHG SURSHUW\OLQHVHWEDFNVIRUDOODSSOLFDEOHFRQVWUXFWLRQRQVLWHZDWHUVWRUDJHIRUILUH SURWHFWLRQGULYHZD\URDGZD\W\SHVDQGVSHFLILFDWLRQVEDVHGRQGHVLJQDWHGXVDJHDOO ZHDWKHU GULYHZD\URDGZD\ VXUIDFHV EHLQJ HQJLQHHUHG IRU OE YHKLFOHV PD[LPXP VORSH RI  WXUQRXW UHTXLUHPHQWV JDWH UHTXLUHPHQWV DQG VHWEDFNV SDUNLQJVWDQGDUGVIXHOVUHGXFWLRQUHJXODWLRQVHWF 7KHH[LVWLQJJUDYHODFFHVVURDGZLOOEHLPSURYHGZLWKDVSKDOWDQGDFXOGHVDFLQ DFFRUGDQFHZLWKDOOFXUUHQWILUHDQGVDIHW\FRGHVDSSOLFDEOHWRWKH3URMHFW7KH3URMHFW DOVRLQFOXGHVLQVWDOODWLRQRIZDWHUWDQNVDQGILUHK\GUDQWVWRDGGQHZZDWHUVWRUDJH DQGILUHSURWHFWLRQIDFLOLWLHVLQWKH:HVWHUQ+LOOV3HUWKH&DOLIRUQLD)LUH&RGHDSRUWLRQ RIWKHZDWHU YDULHVEDVHGRQVL]HDQGQXPEHURIKRPHV ZLOOEHUHTXLUHGWREHDOORWWHG IRU ILUH SURWHFWLRQVHUYLFHV DQG FDQQRW EH XVHG IRU UHVLGHQWLDO XVHWKLV ZLOO EH DFFRPSOLVKHGE\DIORDWVZLWFKLQVLGHWKHWDQN%RWK&DO)LUHDQGWKH89)$KDYH UHYLHZHG WKH 3URMHFW DQG FRQGXFWHG D VLWH YLVLW WRHQVXUHWKH DFFHVVURDGDQG SURSRVHGLPSURYHPHQWVDUHDGHTXDWH7KLVLQIRUPDWLRQKDVEHHQLQFRUSRUDWHGLQWR WKH)LQDO'UDIW,601'&RPPHQWVVXEPLWWHGE\0HQGRFLQR&DO)LUH8QLW)LUH&DSWDLQ 9DOOHUJD DQG 89)$ )LUH &KLHI +XWFKLVRQ DUHLQFOXGHGLQ 5HVSRQVH WR &RPPHQW $WWDFKPHQW$ 6LPLODUO\DOOIXWXUHFRQVWUXFWLRQDQGURDGZD\VDVVRFLDWHGZLWKWKH3URMHFW LQFOXGLQJ IXWXUHUHVLGHQWLDOFRQVWUXFWLRQLQERWKWKH&LW\¶VDQG&RXQW\¶VMXULVGLFWLRQ PXVWDGKHUH WRWKH DIRUHPHQWLRQHGUHJXODWLRQV LQ DGGLWLRQWR DOO RWKHU ORFDO VWDWHDQGIHGHUDO UHJXODWLRQVUHODWLQJWRDFFHVVDQGVDIHW\$OOFRQVWUXFWLRQUHTXLULQJD%XLOGLQJ3HUPLW Page 557 of 800 ZLOOEHUHYLHZHGE\WKH%XLOGLQJ2IILFLDODQG)LUH0DUVKDOODVZHOODVRWKHU&LW\DQG &RXQW\GHSDUWPHQWVDQGDJHQFLHVDVDSSOLFDEOHIRUFRQVLVWHQF\ZLWKOLIHVDIHW\DQG DFFHVVUHTXLUHPHQWV +RZHYHUSULRUWRREWDLQLQJ%XLOGLQJ3HUPLWVDOOIXWXUHUHVLGHQWLDOFRQVWUXFWLRQZLWKLQ WKH SURSRVHG 6LQJOH)DPLO\ 5HVLGHQWLDO+LOOVLGH 2YHUOD\ 'LVWULFW ZLOO UHTXLUH GLVFUHWLRQDU\UHYLHZ6SHFLILFDOO\RQFHWKHSDUFHOVDUHDQQH[HGLQWRWKH&LW\WKH 'HYHORSPHQW3DUFHOVZRXOGQRWEHGHYHORSHGXQWLODQDSSOLFDQWVXEPLWVDSURMHFW VSHFLILFVLWHSODQZLWKD8VH3HUPLWDSSOLFDWLRQDQGUHFHLYHV3ODQQLQJ&RPPLVVLRQ DSSURYDOIRUGHYHORSPHQWRIDKRPHLQDFFRUGDQFHZLWKWKH+LOOVLGH2YHUOD\=RQLQJ 'LVWULFW UHJXODWLRQV7KH +LOOVLGH 2YHUOD\'LVWULFWLQFOXGHV VWULFW GHYHORSPHQW VWDQGDUGVUHODWLQJWRILUHKD]DUGVLQFOXGLQJLQFUHDVHGVHWEDFNVPLQLPXPUHTXLUHG QDWXUDODUHDVUHVWULFWLRQVRQWKHXVHRIFRPEXVWLEOHURRIPDWHULDOVZDWHUDQGILUH K\GUDQWUHTXLUHPHQWVDQGVORSHUHTXLUHPHQWV 7KH8VH3HUPLWSURFHVVIRUFRQVWUXFWLRQZLWKLQWKH+LOOVLGH2YHUOD\'LVWULFWZLOOSURYLGH DQRWKHUOD\HURIUHYLHZIRUVDIHW\VWDQGDUGVUHODWHGWRZLOGILUHWKDWPD\QRWRWKHUZLVH EHUHTXLUHGIRU³E\ULJKW´KRXVLQJLHFRQVWUXFWLRQRIKRXVLQJUHTXLULQJDPLQLVWHULDO EXLOGLQJSHUPLWZLWKLQWKH:HVWHUQ+LOOV$VQRWHGDERYH'HYHORSPHQW3DUFHOV PD\EHGHYHORSHGZLWKLQWKH&RXQW\¶VMXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWEXWZLOO EHUHTXLUHGWREHGHYHORSHGWR5+VWDQGDUGV7KH&LW\¶VXOWLPDWHDFTXLVLWLRQRIWKH SURSHUW\ZLOOHQDEOHWKHSUHVHUYDWLRQDQGPDLQWHQDQFHRIDFUHVRIODQGIRURSHQ VSDFHDQGHQKDQFHGILUHPLWLJDWLRQDVVHWVZKLOHOLPLWLQJGHYHORSPHQWWRVHYHQVLQJOH IDPLO\KRPHV ZLWKWKHSRVVLELOLW\RIVHYHQDFFHVVRU\GZHOOLQJXQLWV ZLWKLQDFUHV Fuel Break7KHIXHOEUHDNDOVRNQRZQDVDVKDGHGIXHOEUHDNLVDILUHSUHYHQWLRQ DQG PLWLJDWLRQ PHDVXUH LPSOHPHQWHG LQ WKH 8NLDK 9DOOH\ IRU WKH :HVWHUQ+LOOV ERUGHULQJ&LW\OLPLWV$VKDGHGIXHOEUHDNLVDIRUHVWPDQDJHPHQWVWUDWHJ\XVHGIRU PLWLJDWLQJWKHWKUHDWRIZLOGILUH7KHJRDORIDVKDGHGIXHOEUHDNLVWRWKLQWKHVXUIDFH YHJHWDWLRQFRQGXFWVHOHFWLYHWKLQQLQJUHPRYHGHDGDQGGRZQHGZRRG\PDWHULDODQG UHPRYHODGGHUIXHOVWRSUHYHQWDFDWDVWURSKLFILUHDQGORVVRIVWUXFWXUHV $VVXSSRUWHGE\&RPPHQW/HWWHUVXEPLWWHGE\&DO)LUH¶VIRUPHU%DWWDOLRQ&KLHI 0LFKDHO0D\QDUG WR ZKRZDVUHVSRQVLEOHIRUIXHOUHGXFWLRQHIIRUWVLQWKH 6WDWH5HVSRQVLELOLW\$UHDRIWKH8NLDK9DOOH\DQGVXUURXQGLQJDUHDVWKH3URSRVHG 3URMHFWSDUFHOVDUHDPRQJ³WKHPRVWFULWLFDO´SURSHUWLHVIURPDILUHILJKWHUSHUVSHFWLYH 7KHSDUFHOVDUHORFDWHGLQWKHPLGGOHRIWKH:HVWHUQ+LOOVDQGUHSUHVHQWWKHNH\WKDW KROGVDOOWKUHHHOHPHQWVRIWKHILUHSUHYHQWLRQZRUNGRQHE\&DO)LUHWRJHWKHULQFOXGLQJ ILUHEUHDNVIXHOEUHDNVDQGSUHVFULEHGEXUQLQJ7KH3URMHFWORFDWLRQSURYLGHVDFFHVV WRWKHWRSRIWKH:HVWHUQ+LOOVIRUILUHUHVRXUFHVWKDWGLGQRWH[LVWSULRUWRDQGLV RQHRIWKHIHZELVHFWLQJILUHEUHDNVQDWXUDORUPDQPDGHRQWKHZHVWHUQVLGHRI8NLDK $OWKRXJKWKH3URSRVHG3URMHFWPD\UHVXOWLQDOLPLWHGQXPEHURIVLQJOHIDPLO\KRPHV WRWKHZHVWRIWKHVKDGHGIXHOEUHDNWKHVHQHZKRPHVZRXOGQRWWDNHDZD\IURPWKH YDOLGLW\RIWKHIXHOEUHDNDVWKHEUHDNVWLOOSURYLGHVDOD\HURISURWHFWLRQWRWKHXUEDQ LQWHUIDFHDQGDGHIHQVLEOHVSDFHIRUILUHILJKWLQJVWDJLQJLIQHHGHG$VQRWHGE\0U 0D\QDUG³7KHFRQVROLGDWLRQRIWKHSDUFHOVXQGHU&LW\JXLGDQFHZLOODOORZIRUDVLQJOH 7KH+LOOVLGH2YHUOD\'LVWULFW5HJXODWLRQVFDQEHIRXQGRQOLQHDW KWWSVZZZFRGHSXEOLVKLQJFRP&$8NLDK8NLDK8NLDKKWPODUW Page 558 of 800 HQWLW\WRPDQDJHWKHIXHOUHGXFWLRQZRUNPDQDJHWKHZDWHUVKHGDQGUHGXFHULVNWR WKHFRPPXQLW\´ +DYLQJWKHPDMRULW\RIWKHODQGVXQGHU&LW\RZQHUVKLSZLOODOVRDOORZIRUFRKHVLYH SODQQHG PDLQWHQDQFH RI WKH IXHO EUHDN)XWXUHKRPHRZQHUV ZLOO EH UHTXLUHG WR PDLQWDLQ WKHLU SURSHUW\ WR ILUH VWDQGDUGV DV SDUW RI WKHLUPHPEHUVKLS LQ WKH +RPHRZQHUV$VVRFLDWLRQ,QWKHPHPRUDQGXPSURYLGHGE\89)$&KLHI+XWFKLVRQ 5HVSRQVH WR &RPPHQWV $WWDFKPHQW $ &KLHI +XWFKLVRQVWDWHV WKDW WKH OLPLWHG QXPEHURIVWUXFWXUHVUHVXOWLQJIURPWKH3URMHFWZRXOGKDYHPLQLPDOLIDQ\LPSDFWVRQ WKHIXHOEUHDN¶VHIIHFWLYHQHVV7KH&KLHIDOVRVWDWHVWKDWILUHKD]DUGVLQWKH3URMHFW DUHDDUHQRWJUHDWHUWKDQRWKHUDUHDVVLPLODUWRWKH3URMHFWORFDWLRQDQGWKDWWKH GHIHQVLEOHVSDFHVFUHDWHGE\WKHKRPHVLWHVFRXOGHYHQHQKDQFHLWVHIIHFWLYHQHVVLQ WKDWOLPLWHGDUHD 7KHZDWHUVWRUDJHWDQNVZLOOVHUYHWKH'HYHORSPHQW3DUFHOVDQGIRUILUHSURWHFWLRQ 7KHIXWXUH+RPHRZQHU¶V$VVRFLDWLRQZLOORZQWKHWDQNVDQGSURYLGHDOOPDLQWHQDQFH RQWKHWDQNVDQGLWVDVVRFLDWHGHTXLSPHQW3HUWKH&DOLIRUQLD)LUH&RGHDSRUWLRQRI WKHZDWHU YDULHVEDVHGRQVL]HDQGQXPEHURIKRPHV ZLOOEHUHTXLUHGWREHDOORWWHG IRUILUHSURWHFWLRQVHUYLFHVDQGFDQQRWEHXVHGIRUUHVLGHQWLDOXVH)LUHK\GUDQWVDUH DOVRUHTXLUHGWREHLQVWDOOHGZLWKWKHUHVLGHQWLDOGHYHORSPHQW  3UH]RQLQJDQG2SHQ6SDFH6RPHFRPPHQWHUVHUURQHRXVO\VWDWHGWKDWWKHRSHQVSDFH SDUFHOVZLOOEHDSXEOLFSDUN6RPHFRPPHQWHUVH[SUHVVHGFRQFHUQUHJDUGLQJSXEOLF DFFHVV WR WKH RSHQ VSDFH DUHD /DVWO\ WKHUH ZHUH VHYHUDO TXHVWLRQV UHODWHG WR WKH SUH]RQLQJDSSURDFKIRUSDUFHOVZLWKLQDQGRXWVLGHRIWKH&LW\¶V6SKHUHRI,QIOXHQFH 5HVSRQVH7KHUHDUHPDQ\GLIIHUHQWZD\VWRSUHVHUYHODQGDVRSHQVSDFH7KH 3URMHFW'HVFULSWLRQZLWKLQWKH'UDIW,QLWLDO6WXG\DQG0LWLJDWHG1HJDWLYH'HFODUDWLRQ SURSRVHVWZRPHWKRGV L7KHSRUWLRQRIWKHSURSRVHGSDUFHOVZLWKLQWKHFXUUHQW6SKHUHRI,QIOXHQFH D SRUWLRQRI3DUFHOVDQGWRWDOLQJDSSUR[LPDWHO\DFUHVUHIHUUHGWRDVWKH ³,QVLGH&RQVHUYDWLRQ3DUFHOV´ ZLOOEHSUHVHUYHGDVRSHQVSDFHDQGLVSURSRVHG WREHSUH]RQHG³3)´ 3XEOLF)DFLOLWLHV ZKLFKVSHFLILFDOO\LGHQWLILHVSXEOLFRUTXDVL SXEOLFXVHVLQFOXGLQJEXWQRWOLPLWHGWRQDWXUDOUHVRXUFHFRQVHUYDWLRQDUHDVDQG SDUNVDQGUHFUHDWLRQ LL7KH&LW\ZLOOSUHVHUYHWKHSRUWLRQRIWKH&RQVHUYDWLRQ3DUFHOVORFDWHGRXWVLGHRI WKH6SKHUH RI ,QIOXHQFH ³2XWVLGH &RQVHUYDWLRQ 3DUFHOV´ FRQVLVWLQJ RI DSSUR[LPDWHO\DFUHV DVRSHQVSDFHWKURXJK&LW\&RXQFLOUHVROXWLRQRURWKHU PHDQV UDWKHU WKDQ SUH]RQLQJ WKHP ³3)´ 3URSRVHG 3DUFHOV  DQG  ZRXOG HIIHFWLYHO\EH³VSOLW]RQHG´LHWKHSRUWLRQZLWKLQWKH62,ZRXOGEHSUH]RQHG3) ZKLOHWKHUHPDLQLQJSRUWLRQRXWVLGHRIWKH62,ZRXOGQRWEHSUH]RQHGEXWZRXOG EH PDGH VXEMHFW WR D FRQVHUYDWLRQ HDVHPHQW RU RWKHU &LW\ &RXQFLO DFWLRQ SURKLELWLQJGHYHORSPHQWDQGSUHVHUYLQJLWDVRSHQVSDFH 7KH0HQGRFLQR &RXQW\ /RFDO $JHQF\ )RUPDWLRQ &RPPLVVLRQ /$)&R ZKLFKLV WKH 5HVSRQVLEOH$JHQF\XQGHU&(4$DQGZLOOXOWLPDWHO\FRQVLGHUWKH&LW\¶VDQQH[DWLRQDQG SUH]RQLQJDSSOLFDWLRQVXEPLWWHGFRPPHQWV VHH&RPPHQW/HWWHU VWDWLQJWKDWWKH ³2XWVLGH &RQVHUYDWLRQ 3DUFHOV´ PXVW EH LQFOXGHG LQ WKH SUH]RQLQJDSSOLFDWLRQ SHU Page 559 of 800 *RYHUQPHQW&RGH6HFWLRQ D  ZKLFKVWDWHV “the decision of the commission with regard to a proposal to annex territory to a city shall be based upon the general plan and prezoning of the city. When the development purposes are not made known to the annexing city, the annexation shall be reviewed on the basis of the adopted plans and policies of the annexing city or county. A commission shall require, as a condition to annexation, that a city prezone the territory to be annexed or present evidence satisfactory to the commission that the existing development entitlements on the territory are vested or are already at build-out, and are consistent with the city’s general plan. However, the commission shall not specify how, or in what manner, the territory shall be prezoned.” $FFRUGLQJO\DQGWRLQFRUSRUDWH/$)&R¶VFRPPHQWVWKH&LW\RI8NLDKSURSRVHVWRSUH]RQH WKHHQWLUHW\RIWKH³&RQVHUYDWLRQ3DUFHOV´ DSSUR[LPDWHO\DFUHV DV3)6HHUHYLVHG )LJXUH3URSRVHG3DUFHO&RQILJXUDWLRQVDQG3UH]RQLQJDQGUHYLVHG7DEOHRIWKH6WDII 5HSRUWZKLFKFRQWDLQVDVXPPDU\RISDUFHODQGSUH]RQLQJLQIRUPDWLRQDVVRFLDWHGZLWK WKH3URSRVHG3URMHFW ,QUHVSRQVHWRFRPPHQWVUHFHLYHGUHJDUGLQJSXEOLFDFFHVVWRWKHRSHQVSDFHDUHDVWKH 3URMHFWVLWH V LVDFFHVVHGYLDDJDWHGSULYDWHURDGDQGQRSXEOLFSDUNLQJLVSURSRVHG7KH 3URMHFWGRHVQRWSURSRVHDSXEOLFSDUNQRUGRHVLWSURSRVHWRDOORZSXEOLFDFFHVVWRWKH RSHQVSDFHODQGV$OWKRXJKWKH&LW\GRHVQRWFXUUHQWO\KDYHDVWDQGDORQH2SHQ6SDFH ]RQLQJ GHVLJQDWLRQ WKH &LW\¶V H[LVWLQJ 3XEOLF )DFLOLWLHV 3)  ]RQLQJ GHVLJQDWLRQ HQFRPSDVVHVODQGVZLWKLQWKH&LW\WKDWFRQWDLQRSHQVSDFHDQGQDWXUDODUHDVSDUNVDV ZHOODVRWKHUSXEOLFIDFLOLWLHV 7KHSURSRVHG'HYHORSPHQW3DUFHOV DSSUR[LPDWHO\DFUHV ZLOOUHPDLQSUH]RQHGIRU 6LQJOH)DPLO\ 5HVLGHQWLDO+LOOVLGH ±+  2YHUOD\ 'LVWULFW ZKLFKLV LQWHQGHG WR VXSSRUW SODQQLQJGHVLJQDQGGHYHORSPHQWDFWLYLWLHVLQKDUPRQ\ZLWKQDWXUDOSK\VLFDOIHDWXUHV DQGPLQLPL]HSRWHQWLDOVDIHW\ZDWHUUXQRIIDQGVRLOHURVLRQFRQFHUQVDVVRFLDWHGZLWKWKH QDWXUDOWHUUDLQ 7KH 3URMHFWZLOODFTXLUH DQG SUHVHUYH RSHQ VSDFH IRU VHYHUDO UHDVRQV LQFOXGLQJ VRXUFHZDWHUSUHVHUYDWLRQILUHPLWLJDWLRQVFHQLFUHVRXUFHVDQGELRORJLFDOSUHVHUYDWLRQ 7KLVDSSURDFKZLOODOORZWKH&LW\WRSUHVHUYHDQGSURWHFWWKHFROOHFWLYH&RQVHUYDWLRQ 3DUFHOV DFUHVWRWDO ZKLOHSHUPLWWLQJOLPLWHGRUGHUO\FOXVWHUHGORZGHQVLW\VLQJOH IDPLO\KRXVLQJGHYHORSPHQWZLWKLQWKH'HYHORSPHQW3DUFHOV DFUHV  &200(17/(77(50$5*2)5$1. &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUH 5HVSRQVH6HH0DVWHU5HVSRQVH &200(17/(77(5&5,63,1%+2//,16+($' &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUH 5HVSRQVH6HH0DVWHU5HVSRQVH &200(17/(77(58//$%5811%(5*5$1' &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUH Page 560 of 800 5HVSRQVH6HH0DVWHU5HVSRQVH &RPPHQW7KHFRPPHQWHUVXJJHVWVWKDWWKHSURMHFWEHUHYLVHGWRRQO\DOORZRQHGZHOOLQJSHU SDUFHODQGOHVV'HYHORSPHQW3DUFHOV 5HVSRQVH8QGHUWKH&RXQW\¶V*HQHUDO3ODQDQG=RQLQJ2UGLQDQFHWKHHQWLUHW\RIWKH DFUHVKDVWKHSRWHQWLDOWREHGHYHORSHGZLWKXSWRRQHGZHOOLQJSHUDFUHVIRUD WRWDORISULPDU\GZHOOLQJV,QDGGLWLRQLQDFFRUGDQFHZLWKVWDWHODZDQ$FFHVVRU\ 'ZHOOLQJ8QLW$'8PD\EHFRQVWUXFWHGDVRIULJKWRQHDFKSDUFHOUHVXOWLQJLQWKHSRWHQWLDO IRUXSWRWRWDOXQLWVWREHGHYHORSHG%\ULJKWGHYHORSPHQWGRHVQRWLQFOXGHSXEOLFRU GLVFUHWLRQDU\UHYLHZQRUGRHVLWLQFOXGHLQGHSWKHQYLURQPHQWDOUHYLHZ 7KH3URSRVHG3URMHFWDQG'HYHORSPHQW$JUHHPHQWZRXOGUHVWULFWGHYHORSPHQWWRRQH VLQJOHIDPLO\GZHOOLQJSHUSDUFHODQGRQH$'8 DVUHTXLUHGE\ODZH[FHSWLQFDVHVZKHUH WKHVORSHH[FHHGVSHUFHQWSHUWKH&LW\¶V+LOOVLGH2YHUOD\2UGLQDQFH IRUDWRWDORIXS WRSRWHQWLDOXQLWV'XHWRWKHVHFRQVWUDLQWVDVZHOODVRWKHUUHVWULFWLRQVZLWKLQWKH +LOOVLGH 2YHUOD\ =RQLQJ 'LVWULFWDIWHU WKH SDUFHOV DUH DQQH[HG LQWR WKH &LW\ WKH GHYHORSPHQWRIVLQJOHIDPLO\KRPHVRQWKH'HYHORSPHQW3DUFHOVZRXOGRQO\RFFXULI LQGLYLGXDO DSSOLFDQWVRZQHUV SXUFKDVH WKH KRPH VLWHV IURP WKH GHYHORSHU VXEPLW D FRPSOHWHSURMHFWVSHFLILFVLWHSODQDQG8VH3HUPLWDSSOLFDWLRQDQGUHFHLYHDSSURYDOIURP WKH 8NLDK3ODQQLQJ &RPPLVVLRQ$V QRWHG DERYH 'HYHORSPHQW 3DUFHOV  PD\ EH GHYHORSHGZLWKLQWKH&RXQW\¶VMXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWEXWZLOOEHUHTXLUHG WREHGHYHORSHGWR5+VWDQGDUGVWKURXJK&& 5V 6XPPDUL]LQJWKH3URMHFWZRXOGUHVXOWLQDUHGXFWLRQLQWKHQXPEHURIXQLWVWKDWDUH FXUUHQWO\DOORZHG8QGHUH[LVWLQJFRQGLWLRQVWKHUHLVSRWHQWLDOIRUXSWRXQLWVWREH GHYHORSHGE\ULJKW,IWKH3URMHFWLVDSSURYHGWKLVQXPEHUZRXOGEHUHGXFHGWRDPD[LPXP RIXSWRXQLWV &200(17/(77(5$//,('8**$1 &RPPHQW7KHFRPPHQWHUH[SUHVVHVRSSRVLWLRQWRWKH3URMHFW 5HVSRQVH7KLVFRPPHQW LV QRWHG DQG LV LQFOXGHG LQWKH SXEOLFUHFRUGIRU 3ODQQLQJ &RPPLVVLRQDQG&LW\&RXQFLOFRQVLGHUDWLRQ &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJWUDIILFRQ5HGZRRG$YHQXH 5HVSRQVH$V QRWHG LQ 6HFWLRQ 7UDQVSRUWDWLRQ RI WKH ,601' LPSDFWV WR WUDQVSRUWDWLRQDQGWUDIILFZRXOGEHVLJQLILFDQWLIWKH3URMHFWFRQIOLFWHGZLWKDORFDOSODQ RUGLQDQFH RU SROLF\ DGGUHVVLQJ WUDQVLW URDGZD\ ELF\FOH DQG SHGHVWULDQ IDFLOLWLHV FRQIOLFWHGZLWK&(4$*XLGHOLQHV6HF E ZKLFKFRQWDLQVFULWHULDIRUDQDO\]LQJ WUDQVSRUWDWLRQLPSDFWVVXEVWDQWLDOO\LQFUHDVHGKD]DUGVGXHWRJHRPHWULFGHVLJQIHDWXUHV RUUHVXOWHGLQLQDGHTXDWHHPHUJHQF\DFFHVV$VQRWHGLQWKH,601'WKH3URMHFWZRXOG QRW FRQIOLFW ZLWK D ORFDO SODQ RU RUGLQDQFH UHODWHG WR WUDIILFDQG LV UHTXLUHG WR EH LQ FRPSOLDQFHZLWKDOO)LUHDQG%XLOGLQJFRGHVUHODWHGWRHPHUJHQF\DFFHVVDQGVDIHW\0LQRU LQFUHDVHVWRWUDIILFRQDGMDFHQWVWUHHWV VSHFLILFDOO\5HGZRRG$YHQXHDQG+HOHQ$YHQXH  FRXOGRFFXUIURPKHDY\HTXLSPHQWUHTXLUHGIRUURDGDQGXWLOLW\LPSURYHPHQWVEXWZRXOG EHFRQVLGHUHGWHPSRUDU\ PRQWKV ,QDGGLWLRQWKHDGMDFHQWVWUHHWVZLOOQRWEHFORVHG WR WKURXJK WUDIILF GXULQJ FRQVWUXFWLRQ RIWKH URDG DQG XWLOLW\ LPSURYHPHQWV ZLWK WKH H[FHSWLRQRIWKHSRWHQWLDOWRKDYHWHPSRUDU\ ILYHWRWHQPLQXWH FORVXUHVZKHQVSHFLDOW\ Page 561 of 800 HTXLSPHQWPD\EHGHOLYHUHGWRWKHMREVLWH)XUWKHULWLVXQOLNHO\WKDWDOORIWKHVLQJOHIDPLO\ KRPHVZRXOGEHGHYHORSHGDWWKHVDPHWLPHDQGLPSDFWVWRWUDIILFZRXOGEHDQDO\]HGRQ DSURMHFWOHYHOEDVLV)RUWKHDIRUHPHQWLRQHGUHDVRQVLQDGGLWLRQWRWKRVHGLVFXVVHGLQ WKH,601'WUDIILFLPSDFWVDVVRFLDWHGZLWKWKH3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQW &RPPHQW7KHFRPPHQWHUVWDWHVWKDWZLOGOLIHH[LVWVLQWKHDUHDDQGWKDWGHYHORSPHQWZRXOG GHVWUR\WKHLUKDELWDW7KHFRPPHQWHUIXUWKHUVWDWHVWKDWDQ\LPSDFWWRZLOGOLIHVKRXOGEHDQDO\]HG SULRUWRGHYHORSPHQW 5HVSRQVH$VQRWHGLQ6HFWLRQ%LRORJLFDO5HVRXUFHVRIWKH,601'D%LRORJLFDO 5HVRXUFHV$VVHVVPHQW %5$ WLWOHG³%LRORJLFDO$VVHVVPHQW5HSRUW´ZDVSUHSDUHGIRUWKH 3URMHFW E\ -DFREV]RRQ  $VVRFLDWHV ,QF 7KH %5$ LV GHVLJQHG WR LGHQWLI\ VHQVLWLYH FRPPXQLWLHVZLWKLQWKHVWXG\DUHDDQGGHWHUPLQHWKHH[LVWHQFHRUSRWHQWLDORFFXUUHQFH IRUVSHFLDOVWDWXVVSHFLHVDVZHOODVLPSDFWVWRELRORJLFDOUHVRXUFHVDVVRFLDWHGZLWKWKH 3URMHFW7KH%5$IRXQGWKDWDOOLPSDFWVWRELRORJLFDOUHVRXUFHVZRXOGEHUHGXFHGWROHVV WKDQVLJQLILFDQWZLWKLPSOHPHQWDWLRQRI0LWLJDWLRQ0HDVXUHV%,2WKURXJK%,2ZKLFK UHTXLUHSUHFRQVWUXFWLRQVXUYH\VIRUQHVWLQJELUGVDQGVHQVLWLYHVSHFLHV3OHDVHUHIHUWR 6HFWLRQDQG$WWDFKPHQW%RIWKH,601'IRUPRUHLQIRUPDWLRQ &RPPHQW7KHFRPPHQWHUUHIHUHQFHVD0HQGRFLQR9RLFHQHZVDUWLFOHIURP-DQXDU\ WKDW VWDWHV WKDWWKH 'RQDWLRQ 3DUFHO ZDV GRQDWHG IRU RSHQ VSDFH DQGILUH PLWLJDWLRQ DQG GHYHORSPHQWRIWKHSDUFHOZDVQHYHUPHQWLRQHG 5HVSRQVH&RQVLVWHQWZLWKWKH-DQXDU\QHZVDUWLFOHDQGDVGLVFXVVHGLQWKH 3URMHFW 'HVFULSWLRQ WKH 'RQDWLRQ 3DUFHOZLOO EH SURWHFWHG DV RSHQ VSDFH DQG LV QRW SURSRVHGIRUGHYHORSPHQW7KH&LW\ZLOOFRRSHUDWHZLWK&DO)LUHDQGRWKHUHQWLWLHVWR FRQWLQXHHIIRUWVIRUILUHPLWLJDWLRQZRUN $V LV FRPPRQ ZLWK RWKHU RSHQ VSDFH FRQVHUYDWLRQ SURMHFWV WKH VFRSH RI WKH 8NLDK :HVWHUQ+LOOV2SHQ/DQG$FTXLVLWLRQ /LPLWHG'HYHORSPHQW3URMHFWKDVHYROYHGVLQFH LWVLQFHSWLRQLQWRWKHFXUUHQWSURSRVDO7KH&LW\RI8NLDKKDVQRW\HWDFTXLUHGDQ\ODQGLQ WKHSURSRVHGSURMHFWDUHDEXWGLGUHFHLYHDGRQDWLRQRIDFUHV UHIHUUHGWRDVWKH ³'RQDWLRQ3DUFHO´ 7KHGRQDWLRQRIWKHODQGWKDWZDVFRPSOHWHGLQZDVQRWSDUWRI WKH3URSRVHG3URMHFWDQGLQIDFWZDVGRQHLQSDUWZLWKWKHKRSHVRIVWUHQJWKHQLQJIXWXUH JUDQWDSSOLFDWLRQV 8QGHUWKH&RXQW\RI0HQGRFLQR¶VMXULVGLFWLRQSRUWLRQVRIWKH3URMHFWVLWHVVSHFLILFDOO\WKH SURSRVHG'HYHORSPHQW3DUFHOVKDYHEHHQXQGHUFRQVLGHUDWLRQIRUGHYHORSPHQWIRUWKH SDVWVHYHUDO\HDUVDV0U+XOOLQWHQGHGWRGHYHORSSRUWLRQVZLWKUHVLGHQWLDOGHYHORSPHQW DWVRPHSRLQWLQWKHIXWXUH7KHVHLPSURYHPHQWVZHUHQRWGRQHLQUHODWLRQWRWKH3URSRVHG 3URMHFWRULQFRRUGLQDWLRQZLWKWKH&LW\RI8NLDK7KH&LW\¶VLQYROYHPHQWZLWKWKHSURSHUW\ LQFOXGHGHIIRUWVWRVHFXUHJUDQWIXQGLQJLQDQGIRUDFTXLVLWLRQRIWKHHQWLUH SURMHFWVLWHEXWWKHVHHIIRUWVZHUHXQVXFFHVVIXO,QWKHPHDQWLPHWKHSURSHUW\RZQHUKHOG WKHSURSHUW\IRUWKHSRVVLEOHJUDQWDFTXLVLWLRQEXWDOVRFRQWLQXHGSURSHUW\LPSURYHPHQWV GXULQJWKDWWLPH 7KH&LW\ZDVDSSURDFKHGE\0U+XOODIWHUWKH&LW\¶VODVWXQVXFFHVVIXOJUDQWDSSOLFDWLRQ DQGEHJDQWRORRNDWRWKHUVROXWLRQVWRDFTXLULQJWKHSURSHUW\7RFRPSOHWHWKHDFTXLVLWLRQ WKH&LW\ZLOOHQWHULQWRD3URSHUW\([FKDQJHDQG'HYHORSPHQW$JUHHPHQW ³'HYHORSPHQW $JUHHPHQW´  ZLWK WKH FXUUHQW RZQHU RI WKH +XOO 3URSHUWLHV VXEMHFW WR WKH DQQH[DWLRQ Page 562 of 800 DSSOLFDWLRQ 8QGHU WKH 'HYHORSPHQW $JUHHPHQW WKH FXUUHQW RZQHU ZLOO FRQYH\ WKH $QQH[DWLRQ3DUFHOVWRWKH&LW\LQH[FKDQJHIRUUHDOSURSHUW\RZQHGE\WKH&LW\DQGD SD\PHQWIURPWKH&LW\RIDQDPRXQWWRPDNHXSWKHGLIIHUHQFHEHWZHHQWKHIDLUPDUNHW YDOXHRIWKHH[FKDQJHGSURSHUWLHV 7KH RQO\ SRUWLRQ RI WKH SURMHFW WKDW LQFOXGHV WKH SRWHQWLDO IRU GHYHORSPHQW LV WKH  HDVWHUQPRVWDFUHVORFDWHGGLUHFWO\DGMDFHQWWRWKHFXUUHQW&LW\OLPLWV$VQRWHGLQUHVSRQVH WR&RPPHQW/HWWHUFXUUHQWO\WKHODQGVSURSRVHGIRUDQQH[DWLRQFRXOGEHGHYHORSHGE\ ULJKWXQGHUOHVVUHVWULFWLYH]RQLQJWKDQZKDWLVFXUUHQWO\SURSRVHGLQWKH'HYHORSPHQW $JUHHPHQW7KH &LW\¶V DFTXLVLWLRQ RI WKH SURSHUW\ ZLOO HQDEOH WKH SUHVHUYDWLRQ DQG PDLQWHQDQFHRIWKHQRQGHYHORSHGODQGIRURSHQVSDFHDQGHQKDQFHGILUHPLWLJDWLRQ DVVHWVZKLOHOLPLWLQJGHYHORSPHQWWRVHYHQVLQJOHIDPLO\KRPHV ZLWKWKHSRVVLELOLW\RI VHYHQ$'8V ZLWKLQDFUHV &RPPHQW7KHFRPPHQWHUH[SUHVVFRQFHUQVUHJDUGLQJZLOGILUH 5HVSRQVH6HH0DVWHU5HVSRQVH &RPPHQW7KHFRPPHQWHUHUURQHRXVO\VWDWHVWKDW³WKLVSURMHFWVWDUWHGRQ$SULODQGWKH KRPHRZQHUVRQ5HGZRRG$YHQXHZKRZRXOGEHPDMRUO\LPSDFWHGZHUHJLYHQSULQWHGQRWLFHRI LWRQ0D\QHDUO\DPRQWKDIWHUWKLVSURFHVVKDVVWDUWHG´ 5HVSRQVH7KH&LW\KDVIROORZHGQRWLFLQJSURFHGXUHVLQFRPSOLDQFHZLWK&LW\QRWLFLQJ UHTXLUHPHQWVDQGWKH*RYHUQPHQW&RGH6SHFLILFDOO\WKH1RWLFHRI,QWHQWWRDGRSWWKH ,601'DQGFRQGXFWDSXEOLFKHDULQJZDVSURYLGHGLQWKHIROORZLQJPDQQHULQDFFRUGDQFH ZLWK8NLDK&LW\&RGH 8&& †DQG&(4$*XLGHOLQHV6HFWLRQ •3URYLGHGWRSURSHUW\RZQHUVZLWKLQIHHWRIWKHSURMHFWSDUFHOVDVZHOODVDJHQFLHV DQGGHSDUWPHQWVZLWKMXULVGLFWLRQRULQWHUHVWRYHUWKHSURMHFWRQ$SULO-XQH DQG$XJXVW •3URYLGHGWRPHPEHUVRIWKHSXEOLFDJHQFLHVDQGLQWHUHVWHGSDUWLHVZKRVXEPLWWHG ZULWWHQFRPPHQWVRQWKH'UDIW,601'GXULQJWKHSXEOLFUHYLHZSHULRGRQ$XJXVW  •3XEOLVKHGLQWKH8NLDK'DLO\-RXUQDORQ$SULO-XQHDQG$XJXVW  •3RVWHGRQWKH3URMHFWVLWHRQ0D\-XQHDQG$XJXVW •3RVWHGDWWKH&LYLF&HQWHU JODVVFDVH KRXUVSULRUWRWKHSXEOLFKHDULQJ •1RWLFHGIRUFRQWLQXDQFHDWWKH0D\3ODQQLQJ&RPPLVVLRQKHDULQJWRDGDWH FHUWDLQRI-XQHDQG •1RWLFHIRUFRQWLQXDQFHDWWKH-XQH3ODQQLQJ&RPPLVVLRQWRDGDWHXQFHUWDLQ ,QDGGLWLRQEDVHGRQWKHDPRXQWRILQWHUHVWLQWKH3URMHFWDQGWRUHFHLYHDVPXFKSXEOLFLQSXW DVSRVVLEOHDGGLWLRQDOSXEOLFQRWLFLQJZDVFRQGXFWHGLQWKHIROORZLQJPDQQHU •3RVWHGRQWKH&LW\RI8NLDKZHEVLWHRQ$SULODQG$XJXVW •(PDLOHGWR3ODQQLQJ&RPPLVVLRQHUVDQG&LW\&RXQFLOPHPEHUVRQ$SULODQG $XJXVW •+DQGGHOLYHUHGWRDOOUHVLGHQFHV LQDGGLWLRQWRDQGEH\RQGWKHIRRWUHTXLUHPHQW  RQ5HGZRRG$YHQXHRQ0D\DQGPDLOHGWRDOOUHVLGHQFHVRQ5HGZRRG $YHQXHRQ$XJXVW  Page 563 of 800 &200(17/(77(5:HVWHUQ+LOOV)LUH6DIH&RXQFLO &RPPHQW7KHFRPPHQWHUUHIHUHQFHVD'HFHPEHU8NLDK'DLO\-RXUQDOQHZVDUWLFOH UHJDUGLQJWKHGRQDWLRQRIWKH'RQDWLRQ3DUFHOWRWKH&LW\E\0U+XOODQGVWDWHVWKDWLWGLGQRW PHQWLRQWKHDFTXLVLWLRQDQGDQQH[DWLRQRIWKHUHPDLQLQJSURSHUWLHVSURSRVHGXQGHUWKH3URMHFW 5HVSRQVH6HH UHVSRQVH WR &RPPHQW /HWWHU  UHJDUGLQJ WKH 'RQDWLRQ 3DUFHO DQG HYROXWLRQRIWKH3URSRVHG3URMHFW &RPPHQW7KHFRPPHQWHUVWDWHVWKDWRQ$SULOWKH1RWLFHRI,QWHQWZDVVHQWWRDIHZ 5HGZRRG$YHQXHDQG6DQ-DFLQWD'ULYHSURSHUW\RZQHUV 5HVSRQVH6HHUHVSRQVHWR&RPPHQW/HWWHUUHJDUGLQJQRWLFLQJ &RPPHQW³7KHPDMRULW\RIWKHSURSHUW\LV]RQHG3)SXEOLFIDFLOLWLHV,W>LV@SRVVLEOHWRFKDQJH WKLV]RQLQJGHVLJQDWLRQLQWKHIXWXUHWR5+]RQLQJ VLQJOHIDPLO\UHVLGHQWLDO VKRXOGWKHUHEH LQWHUHVWLQIXUWKHUGHYHORSPHQW,VLWSRVVLEOHWRFKDQJHWKH]RQLQJRQWKHLQVLGHFRQVHUYDWLRQ3) ]RQHGSDUFHOV ,601'PDSS WRD&RQVHUYDWLRQ(DVHPHQWLQSHUSHWXLW\DORQJZLWKWKHRXWVLGH FRQVHUYDWLRQSDUFHOVIRUD8NLDK:LOGOLIH6DQFWXDU\"´ 5HVSRQVH7KHUHDUHPDQ\GLIIHUHQWZD\VWRSUHVHUYHODQGDVRSHQVSDFH$VQRWHGLQ 0DVWHU5HVSRQVHWKH3URMHFWSURSRVHVWRSUH]RQHWKHHQWLUHDFUHVIRURSHQVSDFH DV³3)´,QDFFRUGDQFHZLWKWKH*RYHUQPHQW&RGHSDUFHOVLQFOXGHGLQWKHSUH]RQHFDQQRW EHUH]RQHGIRUDSHULRGRIWZR\HDUVDIWHUDGRSWLRQ,QDGGLWLRQEHFDXVHWKHSDUFHOVZLOO EHXQGHU&LW\RZQHUVKLSWKH&LW\ZLOOKDYHFRQWURORYHUWKHXVHRIWKHSDUFHOV7KH&LW\¶V ORQJWHUP JRDOV IRU WKH SDUFHOV LQFOXGHRSHQVSDFH DQG GR QRW LQFOXGHUHVLGHQWLDO GHYHORSPHQW &RPPHQW7KHFRPPHQWHUDVNVWKHIROORZLQJTXHVWLRQVUHJDUGLQJWKHSURSRVHGZDWHUWDQN ³:KDWDUHWKHSODQVIRUWKHQHZZDWHUVWRUDJHWDQNEHVLGHVILUHSURWHFWLRQPHDVXUHV":KRZLOO EHUHVSRQVLEOHIRUPDLQWDLQLQJWKHJDOORQWDQNSXPSDQGZHOOWKDWVXSSRUWVWKHZDWHU WDQN",VWKHZDWHULQWKLVWDQNGHGLFDWHGIRUILUHGHSDUWPHQWXVHRUDOVRIRUXVHRISRWHQWLDO GRPHVWLFSXUSRVHVIRUWKHEXLOGRXW":LOOWKHUHEHK\GUDQWVRQWKHFLW\ZDWHUPDLQH[WHQGLQJXS IURP5HGZRRG$YHQXH"´ 5HVSRQVH7KHQHZZDWHUVWRUDJHWDQNVZLOOEHXVHGWRVHUYHWKH'HYHORSPHQW3DUFHOV ,QDGGLWLRQWKH\ZLOOEHXVHGIRUILUHSURWHFWLRQ7KHWDQNVZLOOEHRZQHGDQGPDLQWDLQHG E\WKH+2$3HUWKH&DOLIRUQLD)LUH&RGHDSRUWLRQRIWKHZDWHU YDULHVEDVHGRQVL]HDQG QXPEHURIKRPHV ZLOOEHUHTXLUHGWREHDOORWWHGIRUILUHSURWHFWLRQVHUYLFHVDQGFDQQRWEH XVHGIRUUHVLGHQWLDOXVH)LUHK\GUDQWVDUHDOVRUHTXLUHGWREHLQVWDOOHGZLWKWKHUHVLGHQWLDO GHYHORSPHQW &RPPHQW7KH FRPPHQWHU VWDWHV ³1HLO 'DYLV¶>V@UHVSRQVHV WR :+)6& TXHVWLRQV WR 0U 6DQJLDFRPRUHJDUGLQJWKH+XOO3URSHUWLHV/LPLWHG'HYHORSPHQW$JUHHPHQWLQFOXGHGDTXHVWLRQ RQZDWHUUHVRXUFHV0U'DYLVVWDWHG³«WKLVSURMHFWSURYLGHVVRXUFHZDWHUSURWHFWLRQDQGZLOO EHQHILWWKHHQWLUH8NLDK9DOOH\E\SURWHFWLQJWKHVRXUFHZDWHUDQGHQVXULQJWKDWLWUHDFKHVLWV PD[LPXPSRWHQWLDO´+RZGRHV0U'DYLVGHILQH³VRXUFHZDWHUSURWHFWLRQ"´ 5HVSRQVH$FTXLVLWLRQRIKHDGZDWHUSURSHUWLHVLQWKH:HVWHUQ+LOOVRIWKH8NLDK9DOOH\ SURYLGHV VRXUFH ZDWHU KHDGZDWHU  SURWHFWLRQ EHFDXVH VHFXULQJ WKHVH SURSHUWLHV ZLOO SURYLGHSUHVHUYDWLRQRIKHDGZDWHUSURSHUWLHVLQWKH:HVWHUQ+LOOVWKDWZLOOKHOSHQVXUHWKDW Page 564 of 800 QDWXUDOUXQRIIDQGJURXQGZDWHUUHFKDUJHSDWWHUQVZLOOFRQWLQXHLQSHUSHWXLW\%HQHILWVZLOO LQFOXGHSUHVHUYLQJWKHFXUUHQWK\GURORJ\RIWKH:HVWHUQ+LOOVZKLFKDUHDPDMRUGULYHUIRU WKHUHFKDUJLQJRI8NLDK9DOOH\¶VDTXLIHU3UHVHUYLQJWKHVHSURSHUWLHVZLOOHQVXUHWKDWWKHUH LVQRDGYHUVHFKDQJHWRWKHVHLPSRUWDQWUHVRXUFHVDQGLVFRQVLVWHQWZLWKWKHJRDOVRI VHFWLRQRIWKH6WDWHRI&DOLIRUQLD¶V:DWHU5HVLOLHQFH3RUWIROLRLQWKDWLWZLOO³SURWHFW ZDWHUTXDOLW\DQGVXSSO\´ &RPPHQW,QDGGLWLRQWRH[SUHVVLQJFRQFHUQVUHJDUGLQJZLOGILUHDQGWKHVKDGHGIXHOEUHDNWKH FRPPHQWHUDVNVLIWKHUHVLGHQWLDOGHYHORSPHQWRIWKHHDVWHUQPRVWDFUHVFDQEHWDNHQRXWRI WKH'HYHORSPHQW$JUHHPHQW,QDGGLWLRQWKHFRPPHQWHUDVNVLIWKHORZHUHOHYDWLRQSURSHUWLHV ZHVWRIWKHVKDGHGIXHOEUHDNWKDWUHPDLQLQ0U+XOO¶VSRVVHVVLRQZLOOEHFRQVLGHUHGIRUIXWXUH EXLOGRXW 5HVSRQVH6HH0DVWHU5HVSRQVHDQG&RPPHQW/HWWHUUHJDUGLQJZLOGILUHDQGWKH VKDGHGIXHOEUHDN $VQRWHGLQUHVSRQVHWR&RPPHQW/HWWHULQRUGHUWRFRPSOHWHWKHDFTXLVLWLRQWKH&LW\ ZLOO HQWHULQWR D 3URSHUW\ ([FKDQJH DQG 'HYHORSPHQW $JUHHPHQW ³'HYHORSPHQW $JUHHPHQW´  ZLWK WKH FXUUHQW RZQHU RI WKH +XOO 3URSHUWLHV VXEMHFW WR WKH DQQH[DWLRQ DSSOLFDWLRQ 8QGHU WKH 'HYHORSPHQW $JUHHPHQW WKH FXUUHQW RZQHU ZLOO FRQYH\ WKH $QQH[DWLRQ3DUFHOVWRWKH&LW\LQH[FKDQJHIRUUHDOSURSHUW\RZQHGE\WKH&LW\DQGD SD\PHQWIURPWKH&LW\RIDQDPRXQWWRPDNHXSWKHGLIIHUHQFHEHWZHHQWKHIDLUPDUNHW YDOXHRIWKHH[FKDQJHGSURSHUWLHVWKH&LW\GRHVQRWKDYHWKHIXQGLQJWRSXUFKDVHWKH HQWLUHSURMHFWDUHDZLWKRXWWKLVFRPSRQHQW $V QRWHG LQ WKH 3URMHFW 'HVFULSWLRQ WKH RQO\ SRUWLRQ RI WKH SURMHFW WKDW LQFOXGHV WKH SRWHQWLDOIRUGHYHORSPHQWDUHWKHHDVWHUQPRVWDFUHVORFDWHGGLUHFWO\DGMDFHQWWRWKH FXUUHQW&LW\OLPLWV6HHUHVSRQVHWR&RPPHQW/HWWHUIRUPRUHLQIRUPDWLRQUHJDUGLQJWKH GLVFUHWLRQDU\ UHYLHZ SURFHVV IRU IXWXUH GHYHORSPHQW7KH UHPDLQLQJ DFUHDJH ZLOO EH SUHVHUYHGDVRSHQVSDFH &200(17/(77(5&+5,6:$77 &RPPHQW7KHFRPPHQWHUDVNVLIWKHDQQH[DWLRQUHTXLUHVDWD[VKDULQJDJUHHPHQWZLWKWKH &RXQW\RI0HQGRFLQRDQGLIVRZKDWDFWLRQVKDYHEHHQWDNHQE\WKH&LW\WRVHFXUHDQDJUHHPHQW 5HVSRQVH$ WD[VKDULQJ DJUHHPHQW ZLOO EH UHTXLUHG DV D SDUW RI WKH DQQH[DWLRQ DSSOLFDWLRQ &RPPHQW7KHFRPPHQWHUDVNVLIWKHSDUFHOVSURSRVHGIRUGHYHORSPHQWWREHSUH]RQHGDV 6LQJOH)DPLO\5HVLGHQWLDO+LOOVLGH2YHUOD\'LVWULFW 5+ KDYHEHHQVL]HGFRQVLVWHQWO\ZLWKWKH +LOOVLGH'HYHORSPHQW6WDQGDUGVDQGLIQRWIXUWKHUFRPPHQWVWKHSDUFHOVVKRXOGEHVL]HGLQ DFFRUGDQFHZLWKWKH+LOOVLGH'HYHORSPHQW6WDQGDUGVDQG6XEMHFWWRWKH8VH3HUPLWWLQJ3URFHVV DQGWKH+LOOVLGH'HYHORSPHQW6WDQGDUGV 5HVSRQVH7KH 'HYHORSPHQW3DUFHOV LQFOXGHG LQ WKHRULJLQDOSUHOLPLQDU\/RW /LQH $GMXVWPHQWSURSRVHGWREHSUH]RQHG6LQJOH)DPLO\5HVLGHQWLDO+LOOVLGH2YHUOD\'LVWULFW KDYHEHHQDGHTXDWHO\VL]HGDQGGHVLJQHGLQDFFRUGDQFHZLWKWKH+LOOVLGH2YHUOD\'LVWULFW UHJXODWLRQV6HH5HVSRQVHWR&RPPHQWV$WWDFKPHQW$ZKLFKLQFOXGHVDWRSRJUDSKLFDO PDSDQGWKHDYHUDJHVORSHRIWKH'HYHORSPHQW3DUFHODUHDLQDFFRUGDQFHZLWKWKH +LOOVLGH2YHUOD\ 'LVWULFW ORW VL]H UHTXLUHPHQWV$V QRWHG DERYH LQ WKH 5HYLVLRQV DQG &ODULILFDWLRQVVHFWLRQWKHILQDOUHVXOWLQJFRQILJXUDWLRQPD\YDU\EXWWKHQXPEHURISDUFHOV Page 565 of 800 DQG'HYHORSPHQW3DUFHODUHDIRRWSULQWZLOOQRW$GGLWLRQDOO\WKHILQDOSDUFHOFRQILJXUDWLRQ DQGIXWXUHVLQJOHIDPLO\UHVLGHQWLDOGHYHORSPHQWLVUHTXLUHGWREHLQDFFRUGDQFHZLWKWKH +LOOVLGH2YHUOD\'LVWULFWUHJXODWLRQV)RU'HYHORSPHQW3DUFHOVWKLVLQFOXGHVREWDLQLQJ 3ODQQLQJ&RPPLVVLRQDSSURYDORID8VH3HUPLWIRUGHYHORSPHQWRIDVLQJOHIDPLO\KRXVLQJ XQLW$VQRWHGLQ&RQGLWLRQRI$SSURYDODFRS\RIWKHILQDOUHFRUGHG/RW/LQH$GMXVWPHQW VKDOOEHVXEPLWWHGWRWKH&RPPXQLW\'HYHORSPHQW'HSDUWPHQWSULRUWRVXEPLWWDORID8VH 3HUPLWIRUVLQJOHIDPLO\KRXVLQJ'HYHORSPHQW3DUFHOVPD\EHGHYHORSHGZLWKLQWKH &RXQW\¶VMXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWEXWZLOOEHUHTXLUHGWREHGHYHORSHGWR 5+VWDQGDUGVWKURXJK&& 5VLIGHYHORSHGSULRUWRDQQH[DWLRQ &RPPHQW7KHFRPPHQWHUDVNVLI/DQGVOLGH+D]DUG,GHQWLILFDWLRQ0DS1RSXEOLVKHGLQ E\ WKH &DOLIRUQLD *HRORJLFDO 6XUYH\ ZDV FRQVXOWHG WR GHWHUPLQH WKH SRWHQWLDO SUHVHQFH RI ODQGVOLGH KD]DUGV ZLWK WKH SDUFHOV SURSRVHG IRU GHYHORSPHQW DQG WKH DFFHVV URDGV WR WKH GHYHORSPHQW7KLVUHSRUWVKRXOGEHFRQVXOWHGDQGLQFOXGHGDVDUHIHUHQFHLQWKH,601' 5HVSRQVH$VQRWHGLQWKH5HIHUHQFHVVHFWLRQDQG6HFWLRQ*HRORJ\DQG6RLOVRIWKH ,601'LQIRUPDWLRQUHODWHGWRVRLOVDQGJHRORJ\LQFOXGLQJODQGVOLGHVZDVFRPSLOHGXVLQJ DYDULHW\RIUHVRXUFHVLQFOXGLQJWKH%DFNJURXQG5HSRUWIRUWKH&RXQW\RI0HQGRFLQR *HQHUDO3ODQ8SGDWH SUHSDUHGE\30& DVZHOODVWKH&DOLIRUQLD*HRORJLFDO 6XUYH\86/DQGVOLGH,QYHQWRU\:HE$SSOLFDWLRQDQG(DUWKTXDNH)DXOW0DS8NLDK 7KHVHUHVRXUFHVGRQRWLGHQWLI\WKH'HYHORSPHQW3DUFHOVQRUWKHDFFHVVURDGDVKDYLQJ DKLJKODQGVOLGHKD]DUGSRWHQWLDO &RPPHQW7KHFRPPHQWHUVWDWHVWKDWLWVHHPVLPSUXGHQWWRQRWSHUIRUPDSUHOLPLQDU\VRLOVUHSRUW WRGHWHUPLQHLIWKHSDUFHOVSURSRVHGIRUGHYHORSPHQWKDYHVRLOVRUODQGVOLGHKD]DUGVZKLFKZRXOG SUHFOXGHGHYHORSPHQWRUDWDPLQLPXPVHYHUHO\OLPLWWKHGHYHORSPHQWSRWHQWLDO7KHFRPPHQWHU DOVRVWDWHVWKDWWKH*HRORJ\DQG6RLOVVHFWLRQVKRXOGDOVRUHIHUHQFHWKHUHTXLUHPHQWLQWKH &DOLIRUQLD%XLOGLQJ&RGHWRVXEPLWD*HRWHFKQLFDO5HSRUWIRUHDFKORW  5HVSRQVH7KH3URMHFWGRHVQRWLQFOXGHDSSURYDORIDQ\HQWLWOHPHQWVIRUGHYHORSPHQWRI KRPHV$IWHUWKHSDUFHOVDUHDQQH[HGLQWRWKH&LW\'HYHORSPHQW3DUFHOVZRXOGQRW EHGHYHORSHGXQWLODQDSSOLFDQWVXEPLWVDSURMHFWVSHFLILFVLWHSODQZLWKD8VH3HUPLW DSSOLFDWLRQDQGUHFHLYHV3ODQQLQJ&RPPLVVLRQDSSURYDOIRUGHYHORSPHQWRIDKRPHLQ DFFRUGDQFHZLWKWKH+LOOVLGH2YHUOD\=RQLQJ'LVWULFWUHJXODWLRQV$VVWDWHGLQWKH*HRORJ\ DQG6RLOV6HFWLRQRIWKH,601' 3J WKH+LOOVLGH2YHUO\'LVWULFWUHJXODWLRQV 8&& † F DVRLOVHQJLQHHULQJUHSRUWFRPSOHWHGE\DSURIHVVLRQDOHQJLQHHUUHJLVWHUHGLQ WKHVWDWHRI&DOLIRUQLDLVUHTXLUHGWREHVXEPLWWHGGXULQJWKHGLVFUHWLRQDU\UHYLHZSHULRG IRU GHYHORSPHQW LQFOXGLQJ IXWXUH VLQJOH IDPLO\UHVLGHQWLDO ZLWKLQ WKH +LOOVLGH 2YHUOD\ 'LVWULFW$GGLWLRQDOO\D%XLOGLQJ3HUPLWLVUHTXLUHGIRUUHVLGHQWLDOFRQVWUXFWLRQZKLFKZLOO HQVXUHDOODFWLYLWLHVDUHLQFRPSOLDQFHZLWKEXLOGLQJDQGVHLVPLFVDIHW\FRGHV$VQRWHG DERYHDOWKRXJK 'HYHORSPHQW 3DUFHOV  PD\ EH GHYHORSHG ZLWKLQ WKH &RXQW\¶V MXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWWKH\ZLOOEHUHTXLUHGWREHGHYHORSHGWR5+ VWDQGDUGV WKURXJK && 5V ,Q DGGLWLRQ PLWLJDWLRQ PHDVXUHV LGHQWLILHG IRU UHVLGHQWLDO GHYHORSPHQWLQWKH,601'ZLOOEHDSSOLHGWRDOO'HYHORSPHQW3DUFHOV7KLVLQIRUPDWLRQ KDVEHHQDGGHGWRWKH)LQDO'UDIW,601'  &RPPHQW7KHFRPPHQWHUVWDWHVWKDWWKH:LOGILUHVHFWLRQRIWKH,601'LQGLFDWHVWKDWIXHOEUHDNV DUHGHYHORSHGLQWKHSURMHFWDUHDDQGVWDWHVWKDWWKH,601'GRHVQRWGHVFULEHKRZWKHIXHO EUHDNVZLOOEHPDLQWDLQHG7KHFRPPHQWHUDOVRDVNVWKHIROORZLQJTXHVWLRQV³LIWKH8NLDK9DOOH\ )LUH'LVWULFWKDYHFDSDFLW\WRGHIHQGWKHSURSRVHGGHYHORSPHQWDUHDVDJDLQVWZLOGILUHJLYHQWKH ([WUHPHO\+LJK)LUH5LVNIRUWKHODQGVDGMDFHQWWRWKHSURSRVHGGHYHORSPHQWDUHD":K\QRW Page 566 of 800 VXEMHFWWKHVHSDUFHOVWR:LOGODQG8UEDQ,QWHUIDFHUHTXLUHPHQWV"3HUKDSVLQFOXGHDEHQHILW]RQH WRSD\IRUYHJHWDWLRQPDQDJHPHQWDQGILUHSURWHFWLRQZKLFKLVTXLWHGLIIHUHQWIURPWKHXUEDQ SDUFHOVRIWKH&LW\´  5HVSRQVH6HH0DVWHU5HVSRQVH  &200(17/(77(5-($11(:(7=(/&+,11 &RPPHQW7KHFRPPHQWHUVWDWHVWKHIROORZLQJ³,GRQ¶WWDNHLVVXHZLWKWUDQVIHUULQJVHYHUDORIKLV LQGLYLGXDOSDUFHOVWREHDQQH[HGWRWKH&LW\RI8NLDK+RZHYHUWKHUHDUHFRQFHUQVUHJDUGLQJKRZ WKHDGGLWLRQDODFUHDJHLVSODQQLQJWREHXWLOL]HGDFIRU&RQVHUYDWLRQ/DQGVRQWKHPRVW ZHVWHUQDUHDDFIRU5HFUHDWLRQDO ]RQHG3)3XEOLF)DFLOLWLHV /DQGVLQDQRGGVKDSHG³&´ SDWWHUQDQGDFDV'HYHORSPHQW3DUFHOV ]RQHG5+ RQWKHQRUWKHDVWHUQFRUQHUDVVKRZQ DQG VWDWHG LQ WKH ,601' PDS OHJHQG RQ S :KR RZQV WKH  SDUFHOV EHWZHHQ WKH ³&´ 5HFUHDWLRQDO/DQGVDQGZKDWDUHWKHSODQVIRUWKHVHSDUFHOV"´ 5HVSRQVH7KHFRPPHQWHUHUURQHRXVO\VWDWHVWKDWWKHDFUHVZLWKLQWKH&LW\¶V6SKHUH RI,QIOXHQFHIRURSHQVSDFHZRXOGEHFODVVLILHGDV³5HFUHDWLRQDO/DQGV´7KHVHSDUFHOV DUHSURSRVHGWREHSUH]RQHG³3XEOLF)DFLOLWLHV´DQGXVHGIRURSHQVSDFHDQGFRQVHUYDWLRQ ,WLVXQFOHDUZKDW3DUFHOVWKHFRPPHQWHULVUHIHUULQJWRZKHQWKH\DVN³ZKRRZQVWKH SDUFHOVEHWZHHQWKH³&´5HFUHDWLRQDO/DQGVDQGZKDWDUHWKHSODQVIRUWKHVHSDUFHOV"´ DVWKH3URMHFW'HVFULSWLRQGRHVQRWFODVVLI\DQ\RIWKHSURSRVHGSDUFHOVIRUDQQH[DWLRQLQ VXFKDZD\,QVWHDGDVGLVFXVVHGLQ0DVWHU5HVSRQVHWKH&LW\SURSRVHVWRSUH]RQH WKHHQWLUHDFUHVRIRSHQVSDFHODQGVDV³3)´7KHFRPPHQWHULVUHIHUUHGWR7DEOH RI WKH6WDII 5HSRUWZKLFK FRQWDLQVD VXPPDU\ RISDUFHODQG SUH]RQLQJ LQIRUPDWLRQ DVVRFLDWHGZLWKWKH3URSRVHG3URMHFW &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUHULVNWKHSURMHFWEHLQJORFDWHG ZLWKLQWKH:LOGODQG8UEDQ,QWHUIDFHDUHDDVZHOODVFRPPHQWVUHJDUGLQJWKHVKDGHGIXHOEUHDN WKDWDUHDOVRH[SUHVVHGLQRWKHUFRPPHQWOHWWHUV 5HVSRQVH3OHDVHUHIHUWR0DVWHU5HVSRQVHUHODWHGWRZLOGILUHFRQFHUQV &RPPHQW7KHFRPPHQWHUHUURQHRXVO\VWDWHVWKDWWKHFRPPXQLW\¶VWD[GROODUVZRXOGEHSD\LQJ IRUWKHXWLOLW\H[WHQVLRQVWRWKH'HYHORSPHQW3DUFHOVDQGDVNVZKRZRXOGSD\IRUWKHPDLQWHQDQFH RIWKHJDOORQZDWHUVWRUDJHDQGILUHIDFLOLWLHVWDQNSXPSDQGZHOO 5HVSRQVH7KH SURMHFWLQYROYHV &LW\ DFTXLVLWLRQ RISURSHUW\ZLWK PRVW RI WKH XWLOLW\ LQIUDVWUXFWXUHFRPSOHWHGE\WKHGHYHORSHUDQGLQSODFHSULRUWRDQ\SRWHQWLDOGHYHORSPHQW 7KHSURSHUW\RZQHUGHYHORSHUZLOOEHUHVSRQVLEOHIRUWKHURDGLPSURYHPHQWVLQVWDOODWLRQ DQGPDLQWHQDQFHRIWKHVHZHUV\VWHPZDWHUVWRUDJHWDQNVDQGLWVDVVRFLDWHGHTXLSPHQW (OHFWULFXWLOLWLHVZLOOEHLQVWDOOHGE\WKH&LW\DQGRUWKHGHYHORSHUEXWXOWLPDWHO\ZLOOEH RZQHGDQGPDLQWDLQHGE\WKH&LW\ &RPPHQW7KH FRPPHQWHU VWDWHV WKDW DW WKHPRVWUHFHQW 3DWKV 2SHQ 6SDFH DQG &UHHNV &RPPLVVLRQ 326&& PHHWLQJ&RPPLVVLRQHUVZHUHWROGWKHUHZLOOEHQRLQIUDVWUXFWXUHRQWKH UHFUHDWLRQODQGVLQFOXGLQJQRSXEOLFEDWKURRPIDFLOLWLHVRUSDUNLQJDUHDVIRUSRWHQWLDOKLNHUV  ELNHUVDQGDVNVZKRZRXOGEHUHVSRQVLEOHIRUSDWUROOLQJWKRVHDUHDVWRSLFNXSFLJDUHWWHEXWWV DQGRWKHUWUDVKDQGNHHSWUDQVLHQWVIURPHVWDEOLVKLQJFDPSV Page 567 of 800 5HVSRQVH$VFODULILHGDERYHWKHUHDUHQRODQGVWKDWZRXOGEHFODVVLILHGDV³UHFUHDWLRQDO ODQGV´DQGWKH3URSRVHG3URMHFWGRHVQRWLQFOXGHDOORZLQJSXEOLFDFFHVVWRWKHRSHQ VSDFHDUHDV,ISXEOLFDFFHVVWRRSHQVSDFHDUHDVLVFRQWHPSODWHGLQWKHIXWXUHDGGLWLRQDO HQYLURQPHQWDOUHYLHZZLOOEHUHTXLUHGDVDSSOLFDEOH &RPPHQW7KH FRPPHQWHUVWDWHV WKDW WKHUH LV VLJQLILFDQW ZLOGOLIH DQG ELRORJLF UHVRXUFHV GRFXPHQWHGLQWKH:HVWHUQ+LOOVDQGWKH\ZRXOGOLNHWRVHHDOORIWKHRSHQVSDFHODQGVDQQH[HG WRJHWKHUDV³8NLDK¶V:LOGOLIH6DQFWXDU\´DQGFRQVHUYHGLQSHUSHWXLW\ 5HVSRQVH7KH&LW\RI8NLDKDJUHHVDQGUHFRJQL]HVWKHLPSRUWDQFHRIWKHELRORJLFDO UHVRXUFHVZLWKLQWKH8NLDK:HVWHUQ+LOOV2QHRIWKH&LW\RI8NLDK¶VJRDOVRIWKH3URSRVHG 3URMHFWLVWRSUHVHUYHDQGSURWHFWLPSRUWDQWVRXUFHZDWHUDQGELRORJLFDOUHVRXUFHVDQG RSHQVSDFHZLWKLQWKH8NLDK:HVWHUQ+LOOV$FFRUGLQJO\DSSUR[LPDWHO\DFUHVDUH SURSRVHGIRURSHQVSDFHDQGFRQVHUYDWLRQ7KH&LW\LVSURSRVLQJWRDQQH[WKHHQWLUH DFUHV LQFOXGLQJ WKH DFUHV IRU RSHQ VSDFH  6HH 0DVWHU 5HVSRQVH  IRU PRUH LQIRUPDWLRQUHJDUGLQJSUH]RQLQJ &200(17/(77(5$1'5($9$&+21 &RPPHQW7KHFRPPHQWHUPDNHVVWDWHPHQWVDQGDVNVTXHVWLRQVUHJDUGLQJSXEOLFSDUNLQJDQG DFFHVVXQGHUWKHDVVXPSWLRQWKDWWKHRSHQVSDFHDUHDVZLOOEHDSXEOLFSDUN  5HVSRQVH7KH3URMHFWVLWH V LVDFFHVVHGYLDDJDWHGSULYDWHURDGDWWKHWHUPLQXVRI 5HGZRRG$YHQXHDQGQRSXEOLFSDUNLQJLVSURSRVHG7KH3URMHFWGRHVQRWSURSRVHD SXEOLFSDUNQRUGRHVLWSURSRVHWRDOORZSXEOLFDFFHVVWRWKHRSHQVSDFHODQGVDWWKLV WLPH  &RPPHQW7KH FRPPHQWHU DVNV TXHVWLRQV UHJDUGLQJ SURSRVHG DFFHVV LPSURYHPHQWV DQG UHTXLUHPHQWVZLWKLQWKH)LUH&RGH 5HVSRQVH6HH0DVWHU5HVSRQVH &RPPHQW7KHFRPPHQWHUHUURQHRXVO\VWDWHVWKDWWKH&LW\LVSD\LQJIRUWKHH[WHQVLRQRIXWLOLWLHV DQGDVNVLIWKHGHYHORSHUVKRXOGEHSD\LQJIRUWKHP 5HVSRQVH6HHUHVSRQVHWR&RPPHQW/HWWHU &RPPHQW7KHFRPPHQWHUDVNVZK\WKH,QVLGH&RQVHUYDWLRQSDUFHOVZRXOGQRWEHDSDUWRIWKH &LW\&RXQFLOUHVROXWLRQRUDFWLRQWRSUHVHUYHWKHPDVRSHQVSDFH 5HVSRQVH6HH0DVWHU5HVSRQVHDQGUHVSRQVHWR&RPPHQW/HWWHU &RPPHQW7KHFRPPHQWHUH[SUHVVHGFRQFHUQVUHJDUGLQJZLOGILUH 5HVSRQVH6HH0DVWHU5HVSRQVH &200(17/(77(50LFKDHO0D\QDUG &RPPHQW7KHFRPPHQWHUVWDWHVWKDWKHZDVWKH&DO)LUH%DWWDOLRQ&KLHIIURP1RYHPEHU WR 'HFHPEHU  DQG ZDV UHVSRQVLEOH IRU IXHO UHGXFWLRQ HIIRUWV LQ WKH:HVWHUQ +LOOV 7KH FRPPHQWHUSURYLGHVDQRYHUYLHZRILQIRUPDWLRQUHODWLQJWRSDVWIXHOPDQDJHPHQWSUDFWLFHVDQG H[SUHVVHVVXSSRUWIRUWKHSURMHFW Page 568 of 800 5HVSRQVH7KLVFRPPHQW LV QRWHG DQGLV LQFOXGHG LQWKH SXEOLFUHFRUGIRU 3ODQQLQJ &RPPLVVLRQDQG&LW\&RXQFLOFRQVLGHUDWLRQ &200(17/(77(56KDUURQ7KRPDV &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUHWKDWDUHLQFOXGHGLQRWKHU FRPPHQWOHWWHUV 5HVSRQVH6HH0DVWHU5HVSRQVH &200(17/(77(5$1'5($'$9,6  &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJWKHDFFHVVURDGLQUHODWLRQWRLWVVORSH WRSRJUDSK\HURVLRQDQGUXQRII 5HVSRQVH3OHDVHUHIHUWR,601'6HFWLRQ*HRORJ\DQG6RLOVDVZHOODV6HFWLRQ +\GURORJ\DQG:DWHU4XDOLW\ZKLFKDGGUHVVHVWKHVHFRPPHQWV7RVXPPDUL]H 0LWLJDWLRQ0HDVXUH*(2LVSURSRVHGDQGUHTXLUHVVXEPLWWDORIVHGLPHQWDQGHURVLRQ SODQVLGHQWLI\LQJ%03VWRUHGXFHVRLOHURVLRQDQGZDWHUUXQRIIWRUHGXFHRUDYRLGLPSDFWV WRJHRORJ\DQGVRLOVWREHVXEPLWWHGSULRUWRDQ\JURXQGGLVWXUEDQFHLQDFFRUGDQFHZLWK 8NLDK&LW\&RGH ³8&&´ 'LYLVLRQ&KDSWHU(URVLRQDQG6HGLPHQW&RQWURO,QDGGLWLRQ +LOOVLGH 2YHUOD\ 'LVWULFWGHYHORSPHQW VWDQGDUGV UHTXLUH VXEPLWWDO RI *HRWHFKQLFDO 5HSRUWV*UDGLQJ3ODQV+\GURORJ\5HSRUWVHWF,QUHJDUGVWRWKHDFFHVVURDGVORSHLV DOVRUHJXODWHGE\WKH+LOOVLGH2YHUOD\'LVWULFWDQGWKH)LUH&RGHDVGLVFXVVHGLQ0DVWHU 5HVSRQVH &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVWKDWWKH'HYHORSPHQW3DUFHOVDUHDGMDFHQWWRD VPDOOFDQ\RQWKDWWUDSVGXVWDQGVPRNH7KHFRPPHQWHUDVNVZKDWUHJXODWLRQVIRUEXUQLQJRQ WKHORZHUHOHYDWLRQVRIDQQH[HGSURSHUWLHVEHDQGZKDWZLOOEHGRQHWRHQIRUFHVSHHGOLPLWVWR GHFUHDVHGXVW 5HVSRQVH$LU4XDOLW\DQGEXUQLQJSHUPLWVDUHUHJXODWHGE\WKH0HQGRFLQR&RXQW\$LU 4XDOLW\0DQDJHPHQW'LVWULFW 0&$40' DQG&DO)LUH$VQRWHGLQ,601'6HFWLRQ $LU4XDOLW\WKH0&$40'HQIRUFHVUHJXODWLRQVSHUWDLQLQJWRDLUTXDOLW\LQFOXGLQJIXJLWLYH GXVW,PSDFWVDVVRFLDWHGZLWKFRQVWUXFWLRQZRXOGEHFRQVLGHUHGWHPSRUDU\DQGSDYLQJRI WKH H[LVWLQJ JUDYHO DFFHVV URDG ZLOO XOWLPDWHO\ UHGXFH GXVW HPLVVLRQV LQ WKH DUHD 0&$40'KDVDVHWRIVWDQGDUG%HVW0DQDJHPHQW3UDFWLFHV %03V IRUFRQVWUXFWLRQ SURMHFWVWKDWDUHLQWHQGHGWRUHGXFHDLUTXDOLW\LPSDFWVDQGHQVXUHWKDWSURMHFWVUHPDLQLQ DWWDLQPHQWZLWKDLUTXDOLW\WKUHVKROGV LQFOXGLQJ5HJXODWLRQUHODWLQJWRIXJLWLYHGXVW $V QRWHG LQ WKH,601' 0LWLJDWLRQ 0HDVXUHV $,5 WKURXJK $,5 LQFRUSRUDWH %03V VXJJHVWHGE\WKH0&$40'WRUHJXODWHDLUTXDOLW\DQGGXVWHPLVVLRQV6SHFLILFDOO\LQ UHJDUGVWRWKHTXHVWLRQUHJDUGLQJWKHVSHHGOLPLW$,5 E VWDWHV³All unpaved surfaces, unless otherwise treated with suitable chemicals or oils, shall have a posted speed limit of 10 mph.” :LWKLQFRUSRUDWLRQRI%03VDQGPLWLJDWLRQPHDVXUHVLGHQWLILHGZLWKLQWKH,601' LPSDFWVWR$LU4XDOLW\ZHUHIRXQGWREHOHVVWKDQVLJQLILFDQW  &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJWUDIILFRQ5HGZRRG$YHQXHDQGWKH SRWHQWLDOIRULQFUHDVHGQRLVHIURPYHKLFOHVWUDYHOLQJXSWKHURDG 5HVSRQVH$V QRWHG LQ 6HFWLRQ  7UDQVSRUWDWLRQ RI WKH ,601'LPSDFWV WR WUDQVSRUWDWLRQDQGWUDIILFZRXOGEHVLJQLILFDQWLIWKH3URMHFWFRQIOLFWHGZLWKDORFDOSODQ Page 569 of 800 RUGLQDQFH RU SROLF\ DGGUHVVLQJ WUDQVLW URDGZD\ ELF\FOH DQG SHGHVWULDQ IDFLOLWLHV FRQIOLFWHGZLWK&(4$*XLGHOLQHV6HF E ZKLFKFRQWDLQVFULWHULDIRUDQDO\]LQJ WUDQVSRUWDWLRQLPSDFWVVXEVWDQWLDOO\LQFUHDVHGKD]DUGVGXHWRJHRPHWULFGHVLJQIHDWXUHV RUUHVXOWHGLQLQDGHTXDWHHPHUJHQF\DFFHVV$VQRWHGLQWKH,601'WKH3URMHFWZRXOG QRW FRQIOLFW ZLWK D ORFDO SODQ RU RUGLQDQFH UHODWHG WR WUDIILF DQG LV UHTXLUHG WR EH LQ FRPSOLDQFHZLWKDOO)LUHDQG%XLOGLQJFRGHVUHODWHGWRHPHUJHQF\DFFHVVDQGVDIHW\0LQRU LQFUHDVHVWRWUDIILFRQDGMDFHQWVWUHHWV VSHFLILFDOO\5HGZRRG$YHQXHDQG+HOHQ$YHQXH  FRXOGRFFXUIURPKHDY\HTXLSPHQWUHTXLUHGIRUURDGDQGXWLOLW\LPSURYHPHQWVEXWZRXOG EHFRQVLGHUHGWHPSRUDU\ PRQWKV ,QDGGLWLRQWKHDGMDFHQWVWUHHWVZLOOQRWEHFORVHG WR WKURXJK WUDIILF GXULQJ WKHURDG DQG XWLOLW\ LPSURYHPHQWV ZLWK WKH H[FHSWLRQ RI WKH SRWHQWLDOWRKDYHWHPSRUDU\ ILYHWRWHQPLQXWH FORVXUHVZKHQVSHFLDOW\HTXLSPHQWPD\ EHGHOLYHUHGWRWKHMREVLWH)XUWKHULWLVXQOLNHO\WKDWDOORIWKHVLQJOHIDPLO\KRPHVZRXOG EHGHYHORSHGDWWKHVDPHWLPHDQGLPSDFWVWRWUDIILFZRXOGEHDQDO\]HGRQDSURMHFWOHYHO EDVLV)RUWKHDIRUHPHQWLRQHGUHDVRQVLQDGGLWLRQWRWKRVHGLVFXVVHGLQWKH,601'WUDIILF LPSDFWVDVVRFLDWHGZLWKWKH3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQW 6LPLODUO\QRLVHLPSDFWVDVVRFLDWHGZLWKWUDIILFZRXOGEHFRQVLGHUHGWHPSRUDU\GXULQJ FRQVWUXFWLRQ8SRQIXWXUHFRQVWUXFWLRQRIVLQJOHIDPLO\KRPHVVRXUFHVRIQRLVHZRXOGEH FRQVLVWHQW ZLWK RWKHU QRLVH VRXUFHVW\SLFDO RI UHVLGHQWLDO XVHV HJ PHFKDQLFDO HTXLSPHQWGRJVSHWVODQGVFDSLQJDFWLYLWLHVFDUVSDUNLQJHWF $GGLWLRQDOO\DVQRWHGLQ 6HFWLRQ1RLVHRIWKH,601'WKH&LW\¶V1RLVH2UGLQDQFH 'LYLVLRQ&KDSWHU $UWLFOH HVWDEOLVKHVDPELHQWEDVHQRLVHOHYHOVWDQGDUGVWKDWDSSO\WRVSHFLILF]RQLQJ GLVWULFWVZLWKLQWKH&LW\RI8NLDK,QDGGLWLRQWRUHGXFHSRWHQWLDOQRLVHLPSDFWVWRQHDUE\ VHQVLWLYHUHFHSWRUV0LWLJDWLRQ0HDVXUH12,ZRXOGUHTXLUHFRPSOLDQFHZLWKWKH&LW\¶V DOORZHG KRXUV RI FRQVWUXFWLRQ  DP WR  SP  LQFOXGH %HVW 0DQDJHPHQW 3UDFWLFHV %03V IRUUHGXFLQJFRQVWUXFWLRQQRLVHDQGUHTXLUHFRQVWUXFWLRQHTXLSPHQWWR EHHTXLSSHGZLWKSURSHUO\RSHUDWLQJDQGPDLQWDLQHGPXIIOHUVDQGRWKHUVWDWHUHTXLUHG QRLVHDWWHQXDWLRQGHYLFHV2SHUDWLRQRIWKH3URSRVHG3URMHFWZRXOGUHVXOWLQVWDWLRQDU\ QRLVH VRXUFHV DVVRFLDWHG ZLWK W\SLFDO UHVLGHQWLDO ODQG XVHV 7KHVH QRLVH VRXUFHV DUH W\SLFDOO\LQWHUPLWWHQWDQGVKRUWLQGXUDWLRQDQGZRXOGEHFRPSDUDEOHWRH[LVWLQJVRXUFHV RIQRLVHH[SHULHQFHGDWVXUURXQGLQJUHVLGHQWLDOXVHV1RLVHLPSDFWVDVVRFLDWHGZLWKWKH 3URMHFWZRXOGEHOHVVWKDQVLJQLILFDQWZLWKPLWLJDWLRQLPSOHPHQWHG &RPPHQW7KHFRPPHQWHUVWDWHVWKDWWKHJUHHQKRXVHJDVHPLVVLRQVGLVFXVVLRQVKRXOGFRQVLGHU WKDWWKHGHYHORSPHQWZLOOHQFRXUDJHYHKLFOHIXHOFRQVXPSWLRQGXHWRWKHORFDWLRQRIWKHKRXVLQJ 5HVSRQVH$V GLVFXVVHG LQ ,601' 6HFWLRQ  *UHHQKRXVH *DV(PLVVLRQV &RQVWUXFWLRQDFWLYLWLHVDVVRFLDWHGZLWKWKH3URMHFWDQGIXWXUHKRXVLQJGHYHORSPHQWFRXOG UHVXOWLQGLUHFWDQGLQGLUHFWHPLVVLRQVRI*+*HPLVVLRQV'LUHFWSURMHFWUHODWHG*+* HPLVVLRQVJHQHUDOO\LQFOXGHHPLVVLRQVIURPFRQVWUXFWLRQDFWLYLWLHVDUHDVRXUFHVDQG PRELOHVRXUFHVZKLOHLQGLUHFWVRXUFHVLQFOXGHHPLVVLRQVIURPHOHFWULFLW\FRQVXPSWLRQ ZDWHUGHPDQGDQGVROLGZDVWHJHQHUDWLRQ2SHUDWLRQDO*+*HPLVVLRQVZRXOGUHVXOWIURP HQHUJ\HPLVVLRQVIURPQDWXUDOJDVXVDJHDQGDXWRPRELOHHPLVVLRQV $VGLVFXVVHGLQ6HFWLRQ$LU4XDOLW\RIWKH,601'WKH3URMHFW ERWKFRQVWUXFWLRQDQG RSHUDWLRQ ZRXOGQRWUHVXOWLQDVLJQLILFDQWQHJDWLYHLPSDFWWRDLUTXDOLW\6LPLODUO\DV GLVFXVVHG LQ 6HFWLRQ  7UDQVSRUWDWLRQ WKH 3URMHFW ZRXOG QRW SURGXFH VLJQLILFDQW DPRXQWVRIWUDIILFRUYHKLFOHPLOHVWUDYHOHGWKDWZRXOGLQWXUQUHVXOWLQDVLJQLILFDQWLQFUHDVH LQ *+* HPLVVLRQV ,QGLYLGXDO UHVLGHQWLDO GHYHORSPHQW SURMHFWV FRQVWUXFWHG XQGHU WKH Page 570 of 800 'HYHORSPHQW$JUHHPHQWZLOOEHUHYLHZHGRQDSURMHFWE\SURMHFWEDVLVWRDQDO\]H*+* HPLVVLRQVDQGZLOOEHUHTXLUHGWRIROORZDOOEXLOGLQJFRGHVDQGSROLFLHVLQFOXGLQJWKRVH LQWHQGHGWRUHGXFHHPLVVLRQV6SHFLILFDOO\IXWXUHUHVLGHQWLDOXVHVFRQVWUXFWHGZRXOGEH UHTXLUHG WR DGKHUH WR DOO IHGHUDO VWDWH DQG ORFDO UHTXLUHPHQWV IRU HQHUJ\ HIILFLHQF\ LQFOXGLQJ WKH7LWOH  VWDQGDUGV &RPSOLDQFH ZLWK7LWOH  %XLOGLQJ (QHUJ\ (IILFLHQF\ 6WDQGDUGV ZRXOG SURYLGH PLQLPXP HIILFLHQF\ VWDQGDUGV UHODWHG WR YDULRXV EXLOGLQJ IHDWXUHVLQFOXGLQJDSSOLDQFHVZDWHUDQGVSDFHKHDWLQJDQGFRROLQJHTXLSPHQWEXLOGLQJ LQVXODWLRQDQGURRILQJDQGOLJKWLQJ,PSOHPHQWDWLRQRIWKH7LWOHVWDQGDUGVVLJQLILFDQWO\ UHGXFHVHQHUJ\XVDJHDVZHOODV*+*HPLVVLRQV /DVWO\WKH3URMHFWLQFOXGHVDQQH[DWLRQDQGFRQVHUYDWLRQRIDSSUR[LPDWHO\DFUHV ZKLFKZLOOKDYHQRLPSDFW RUDEHQHILFLDOLPSDFW RQ*+*JLYHQWKDWWKH3URMHFWLVORFDWHG ZLWKLQDQRQDWWDLQPHQWDUHDWKH3URMHFWLVUXUDOLQQDWXUHDQGWKH3URMHFWKDVDVPDOO GHYHORSPHQW IRRWSULQW 7KH3URMHFW LQFOXGLQJ LQIUDVWUXFWXUH LPSURYHPHQWV DQG RWKHU WHPSRUDU\FRQVWUXFWLRQDFWLYLWLHVLVQRWH[SHFWHGWRVLJQLILFDQWO\LQFUHDVH*+*LQWKHDUHD :LWKLPSOHPHQWDWLRQRIWKHDIRUHPHQWLRQHGUHJXODWLRQVLPSDFWVWR*+*HPLVVLRQVZRXOG EHOHVVWKDQVLJQLILFDQW &RPPHQW7KHFRPPHQWHUVXJJHVWVWKDWWKHUHTXLUHGERWDQLFDOVXUYH\VDUHLQDGHTXDWHDQGEH FRPSOHWHGSULRUWRILQDOL]DWLRQRIWKH,601' 5HVSRQVH$VQRWHGLQ,601'6HFWLRQ%LRORJLFDO5HVRXUFHVERWDQLFDOVXUYH\VDUH UHTXLUHGWREHFRQGXFWHGLQDFFRUGDQFHZLWK86)LVKDQG:LOGOLIH 86):6 VXUYH\ SURWRFROVZKLFKUHTXLUHVVHYHUDOVXUYH\VWKURXJKGLIIHUHQWWLPHVRIWKH\HDULQUHODWLRQWR GLIIHUHQWVSHFLHV¶EORRPLQJSHULRGV$WWKHWLPHRIFLUFXODWLRQRIWKH'UDIW,601'WKHWZR RIWKUHHUHTXLUHGVXUYH\VFRPSOHWHG 0DUFKDQG0D\ KDGUHVXOWHGLQ QHJDWLYHILQGLQJV3HU86):6SURWRFROVRQHDGGLWLRQDOVXUYH\ZDVUHTXLUHGGXULQJWKH EORRPLQJSHULRG 0DUFK-XO\ DVQRWHGLQ'UDIW,601'0LWLJDWLRQ0HDVXUH%,2WKLV VXUYH\ZRXOGRFFXUSULRUWRDQ\JURXQGGLVWXUELQJDFWLYLWLHVDWWKHUHFRPPHQGDWLRQRIWKH %LRORJLVW+RZHYHUVLQFHWKHFLUFXODWLRQRIWKH'UDIW,601'WKHILQDOERWDQLFDOVXUYH\ZDV FRPSOHWHGRQ-XO\7KHVXUYH\GLGQRWUHVXOWLQWKHLGHQWLILFDWLRQRIDQ\VHQVLWLYH ERWDQLFDO VSHFLHV$V VXFK QR IXUWKHU ERWDQLFDO VXUYH\V DUH UHTXLUHG DQG 0LWLJDWLRQ 0HDVXUH%,2KDVEHHQUHYLVHGDFFRUGLQJO\7KLVLQIRUPDWLRQKDVEHHQLQFRUSRUDWHGLQWR WKH%LRORJLFDO5HVRXUFHVVHFWLRQRIWKH)LQDO'UDIW,601'DFFRUGLQJO\WKH%LRORJLFDO 5HVRXUFHV$VVHVVPHQW$GGHQGXPIRU5DUH3ODQW$VVHVVPHQWDQG%RWDQLFDO6XUYH\LV LQFOXGHGDV$WWDFKPHQW%RIWKH)LQDO'UDIW,601' &RPPHQW7KH FRPPHQWHU H[SUHVVHV FRQFHUQV UHJDUGLQJ ELRORJLFDO UHVRXUFHV DQG ZDWHU FRXUVHVDQGFXOYHUWVZLWKLQWKH3URMHFWYLFLQLW\7KHFRPPHQWHUDOVRH[SUHVVHVFRQFHUQVUHODWHG WRZLOGOLIHPRYHPHQW 5HVSRQVH$V QRWHG LQ WKH UHVSRQVH WR FRPPHQWV UHFHLYHG IURP -DFREV]RRQ  $VVRFLDWHV,QF 5HVSRQVHWR&RPPHQWV$WWDFKPHQW$ DQGLQWKH%LRORJLFDO5HVRXUFHV 6XUYH\ IRU WKH 3URMHFW WKHFUHHNV ZLWKLQ WKH 6WXG\$UHD ZHUH VXUYH\HG GXULQJ WKH %LRORJLFDO 5HVRXUFH $VVHVVPHQW DQG ILUVW ERWDQLFDO VXUYH\EXWQR VSHFLDO VWDWXV DPSKLELDQVSHFLHV ZHUH REVHUYHG KRZHYHU 0LWLJDWLRQ 0HDVXUH %,2 UHTXLUHV SUH FRQVWUXFWLRQVXUYH\VSULRUWRZRUNLQRUDURXQGWKHGUDLQDJHVRUZDWHUFRXUVHVWRSURWHFW VHQVLWLYHDPSKLELDQVSHFLHV1RPRGLILFDWLRQVWRH[LVWLQJFXOYHUWVDUHSURSRVHG+RZHYHU DV QRWHG LQ &RQGLWLRQ RI $SSURYDO  WKH 'HYHORSHU VKDOO REWDLQ UHJXODWRU\ SHUPLWV Page 571 of 800 LQFOXGLQJEXWQRWOLPLWHGWRD:DWHU4XDOLW\&HUWLILFDWLRQ&DOLIRUQLD'HSDUWPHQWRI)LVK DQG:LOGOLIH/DNHDQG6WUHDPEHG$OWHUDWLRQ$JUHHPHQWHWFLIZRUNLVSURSRVHGLQWKH IXWXUHLQDFFRUGDQFHZLWKH[LVWLQJUHJXODWRU\UHTXLUHPHQWV $VGLVFXVVHGLQ,601'6HFWLRQ%LRORJLFDO5HVRXUFHVWKHUHDUHQRHVWDEOLVKHGQDWLYH UHVLGHQWRUPLJUDWRU\ZLOGOLIHFRUULGRUVRUQDWLYHZLOGOLIHQXUVHU\VLWHVZLWKLQWKH3URMHFW DUHD%HFDXVHWKH3URMHFWLQFOXGHVSUHVHUYDWLRQRIDSSUR[LPDWHO\DFUHVWKH3URMHFW ZLOOSUHVHUYHH[LVWLQJKDELWDWDQGRSSRUWXQLW\IRUPRYHPHQWIRUZLOGOLIHVSHFLHV &200(17/(77(50$5*2)5$1. &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUHDQGH[SUHVVHVRSSRVLWLRQWR WKHSURMHFW 5HVSRQVH7KLVFRPPHQW LV QRWHG DQG LV LQFOXGHG LQWKH SXEOLFUHFRUGIRU 3ODQQLQJ &RPPLVVLRQDQG&LW\&RXQFLOFRQVLGHUDWLRQ 6HH0DVWHU5HVSRQVHUHODWHGWRZLOGILUH &200(17/(77(5+($7+(56(**(/ &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUHDQGH[SUHVVHVRSSRVLWLRQWR WKHSURMHFW 5HVSRQVH7KLVFRPPHQW LV QRWHG DQG LV LQFOXGHG LQWKH SXEOLFUHFRUGIRU 3ODQQLQJ &RPPLVVLRQDQG&LW\&RXQFLOFRQVLGHUDWLRQ &200(17/(77(57+20$6+817 &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVWKDWWKHFULWHULDIRUORWOLQHDGMXVWPHQWVLVQRW EHLQJPHWDQGWKDWHDFKTXDOLI\LQJSDUFHORIDORWOLQHDGMXVWPHQWPXVWKDYHDUHFRUGHGFHUWLILFDWH RI FRPSOLDQFH WKDWWKH ORW LV D YLDEOH FRQIRUPLQJ ORW7KH FRPPHQWHU DOVR VWDWHV WKDW ³UHFRQILJXUDWLRQ RI SDUFHOV XVLQJ WKH ORW OLQH DGMXVWPHQW PHWKRG EHFRPHV D YLRODWLRQ RI WKH 6XEGLYLVLRQ 0DS $FW LI JUHDWHU WKDQ )RXU SDUFHO UHFRQILJXUDWLRQV //$  DUH SHUIRUPHG $ GHYHORSPHQWRIWKLVQDWXUHVKRXOGEHUHTXLUHGWRSUHSDUHDWHQWDWLYHVXEGLYLVLRQPDSSUHOLPLQDU\ HQJLQHHULQJRIWKHDFFHVVURDGORWOD\RXWLQFRQIRUPDQFHZLWKWKHKLOOVLGHVORSHRUGQDQFHDQG SURYLGH D VORSH DQDO\VLV VWXG\ LQ FRQIRUPDQFH ZLWK WKH +LOOVLGH RUGLQDQFH XVLQJ DFFXUDWH WRSRJUDSKLFPDSSLQJ´ 5HVSRQVH6HH UHVSRQVH WR &RPPHQW /HWWHU  (DFK ORW KDV YDOLG &HUWLILFDWH RI &RPSOLDQFHV DQG DQ\ ORW OLQH DGMXVWPHQWV DUH WR EH GRQH LQ DFFRUGDQFH ZLWK WKH 6XEGLYLVLRQ0DS$FWDQGDOO&RXQW\DQG&LW\FRGHVDVDSSOLFDEOH*RYHUQPHQW&RGH VHFWLRQ  VSHFLILHV FLUFXPVWDQFHV DQG SURFHVVHV WKDW DUH H[FHSWHG IURP WKH 6XEGLYLVLRQ0DS$FW7KHH[FHSWLRQIRXQGLQVXEGLYLVLRQ G WRWKDWVHFWLRQFRQFHUQVORW OLQHDGMXVWPHQWV³EHWZHHQIRXURUIHZHUH[LVWLQJDGMRLQLQJSDUFHOVZKHUHWKHODQGWDNHQ IURPRQHSDUFHOLVDGGHGWRDQDGMRLQLQJSDUFHODQGZKHUHDJUHDWHUQXPEHURISDUFHOV WKDQ RULJLQDOO\ H[LVWHG LV QRW WKHUHE\ FUHDWHG«´ $ ORW OLQH DGMXVWPHQWPHHWLQJ WKHVH FULWHULDUHQGHUVWKH6XEGLYLVLRQ0DS$FW³LQDSSOLFDEOH´WRWKHDSSOLFDWLRQ San Dieguito Partnership v. City of San Diego  &DO$SSWK >*RY&RGH† VXEGLYLVLRQ G GRHVQRWOLPLWWKHVL]HRIWKHDUHDVXEMHFWWRDORWOLQHDGMXVWPHQW@  6HTXHQWLDOORWOLQHDGMXVWPHQWVLQYROYLQJWKHVDPH RUVRPHRIWKHVDPH SURSHUWLHVGRHV QRWUXQDIRXORIWKHVHFULWHULDDQGDUHSHUPLWWHGWREHFRPSOHWHGXSRQFRPSOHWLRQRIWKH Page 572 of 800 SUHFHGLQJDGMXVWPHQW Sierra Club v. Napa County Bd. of Sup'rs  &DO$SSWK   7KH&LW\¶VUHYLHZRIDSSOLFDWLRQVLVOLPLWHGDQGPLQLVWHULDOLQQDWXUH,WPD\RQO\GHWHUPLQH ZKHWKHUWKHORWOLQHDGMXVWPHQWFRQIRUPVWRWKHORFDOJHQHUDOSODQDQ\DSSOLFDEOHVSHFLILF SODQ DQ\ DSSOLFDEOH FRDVWDO SODQ DQG ]RQLQJDQG EXLOGLQJ RUGLQDQFHV7KH &LW\ FDQ UHTXLUHWKH SUHSD\PHQW RI UHDO SURSHUW\ WD[HV SULRU WR WKH DSSURYDO RI WKH ORW OLQH DGMXVWPHQW DQG LW PD\ IDFLOLWDWH WKH UHORFDWLRQ RI H[LVWLQJ XWLOLWLHV LQIUDVWUXFWXUH RU HDVHPHQWV 6R ORQJ DV WKH DGMXVWPHQW GRHV QRW H[FHHG WKH UHIHUHQFHG FULWHULD WKH DSSOLFDWLRQPD\QRWEHGHQLHG *RY&RGH† G Sierra Club v. Napa County Bd. of Sup'rs, supra, &DO$SSWKDWSS±San Dieguito Partnership v. City of San Diego, supra, &DO$SSWKDWS 2WKHUWKDQWKRVHGHVFULEHDERYHQRRWKHU FRQGLWLRQVDQGH[DFWLRQVRQDSSURYDORIDORWOLQHDGMXVWPHQWVPD\EHLPSRVHG,QVKRUW ³WKHUHJXODWRU\IXQFWLRQRIWKHDSSURYLQJDJHQF\LVVWULFWO\FLUFXPVFULEHGE\WKH/HJLVODWXUH LQDORWOLQHDGMXVWPHQWZLWKYHU\OLWWOHDXWKRULW\DVFRPSDUHGWRWKHDJHQF\ VIXQFWLRQDQG DXWKRULW\LQFRQQHFWLRQZLWKDVXEGLYLVLRQ´ Ibid  3OHDVH UHIHU WR UHVSRQVH WR &RPPHQW /HWWHU  DQG UHVSRQVHV EHORZ UHJDUGLQJ GHYHORSPHQWLQFRQIRUPDQFHZLWKWKH+LOOVLGH2YHUOD\'LVWULFW &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVWKDWWKHQHZURDGZLOOQRWPHHW)LUH6DIHW\5RDG 6WDQGDUGVDQGLVFRQFHUQHGDERXWKRZWKHURDGZLOOEHPDLQWDLQHG 5HVSRQVH$VPHQWLRQHGLQ0DVWHU5HVSRQVHWKHH[LVWLQJDFFHVVURDGZLOOEH LPSURYHGLQDFFRUGDQFHZLWKDOODSSOLFDEOHILUHDQGVDIHW\FRGHV $OO IXWXUH FRQVWUXFWLRQ DQG URDGZD\V DVVRFLDWHG ZLWK WKH 3URMHFW LQFOXGLQJIXWXUH UHVLGHQWLDOFRQVWUXFWLRQ PXVWDGKHUHWRWKHDIRUHPHQWLRQHGUHJXODWLRQVLQDGGLWLRQWR DOORWKHUORFDOVWDWHDQGIHGHUDOUHJXODWLRQVUHODWLQJWRDFFHVVDQGVDIHW\7KHURDG ZLOOEHSULYDWHO\RZQHGDQGPDLQWDLQHGE\D+RPHRZQHUV$VVRFLDWLRQ &RPPHQW7KHFRPPHQWHUH[SUHVVHGFRQFHUQVWKDWWKH,601'GRHVQRWDGGUHVVWKHFDSDFLW\ IRURIWKHH[LVWLQJ&LW\XWLOLW\WRVXSSRUWWKHSURSRVHGKRPHVDQGTXHVWLRQVZKRZRXOGPDLQWDLQ WKHLQIUDVWUXFWXUH 5HVSRQVH7KH SURMHFW LQYROYHV &LW\ DFTXLVLWLRQ RI SURSHUW\ ZLWK PRVW RI WKH XWLOLW\ LQIUDVWUXFWXUHFRPSOHWHGE\WKHGHYHORSHUDQGLQSODFHSULRUWRDQ\SRWHQWLDOGHYHORSPHQW 7KHSURSHUW\RZQHUGHYHORSHUZLOOEHUHVSRQVLEOHIRUWKHURDGLPSURYHPHQWVLQVWDOODWLRQ DQGPDLQWHQDQFHRIWKHVHZHUV\VWHPZDWHUVWRUDJHWDQNVDQGLWVDVVRFLDWHGHTXLSPHQW WKHVHFRPSRQHQWVZLOOEHPDLQWDLQHGE\WKH+2$(OHFWULFXWLOLWLHVZLOOEHLQVWDOOHGE\WKH &LW\DQGRUWKHGHYHORSHUEXWXOWLPDWHO\ZLOOEHRZQHGDQGPDLQWDLQHGE\WKH&LW\3OHDVH UHIHUWR,601'6HFWLRQ8WLOLWLHVDQG6HUYLFH6\VWHPVIRUDQDQDO\VLVRIVHUYLFH FDSDFLW\$GGLWLRQDOLQIRUPDWLRQLVDOVRSURYLGHGLQUHVSRQVHWR&RPPHQW/HWWHU &RPPHQW7KHFRPPHQWHUH[SUHVVHGFRQFHUQVUHJDUGLQJZLOGILUHDQGDFFHVVUHTXLUHPHQWV,Q DGGLWLRQWKHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJGHYHORSPHQWUHJXODWLRQVLQWKH+LOOVLGH 2YHUOD\'LVWULFWUHODWHGWRVORSH 5HVSRQVH6HH0DVWHU5HVSRQVHDQGUHVSRQVHWR&RPPHQW/HWWHUDQGUHJDUGLQJ VORSHDQGGHYHORSPHQWZLWKLQWKH+LOOVLGH2YHUOD\'LVWULFW Page 573 of 800 &RPPHQW7KHFRPPHQWHUVWDWHVWKDWLPSDFWVWRK\GURORJ\IURPSRWHQWLDOIXWXUHGHYHORSPHQW DQGUHSODFHPHQWVRIFXOYHUWVZHUHQRWDGHTXDWHO\GLVFXVVHGLQWKH,601' 5HVSRQVH6HHUHVSRQVHWR&RPPHQW/HWWHUVDQG$VGLVFXVVHGLQ,601' 6HFWLRQ+\GURORJ\DQG:DWHU4XDOLW\WKHSURMHFWLQFOXGLQJLPSURYHPHQWRIWKH DFFHVVURDGDQGIXWXUHUHVLGHQWLDOFRQVWUXFWLRQZRXOGUHVXOWLQLPSHUYLRXVVXUIDFHVWKDW FRXOGUHVXOWLQDQLPSDFWWRZDWHUTXDOLW\+RZHYHUDVQRWHGLQ0LWLJDWLRQ0HDVXUHV*(2 DQG+$=SULRUWRDQ\JURXQGGLVWXUEDQFHHURVLRQDQGVHGLPHQWFRQWUROSODQVVKDOO EHVXEPLWWHGWRWKH3XEOLF:RUNV'HSDUWPHQWDQG&RPPXQLW\'HYHORSPHQW'HSDUWPHQW IRUUHYLHZDQGDSSURYDODQGVKDOOLQFOXGH%HVW0DQDJHPHQW3UDFWLFHV %03V WRDGGUHVV VRLOHURVLRQDQGVWRUPZDWHUUXQRII$OVR5+GHYHORSPHQWUHJXODWLRQVUHTXLUHVXEPLWWDO RIWKHIROORZLQJVRLODQGJHRORJLFDOUHSRUWVVXEVXUIDFHLQYHVWLJDWLRQVJUDGLQJSODQV YHJHWDWLRQUHSRUWVJUDGLQJ SODQV K\GURORJ\ UHSRUWVWR HQVXUH GHYHORSPHQW LV EHLQJ SURSHUO\ GHVLJQHG WR DYRLG LPSDFWV WR JHRORJ\ VRLOV DQG K\GURORJ\$GGLWLRQDOO\ FRQVWUXFWLRQSURMHFWVWKDWZRXOGGLVWXUEPRUHWKDQRQHDFUHRIODQGZRXOGEHVXEMHFWWR WKH UHTXLUHPHQWV RI *HQHUDO &RQVWUXFWLRQ $FWLYLW\ 6WRUPZDWHU 3HUPLW &RQVWUXFWLRQ *HQHUDO 3HUPLW 2UGHU ':4 DOVR NQRZQ DV WKH &*3  ZKLFK UHTXLUHV RSHUDWRUVRIVXFKFRQVWUXFWLRQVLWHVWRLPSOHPHQWVWRUPZDWHUFRQWUROVDQGGHYHORSD 6WRUPZDWHU 3ROOXWLRQ 3UHYHQWLRQ 3ODQ 6:333  LGHQWLI\LQJ VSHFLILF %03V WR EH LPSOHPHQWHGWRUHGXFHWKH DPRXQW RI VHGLPHQW DQG RWKHU SROOXWDQWV DVVRFLDWHG ZLWK FRQVWUXFWLRQVLWHVIURPEHLQJGLVFKDUJHGLQVWRUPZDWHUUXQRII 7KHSURSRVHG'HYHORSPHQW$JUHHPHQWGRHVQRWLQFOXGHVSHFLILFGHYHORSPHQWGHVLJQVRU SURSRVDOV QRU GRHV LW JUDQW DQ\ HQWLWOHPHQWV IRU GHYHORSPHQW )XWXUHVLQJOHIDPLO\ KRXVLQJ GHYHORSPHQWIRU DOO 'HYHORSPHQW 3DUFHOV ZLOO EH VXEMHFW WR WKH &LW\¶V5+ GHYHORSPHQW VWDQGDUGV EXLOGLQJ DQG VDIHW\ FRGHV LQFOXGLQJ UHYLHZ RI VWRUPZDWHU PDQDJHPHQWSUDFWLFHVZKHUHDSSOLFDEOH,IIXWXUHZRUNLQRUDGMDFHQWWRDQ\RIWKHRWKHU ZDWHUFRXUVHVRUFXOYHUWVDUHSURSRVHGWKHGHYHORSHULVUHTXLUHGWRREWDLQQHFHVVDU\ UHJXODWRU\SHUPLWVIRUPWKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIHDQGWKH5HJLRQDO :DWHU4XDOLW\&RQWURO%RDUGDVQHFHVVDU\$VQRWHGLQWKH,601'LPSDFWVDVVRFLDWHG ZLWK HURVLRQ DQG VWURPZDWHU UXQRII ZRXOG EH OHVV WKDQ VLJQLILFDQW ZLWK PLWLJDWLRQ LQFRUSRUDWHG &200(17/(77(567(9($1'-($1/,1&2/1 &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUHDQGH[SUHVVHVRSSRVLWLRQWR WKHSURMHFW 5HVSRQVH7KLVFRPPHQW LV QRWHG DQG LV LQFOXGHG LQWKH SXEOLFUHFRUGIRU 3ODQQLQJ &RPPLVVLRQDQG&LW\&RXQFLOFRQVLGHUDWLRQ &200(17/(77(51257+&2$675(*,21$/:$7(548$/,7<&21752/%2$5' 1&5:4&%  &RPPHQW7KHFRPPHQWHUVWDWHVWKDWLQIRUPDWLRQUHJDUGLQJVHQVLWLYHELRORJLFDOFRPPXQLWLHV :DWHUVRIWKH6WDWHDQGZHWODQGVLVFRQIOLFWLQJZLWKLQWKH%LRORJLFDO5HVRXUFHV$VVHVVPHQW7KH 1&5:4&%DOVRVWDWHVWKDWLI:DWHUVRIWKH6WDWHZLOOEHLPSDFWHGE\WKHSURMHFWUHJXODWRU\ SHUPLWVZLOOEHUHTXLUHG Page 574 of 800 5HVSRQVH$VQRWHGLQWKHUHVSRQVHVSUHSDUHGE\-DFREV]RRQDQG$VVRFLDWHV,QF LQFOXGHGLQ5HVSRQVHWR&RPPHQWV$WWDFKPHQW$ ³1RZHWODQGVZHUHREVHUYHGZLWKLQ WKH6WXG\$UHDGXULQJWKHELRORJLFDODVVHVVPHQW´DQG³%LRORJLFDO5HVRXUFHV$VVHVVPHQW $WWDFKPHQW%WRWKH,601' 6HFWLRQ  )LHOG6XUYH\0HWKRGRORJ\  %LRORJLFDO &RPPXQLWLHV  6HQVLWLYH&RPPXQLWLHV$TXDWLF5HVRXUFHV SDJH LVQRWDUHVXOWRU DFFRXQWRIZKDWZHREVHUYHGRQVLWHDQGLVPHDQWWRGHVFULEHRXUPHWKRGRORJ\LQGHILQLQJ DQGGHVFULELQJZHWODQGVIRUWKHSXUSRVHVRIWKHDVVHVVPHQW*HQHUDOO\LIDVXVSHFWHG ZHWODQGLVREVHUYHGGXULQJRXUELRORJLFDODVVHVVPHQWLWLVUHIHUUHGWRDVD³ZHWDUHD´XQWLO DZHWODQGGHOLQHDWLRQLVSHUIRUPHGWRGHWHUPLQHZKHWKHUWKH³ZHWDUHD¶PHHWVWKHFULWHULD RIZHWODQGVDVGHVFULEHGE\WKH86$&(0DQXDO7KH1:,GDWDEDVHLVFRQVXOWHGDW DUHFRQQDLVVDQFHOHYHOEHIRUHRXUVLWHYLVLWDQGLVQRWLQWHQGHGWRVXEVWLWXWHRQWKHJURXQG ILHOGDVVHVVPHQWVIRUZHWODQGV´3OHDVHUHIHUWRVHFWLRQ  )LHOG6XUYH\5HVXOWV   %LRORJLFDO&RPPXQLWLHV   6HQVLWLYH %LRORJLFDO &RPPXQLWLHV6HQVLWLYH $TXDWLF 5HVRXUFHV SDJH IRUWKHUHVXOWVRIWKHDVVHVVPHQWFRQFHUQLQJVHQVLWLYHDTXDWLF UHVRXUFHVLQFOXGLQJZHWODQGV 7KH6WXG\$UHDFRQWDLQVWZR  &ODVV,,ZDWHUFRXUVHVDQGIRXU  &ODVV,,,ZDWHUFRXUVHV WKDW ZHUH REVHUYHG DQG PDSSHG RQVLWH 7KH FORVHVW ZDWHUFRXUVH LV D &ODVV ,, ZDWHUFRXUVHORFDWHGRQ$31 H[LVWLQJ3DUFHODQGSURSRVHG3DUFHO RIWKH VWXG\ DUHD 7KLV &ODVV ,, ZDWHUFRXUVH LV PDSSHG RQ WKH 86):6 1DWLRQDO :HWODQG ,QYHQWRU\ DV D ULYHULQHKDELWDW FODVVLILHG DV 56%& 56%& LV D ULYHULQH LQWHUPLWWHQW V\VWHPZLWKDVWUHDPEHGDQGLVVHDVRQDOO\IORRGHG5LYHULQHV\VWHPVDUHFRQVLGHUHG ZDWHUFRXUVHVIRUWKHSXUSRVHVRIWKLVDVVHVVPHQW7KH3URSRVHG3URMHFWZLOOQRWLPSDFW WKLVZDWHUFRXUVHDVLWZRXOGEHLQFOXGHGLQSURSRVHG3DUFHOZKLFKZLOOEHSUHVHUYHGDV RSHQVSDFH7KHSURMHFWGRHVQ¶WSURSRVHPRGLILFDWLRQRIH[LVWLQJFXOYHUWV)RUWKHUHDVRQV GLVFXVVHGDERYHWKH3URMHFWZRXOGQRWUHVXOWLQDVLJQLILFDQWLPSDFWWRVHQVLWLYHELRORJLFDO FRPPXQLWLHVRUZHWODQGV,IIXWXUHZRUNLQRUDGMDFHQWWRDQ\RIWKHRWKHUZDWHUFRXUVHVRU FXOYHUWVDUHSURSRVHGWKH'HYHORSHULVUHTXLUHGWRREWDLQQHFHVVDU\UHJXODWRU\SHUPLWV IRUPWKH&DOLIRUQLD'HSDUWPHQWRI)LVKDQG:LOGOLIHDQGWKH5HJLRQDO:DWHU4XDOLW\&RQWURO %RDUGDVQHFHVVDU\ 7KH%LRORJLFDO 5HVRXUFHV $VVHVVPHQW LGHQWLILHV WKH IROORZLQJ WZR VHQVLWLYH WUHH FRPPXQLWLHVLQWKH6WXG\$UHDQuercus garryana)RUHVW :RRGODQG$OOLDQFH2UHJRQ ZKLWHRDNIRUHVWDQGZRRGODQGDQGUmbellularia californica)RUHVW :RRGODQG$OOLDQFH &DOLIRUQLDED\IRUHVWDQGZRRGODQG%RWKFRPPXQLWLHVDUHFODVVLILHGDVKDYLQJD&DOLIRUQLD 'HSDUWPHQWRI:LOGOLIH6WDWH5DULW\5DQNRI6 9XOQHUDEOH 1RWUHHVDUHSURSRVHGIRU UHPRYDO +RZHYHU LIIXWXUH GHYHORSPHQW RI VLQJOHIDPLO\ KRPHV SURSRVH UHPRYDO RI WUHHV SUHFRQVWUXFWLRQ VXUYH\V LGHQWLILHG LQ 0LWLJDWLRQ 0HDVXUH %,2 VKDOO LQFOXGH LGHQWLILFDWLRQRIWKHVHVSHFLHVDQGUHPRYDOVKDOOEHLQDFFRUGDQFHZLWKWKH&DOLIRUQLD 'HSDUWPHQWRI)LVKDQG:LOGOLIHUHJXODWLRQVDQGWKH&LW\RI8NLDK7UHH0DQDJHPHQW *XLGHOLQHV ,IWUHHVDUHSURSRVHGIRUUHPRYDOVXUYH\VZLOODOVRLQFOXGHLGHQWLILFDWLRQRI2UHJRQZKLWH RDNIRUHVWDQGZRRGODQGDVZHOODV&DOLIRUQLDED\IRUHVWDQGZRRGODQGKDELWDWUHPRYDO RIVHQVLWLYHKDELWDWVKDOOEHFRQGXFWHGLQDFFRUGDQFHZLWKWKH&DOLIRUQLD'HSDUWPHQWRI )LVKDQG:LOGOLIHUHJXODWLRQV6HHUHYLVLRQVWR0LWLJDWLRQ0HDVXUHV%,2DQG%,2IRU FRQVLVWHQF\ZLWKWKH%LRORJLFDO5HVRXUFHV$VVHVVPHQW &200(17/(77(5-2+1$1''(/<11(52*(56 Page 575 of 800 &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJZLOGILUH 5HVSRQVH6HH0DVWHU5HVSRQVH &RPPHQW7KH FRPPHQWHU VWDWHV WKDW RQFH &LW\ XWLOLWLHV DUH H[WHQGHG WR WKH 'HYHORSPHQW 3DUFHOVWKDWWKHUHLVLQFUHDVHGSRWHQWLDOIRUIXUWKHUGHYHORSPHQW 5HVSRQVH6HH 6HFWLRQ  3RSXODWLRQ DQG +RXVLQJUHJDUGLQJ D GLVFXVVLRQ RQ SRWHQWLDO JURZWK LQGXFLQJ LPSDFWV7KH UHVLGHQWLDO FRPSRQHQW RI WKH SURSRVHG 'HYHORSPHQW$JUHHPHQWZRXOGEHORFDWHGZLWKLQDFUHVRIWKHWRWDODFUHVSURSRVHG IRUDQQH[DWLRQ'HYHORSPHQWZRXOGEHUHVWULFWHGWRDWRWDORIXQLWV VHYHQVLQJOHIDPLO\ KRPHVDQGWKHSRWHQWLDOIRUDQ$'8WRHDFKKRPH FRPSDFWDQGFOXVWHUHGLQRUGHUWR PD[LPL]HWKHSUHVHUYDWLRQRIRSHQVSDFH7KLVKRXVLQJFOXVWHUZLOOEHFRQWLJXRXVDQG VLPLODUWRH[LVWLQJXUEDQL]HGDUHDVZLWKLQWKH:HVWHUQ+LOOVXQGHU&LW\MXULVGLFWLRQ,IWKH SURSHUW\ZHUHWRUHPDLQXQLQFRUSRUDWHGKRXVLQJXQLWVFRXOGEHGHYHORSHGRQHDFKSDUFHO WKURXJKRXWWKHWRWDODUHDDOEHLWLQDPRUHZLGHO\GLVEXUVHGFRQILJXUDWLRQ7KHVHSURSRVHG MXULVGLFWLRQDOFKDQJHVZRXOGQRWHQJHQGHUµ6SUDZO¶2QWKHFRQWUDU\YLHZHGDVDZKROH WKHSURSRVHGDQQH[DWLRQZLOOUHGXFHSRWHQWLDOVSUDZODQGFRQFHQWUDWHXUEDQVHUYLFHV ZDWHUVHZHUHOHFWULFLW\VROLGZDVWHFROOHFWLRQDQGSXEOLFDQGSULYDWHURDGV LQWKHDUHD DOUHDG\GHYHORSHGIRUVLQJOHIDPLO\KRXVLQJDQGUHFHLYLQJXUEDQVHUYLFHV7KHFRQWLJXRXV SURSHUWLHVWRWKHQRUWKHDVWDUHDOUHDG\XQGHU&LW\MXULVGLFWLRQDQG]RQHG5+6HUYLFHV ZRXOGRQO\EHH[WHQGHGWRWKHUHVLGHQWLDOVLWHVDQGZRXOGQRWLQGXFHJURZWKWKURXJKRXW WKHODUJHU:HVWHUQ+LOOV &2001(7/(77(53,1.<.86+1(5 &RPPHQW7KHFRPPHQWHUUDLVHVFRQFHUQVDQGTXHVWLRQVUHODWHGWRWKHSUH]RQHDSSURDFK LGHQWLILHGLQWKH3URMHFW'HVFULSWLRQ 5HVSRQVH3OHDVHUHIHUWR0DVWHU5HVSRQVHIRUFODULILFDWLRQ &RPPHQW7KH FRPPHQWHUUHIHUV WR WKH IROORZLQJ WH[W ³&LW\RZQHG SDUFHOV FDQ EH ORFDWHG DQ\ZKHUHLQWKH&RXQW\DVORQJDVWKH\DUHOHVVWKDQDFUHVRZQHGE\WKH&LW\DQGXVHGIRU PXQLFLSDOSXUSRVHVDWWKHWLPHRIWKHDQQH[DWLRQDSSOLFDWLRQ´DQGVWDWHV³,WLVQRWFOHDUKRZWKLV SURMHFWVDWLVILHVDQ\RIWKRVHOLPLWDWLRQV,QIDFWLWVHHPVFOHDUWKDWQRQHRIWKHSURYLVLRQVDUH VDWLVILHG7KHSURSHUW\WKDWLVSURSRVHGWREHGHVLJQDWHG3)ZLOOQRWEHIRUPXQLFLSDOSXUSRVHVLQ WKHRUGLQDU\OHJDOPHDQLQJRIWKHZRUG³PXQLFLSDO´ 5HVSRQVH$VGLVFXVVHGLQ0DVWHU5HVSRQVHWKHDSSUR[LPDWHO\DFUHVRISURSHUW\ ORFDWHGRXWVLGHRIWKH&LW\¶VFXUUHQW6SKHUHRI,QIOXHQFHZLOOEHSUHVHUYHGDVRSHQVSDFH DQGSUH]RQHG3)´ 3XEOLF)DFLOLWLHV FRQVLVWHQWZLWKDOORIWKHUHPDLQLQJ³&RQVHUYDWLRQ 3DUFHOV´WRWDOLQJDFUHVLQUHVSRQVHWRFRPPHQWVVXEPLWWHGE\WKH/RFDO$JHQF\ )RUPDWLRQ&RPPLVVLRQ /$)&R $OORIWKLVSURSHUW\ZLOOEHRZQHGDQGPDLQWDLQHGE\WKH &LW\RI8NLDK$VQRWHGLQWKH3URMHFW'HVFULSWLRQDQG0DVWHU5HVSRQVH3)VSHFLILFDOO\ LGHQWLILHV SXEOLF RU TXDVLSXEOLF XVHV LQFOXGLQJ EXW QRW OLPLWHG WR QDWXUDO UHVRXUFH FRQVHUYDWLRQDUHDVDQGSDUNVDQGUHFUHDWLRQ &RPPHQW7KHFRPPHQWHUVWDWHVWKHIROORZLQJ³7KH&LW\VKRXOGGHPDQGDFRGLFLOWRWKHSULYDWH URDGDFFHVVWKDWZLOOUHTXLUHWKDWDNH\HGHQWUDQFHJDWHEHEXLOWRQWKHURDGDWWKHHQWU\WRWKH GHYHORSHG KRXVLQJ DUHDDQGDOVRDWWKHGLVWDOHQGRIWKHGHYHORSHG KRXVLQJ DUHD)XUWKHUPRUH QRWKLUGSDUW\RWKHUWKDQWKHRZQHUVRIWKHGHYHORSHGKRXVLQJDQGWKH&LW\FDQEHJLYHQULJKWV Page 576 of 800 WRWUHVSDVVWKRVHWZRJDWHV:LWKRXWVXFKDFRGLFLOLWLVREYLRXVWKDWWKLVSURSRVHGGHYHORSPHQW ZLOOEHDEOHWROHDSIURJIXUWKHUGHYHORSPHQWLQWRWKH&RXQW\SURSHUW\WKDWOLHVIXUWKHUWRWKHZHVW DORQJ WKH URDGZD\ 7KHVH IXUWKHU O\LQJ SDUFHOV DUH GHVLJQDWHG &RXQW\ ODQGV DQG DQ\ GHYHORSPHQWFRQVWUXFWLRQZLOOQRWEHVXEMHFWWR&LW\RI8NLDK¶VUHYLHZVDQGZLOOEHZLWKRXW&LW\ OLPLWDWLRQV DV PHQWLRQHG LQ WKH QHJ GHF LQ WKH DUJXPHQW IRU WKH SUHVHQW DQQH[DWLRQ  ,W LV HJUHJLRXVWKDWWKHSRWHQWLDOIRUOHDSIURJJHGGHYHORSPHQWLVQRWHYHQPHQWLRQHGLQWKHµQHJGHF¶´ 5HVSRQVH7KHH[LVWLQJDFFHVVURDGLVDSULYDWHURDGDQGLVFXUUHQWO\DFFHVVHGE\DJDWH ZLWKDFRGH6HHUHVSRQVHWR&RPPHQW/HWWHUIRULQIRUPDWLRQWKDWDGGUHVVHVWKH FRPPHQWUHJDUGLQJWKHSRWHQWLDOIRU³VSUDZO´ &RPPHQWWKHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJYLVXDOLPSDFWVUHODWHGWRWKHZDWHU WDQN³QHZDFFHVVURDGV´DQGSRWHQWLDOVLQJOHIDPLO\KRPHV 5HVSRQVH$VGLVFXVVHGLQ,601'6HFWLRQ$HVWKHWLFVWKH3URMHFWVLWH V FRQVLVWVRI PRVWO\XQGHYHORSHGSDUFHOVZLWKILUHEUHDNVDQGSULYDWHDFFHVVURDGV1RQHZDFFHVV URDGV DUH SURSRVHG 7KH SDUFHOV KDYH EHHQ VXEMHFW WR YHJHWDWLRQ PDQDJHPHQW DQG JUDGLQJSUDFWLFHVLQFOXGLQJFOHDULQJDUHDVIRUSRWHQWLDOZDWHUWDQNSDGVLWHVDQGKRXVH VLWHVRYHUWKHODVWVHYHUDO\HDUVWKURXJKWKH&RXQW\¶VSHUPLWWLQJSURFHVV 1RWUHHVDUHSURSRVHGIRUUHPRYDODVDSDUWRIWKH3URMHFW7KH3URMHFWSURSRVHVWRDFTXLUH DQGSUHVHUYHRSHQVSDFHIRUVHYHUDOUHDVRQVLQFOXGLQJVRXUFHZDWHUSUHVHUYDWLRQILUH PLWLJDWLRQVFHQLFUHVRXUFHVDQGELRORJLFDOSUHVHUYDWLRQ$SSUR[LPDWHO\DFUHVZRXOG UHPDLQRSHQVSDFHZKLOHDFUHVZRXOGEHSRWHQWLDOO\GHYHORSHGZLWKXSWRXQLWV RQH VLQJOHIDPLO\GZHOOLQJDQGRQH$'8SHUORW $OWKRXJKWKH3URMHFWGRHVQRWLQFOXGHVSHFLILF GHYHORSPHQWSURSRVDOVIRUFRQVWUXFWLRQRIWKHKRPHVWKH'HYHORSPHQW$JUHHPHQWDOORZV WKHSRWHQWLDOIRUWKHKRPHVWREHEXLOWDWVRPHSRLQWLQWKHIXWXUH+RZHYHUWKHORFDWLRQRI SRWHQWLDOKRPHV ZLWKLQWKH'HYHORSPHQW3DUFHOV DUHDOOSURSRVHGLQWKHORZHVWHOHYDWLRQ RIWKH3URMHFWDUHDWKHUHIRUHOLPLWLQJYLVXDOLPSDFWIURPWKHYDOOH\IORRU ,QDGGLWLRQDVRXWOLQHGLQWKH&LW\¶V=RQLQJ2UGLQDQFH 8&&6HFWLRQ WKH&LW\¶V 6LQJOH)DPLO\5HVLGHQWLDO 5 ]RQLQJGLVWULFWFRQWDLQVGHYHORSPHQWVWDQGDUGVLQFOXGLQJ DIRRWKHLJKWOLPLWDWLRQIRUVLQJOHIDPLO\KRPHV7KLVVFDOHRISRWHQWLDOGHYHORSPHQW ZRXOG EH VLPLODU WR UHVLGHQWLDO GHYHORSPHQW LQ WKH DUHD HDVW RI WKH VLWH :KLOH WKH HDVWHUQPRVWSRUWLRQRIWKH3URMHFWWKDWFRXOGEHGHYHORSHGZLWKKRPHVGHYHORSPHQWRI WKHVHKRPHVZRXOGQRWVXEVWDQWLDOO\GHJUDGHDVFHQLFYLVWDRUWKHYLVXDOFKDUDFWHURIWKH DUHDDVLWLVDVVXPHGWKH\ZRXOGEHFRQVWUXFWHGZLWKLQWKHH[LVWLQJKRXVHVLWHVDQGQRW UHTXLUHDVXEVWDQWLDODPRXQWRIYHJHWDWLRQUHPRYDO 2QHRIWKHLQWHQWLRQVRIWKH±+'LVWULFWLVWRSUHVHUYHRXWVWDQGLQJQDWXUDOSK\VLFDOIHDWXUHV VXFKDVWKHKLJKHVWFUHVWRIDKLOOQDWXUDOURFNRXWFURSSLQJVPDMRUWUHHEHOWVHWF$OORZLQJ WKH GHYHORSPHQW RI KRPHV RQ WKH HDVWHUQPRVW SRUWLRQ RI WKH VLWH ZKLOH SUHYHQWLQJ UHVLGHQWLDOGHYHORSPHQWRQWKHUHPDLQLQJDFUHVZLOOHQVXUHRUGHUO\GHYHORSPHQW SDWWHUQVWRSUHYHQWVSUDZODQGYLVXDOGHJUDGDWLRQZLWKLQWKH:HVWHUQ+LOOV7KHDVVXPHG ORZGHQVLW\GHYHORSPHQWSDWWHUQLVFRQVLVWHQWDQGFRQWULEXWHVWRWKHUXUDO³VPDOOWRZQ´ FKDUDFWHURIWKH8NLDK9DOOH\DQGFRQVLVWHQWZLWKSURSRVHG&LW\]RQLQJIRUWKHVLWHV,WLV DOVRFRQVLVWHQWZLWKWKHSXUSRVHVDQGLQWHQWLRQVRIWKH8NLDK9DOOH\$UHD3ODQ,QDGGLWLRQ IXWXUH UHVLGHQWLDO GHYHORSPHQW RI 'HYHORSPHQW 3DUFHOV ZRXOG EH VXEMHFW WR GLVFUHWLRQDU\DQGHQYLURQPHQWDOUHYLHZDQGEHUHTXLUHGWRFRPSO\ZLWK&LW\UHJXODWLRQV IRU KHLJKW VHWEDFNV DQG RWKHU GHYHORSPHQW VWDQGDUGV HVWDEOLVKHG WR SURWHFW QDWXUDO Page 577 of 800 IHDWXUHVDQGVFHQLFUHVRXUFHVZLWKLQWKH:HVWHUQ+LOOV$OWKRXJK'HYHORSPHQW3DUFHOV PD\EHGHYHORSHGZLWKLQWKH&RXQW\¶VMXULVGLFWLRQSULRUWRDQQH[DWLRQE\ULJKWWKH\ZLOO EHUHTXLUHGWREHGHYHORSHGWR5+VWDQGDUGVWKURXJK&& 5V,QDGGLWLRQDOOPLWLJDWLRQ PHDVXUHV LGHQWLILHG IRU UHVLGHQWLDO GHYHORSPHQWLQ WKH ,601'ZLOO EH DSSOLHG WR 'HYHORSPHQW3DUFHOV7KHUHIRUHWKHSRWHQWLDOUHVLGHQWLDOGHYHORSPHQWDVVRFLDWHG ZLWKWKH3URMHFWZRXOGQRWFRQIOLFWZLWKDSSOLFDEOH]RQLQJDQGRWKHUUHJXODWLRQVJRYHUQLQJ VFHQLFTXDOLW\  6HZHUDQGHOHFWULFXWLOLWLHVZRXOGEHH[WHQGHGIURP5HGZRRG$YHQXHWRWKHKRXVHVLWHV EXWZRXOGEHORFDWHGXQGHUJURXQGZLWKLQWKHH[LVWLQJURDGZD\WRDYRLGYLVXDOLPSDFWV7KH WZRSURSRVHGZDWHUWDQNV IW[IWIWKLJK ZRXOGEHFRORUHGDVKDGHRIJUHHQWR EOHQGLQZLWKWKHODQGVFDSH7KHZDWHUWDQNVLWHKDVDOUHDG\EHHQFOHDUHGRIYHJHWDWLRQ DQGLVVXUURXQGHGE\WUHHVPDNLQJLWOHVVYLVLEOHWRWKHSXEOLF'XHWRWKHORFDWLRQDQG WRSRJUDSK\ RI WKH VLWH DQG GLVWDQFH IURP SXEOLF YLHZV VXFK DV WKRVH LQ DGMDFHQW UHVLGHQWLDO DUHDV RU YLHZV IURP WKH YDOOH\ IORRU WKH SURSRVHG ZDWHU WDQN ZRXOG QRW VLJQLILFDQWO\LPSDFWVFHQLFUHVRXUFHVRQWKHVLWHRULQWKHDUHD )RUWKHDIRUHPHQWLRQHGUHDVRQVWKH3URMHFWZRXOGQRWUHVXOWLQDVLJQLILFDQWLPSDFWWR VFHQLFYLVWDVQRUWKHYLVXDOFKDUDFWHURIWKHVLWHRUDUHD,PSDFWVZRXOGEHOHVVWKDQ VLJQLILFDQW &RPPHQW7KHFRPPHQWHUVWDWHVWKDW³$FFRUGLQJWRWKH,601'WKHSURMHFWVKRXOGHYDOXDWH ³IRUHVWFDUERQPHDVXUHPHQWPHWKRGRORJ\SURYLGHGLQ)RUHVW3URWRFROVDGRSWHGE\WKH&DOLIRUQLD $LU5HVRXUFHV%RDUG´1RGDWDKDYHEHHQSURYLGHG&2OHYHOVFRQWLQXHWRLQFUHDVHLQWKH8NLDK 9DOOH\7KHUHPRYDORIIRUHVWVZLOODGGWRWKHFDUERQLQFUHDVHV7KLVHIIHFWFDQQRWEHVDLGWREH OHVVWKDQVLJQLILFDQWXQOHVVFDUERQPHDVXUHPHQWVDUHHVWDEOLVKHG,QRUGHUWRµQHJGHF¶WKH SURMHFWFXUUHQWSUHSURMHFWEDVHOLQHGDWDPXVWEHPHDVXUHG7KHKHDWHIIHFWRIIRUHVWUHPRYDO PXVWEHHYDOXDWHG´ 5HVSRQVH7KHODQJXDJHWKHFRPPHQWHUUHIHUVWRLVLQFOXGHGLQWKH&(4$*XLGHOLQHV $SSHQGL[*FKHFNOLVWIRU$JULFXOWXUHDQG)RUHVWU\5HVRXUFHV,WLVSURYLGHGLQWKHFKHFNOLVW DVDWRROIRUPHDVXULQJWKHFRQYHUVLRQRIIRUHVWODQG$VQRWHGLQ6HFWLRQ$JULFXOWXUH DQG )RUHVWU\ 5HVRXUFHVRI WKH ,601' DFFRUGLQJ WR WKH &DOLIRUQLD 'HSDUWPHQW RI &RQVHUYDWLRQ)DUPODQG0DSSLQJ 0RQLWRULQJ3URJUDP&DOLIRUQLD,PSRUWDQW)DUPODQG )LQGHUWKH3URMHFWDUHDGRHVQRWFRQWDLQ8QLTXH)DUPODQGRU)DUPODQGRI6WDWHZLGH ,PSRUWDQFH$GGLWLRQDOO\WKH3URMHFWGRHVQRWFRQWDLQWLPEHUODQG7KH3URMHFWZRXOGQRW FRQYHUW)DUPODQGFRQIOLFWZLWKH[LVWLQJ]RQLQJIRUDJULFXOWXUHRUIRUHVWODQGDQGZRXOGQRW LQYROYHFKDQJHVWRWKHHQYLURQPHQWWKDWZRXOGUHVXOWLQWKHFRQYHUVLRQRIDJULFXOWXUDO UHVRXUFHVWRQRQDJULFXOWXUHXVHV7KHUHIRUHWKHDQDO\VLVWKHFRPPHQWHUUHIHUVWRLVQRW DSSOLFDEOHWRWKH3URMHFW3OHDVHUHIHUWR,601'6HFWLRQ$LU4XDOLW\IRUDGLVFXVVLRQ RIDLUTXDOLW\LPSDFWV &RPPHQW7KHFRPPHQWHUH[SUHVVHVWKHRSLQLRQWKDWWKH%LRORJLFDO5HVRXUFH$VVHVVPHQWIRU WKH3URMHFWLVLQDGHTXDWHEHFDXVHQRWDOORIWKHERWDQLFDOVXUYH\VKDGEHHQFRPSOHWHGDWWKHWLPH RIWKH'UDIW,601',QDGGLWLRQWKHFRPPHQWHUVWDWHVWKDWWKHHQWLUHDFUHVDVVRFLDWHGZLWK WKH3URMHFWVKRXOGEHVXUYH\HG 5HVSRQVH6HHUHVSRQVHWR&RPPHQW/HWWHU,QDGGLWLRQLWVKRXOGEHFODULILHGWKDW VXUYH\VDQGWKH%LRORJLFDO5HVRXUFHV$VVHVVPHQWZDVFRQGXFWHGRQDFUHVRIWKH 3URMHFWVLWHDQGOLPLWHGWRDUHDVWKDWZRXOGLQFOXGHJURXQGGLVWXUEDQFHWKLVLQFOXGHVWKH Page 578 of 800 DFUHVHQFRPSDVVLQJWKHSURSRVHG'HYHORSPHQW3DUFHOVLQDGGLWLRQWRWKHDFFHVVURDG H[WHQGHGRXWWRIWRQHLWKHUVLGH DQGWKHZDWHUWDQNSDGVLWH1RGHYHORSPHQWRU JURXQGGLVWXUEDQFHZRXOGRFFXURQWKHUHDPLQJDSSUR[LPDWHO\DFUHVDVLWZLOOEH SUHVHUYHGDVRSHQVSDFH$FFRUGLQJO\DGGLWLRQDOELRORJLFDOVXUYH\VDUHQRWZDUUDQWHG &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQUHJDUGLQJZLOGILUHDQGDVNVVHYHUDOTXHVWLRQV UHJDUGLQJZLOGILUHLQVXUDQFHVRLOPRLVWXUHGURXJKWIHDVLELOLW\RIWKH3URMHFWDQGKRXVLQJQHHGV 5HVSRQVH 3OHDVH UHIHU WR 0DVWHU 5HVSRQVH  UHJDUGLQJ ZLOGILUH5HJDUGLQJ WKH UHPDLQLQJTXHVWLRQVUDLVHGE\WKHFRPPHQWHU,601'6HFWLRQ:LOGILUHSURYLGHVDQ DQDO\VLVRIZLOGILUHLPSDFWVDVUHTXLUHGE\&(4$,QIRUPDWLRQUHOHYDQWWRWKLVDQDO\VLV UHJDUGLQJWKH&LW\¶V+RXVLQJ(OHPHQWDQG5HJLRQDO+RXVLQJ1HHGV$OORFDWLRQFDQEH IRXQGLQ,601'6HFWLRQ3RSXODWLRQDQG+RXVLQJ$QDQDO\VLVRIWKH&LW\¶VVHUYLFH DQGXWLOLW\FDSDFLW\ LQFOXGLQJZDWHU FDQEHIRXQGLQ,601'6HFWLRQ8WLOLWLHVDQG 6HUYLFH6\VWHPVDQGDOVRLQUHVSRQVHWR&RPPHQW/HWWHU 7KHUHPDLQLQJFRPPHQWVUDLVHGE\WKHFRPPHQWHULQFOXGHTXHVWLRQVWKDWDUHK\SRWKHWLFDO LQQDWXUHDQGRUGRQRWUHTXLUHDQDO\VLVLQDFFRUGDQFHZLWK&(4$*XLGHOLQHV6HFWLRQ ZKLFKVWDWHV³reviewers should be aware that the adequacy of an EIR is determined in terms of what is reasonably feasible, in light of factors such as the magnitude of the project at issue, the severity of its likely environmental impacts, and the geographic scope of the project. CEQA does not require a lead agency to conduct every test or perform all research, study, and experimentation recommended or demanded by commenters. When responding to comments, lead agencies need only respond to significant environmental issues and do not need to provide all information requested by reviewers, as long as a good faith effort at full disclosure is made in the EIR´ &RPPHQW7KHFRPPHQWHULVRIWKHRSLQLRQWKDWWKHILJXUHVLQFOXGHGLQWKH,601'DUHLQDGHTXDWH DQGVWDWHVWKDWDWRSRJUDSKLFDOPDSZDVQRWLQFOXGHG,QDGGLWLRQWKHFRPPHQWHUVWDWHVWKDWWKH SKRWRJUDSKV LQ WKH %LRORJLFDO 5HVRXUFH $VVHVVPHQW GR QRW QRWH WKH ³JHRJUDSKLFDO RU WRSRJUDSKLFDOZKHUHDERXWV´ 5HVSRQVH7RSRJUDSKLFDOPDSVDVZHOODVPDQ\RWKHUUHVRXUFHVOLVWHGLQWKH5HIHUHQFHV 6HFWLRQ RI WKH ,601' ZHUH UHYLHZHG GXULQJ WKH SUHSDUDWLRQ RI WKH ,601'$ WRSRJUDSKLFDOPDSLVQRWUHTXLUHGWREHLQFOXGHGLQWKH,601'+RZHYHURQHLVLQFOXGHG LQ5HVSRQVHWR&RPPHQWV$WWDFKPHQW$IRUUHIHUHQFH &RPPHQW7KHFRPPHQWHUVWDWHVWKDW³DQ(,5LVUHTXLUHGWRKDYHDOWHUQDWLYHLQFOXGLQJDQR SURMHFWDOWHUQDWLYHDQGRWKHUDOWHUQDWLYHVWKDWDFKLHYHWKHVDPHRUHTXDOSURYLVLRQV´ 5HVSRQVH7KHFRPPHQWHULVFRUUHFWLQWKDWDFFRUGLQJWR&(4$*XLGHOLQHV6HFWLRQ LQSUHSDUDWLRQRIDQ(,5DOWHUQDWLYHVPXVWEHSURYLGHG+RZHYHUWKHFRPPHQWHU HUURQHRXVO\LGHQWLILHV WKH ,601' DV DQ (,5 ,601'V DUH QRW UHTXLUHG WR SURYLGH DOWHUQDWLYHV &RPPHQW7KHFRPPHQWHUVWDWHVWKDWDOWHUQDWLYHVLWHVIRUWKHZDWHUWDQNPXVWEHLQFOXGHGDQG UDLVHVFRQFHUQVUHJDUGLQJWKHZDWHUDQDO\VLV 5HVSRQVH$OWKRXJKQRWUHTXLUHGDOWHUQDWLYHZDWHUWDQNORFDWLRQVZHUHFRQVLGHUHGLQWKH SUHOLPLQDU\SODQQLQJSURFHVVRIWKLV3URMHFW$VQRWHGLQ,601'6HFWLRQ+\GURORJ\ DQG:DWHU4XDOLW\DVZHOODV6HFWLRQ8WLOLWLHVDQG6HUYLFH6\VWHPVZDWHUZLOOEH Page 579 of 800 SURYLGHGRQVLWHE\WKHGHYHORSHUYLDWZR  JDOORQZDWHUWDQNV$FFRUGLQJWRWKH ZDWHUWDQNSODQQLQJVWXG\PHPRUDQGXPSUHSDUHGE\*+' 'HFHPEHU WKH H[LVWLQJZHOOVSURGXFHDSSUR[LPDWHO\JDOORQVSHUGD\DQGDUHORFDWHGDGMDFHQWWR WKHSURSRVHGWDQNV$VDUHVXOWWKHGHYHORSHUSURSRVHVWRVXSSO\WKHWDQNVZLWKZDWHU IURPWKHZHOOUDWKHUWKDQFRQVWUXFWLQJQHZERRVWHUSXPSVWDWLRQVWRSXPSZDWHUXSWRWKH WDQNVIURPWKH&LW\¶VH[LVWLQJZHOOV$VQRWHGLQWKH*+'PHPRUDQGXPWKHSRWHQWLDO GHYHORSPHQW LQ WKLV DUHD FRXOG EH VHUYHG ZLWK DGHTXDWH SUHVVXUH E\ D WDQN DW WKH SURSRVHGORFDWLRQ7KLVLQIRUPDWLRQKDVEHHQDGGHGWRWKH)LQDO'UDIW,601' &200(17/(77(5  0(1'2&,12 &2817< /2&$/ )250$7,21 &200,66,21 /$)&R  &RPPHQW/$)&R VWDWHV WKDW ³LQ RUGHU WR IXOO\ DGGUHVV WKH DQQH[DWLRQ FRPSRQHQW RI WKH SURSRVHGSURMHFWWKH,QLWLDO6WXG\QHHGVWRIXUWKHUDQDO\]HWKHFKDQJHLQGHYHORSPHQWSRWHQWLDO RIWKHDQQH[DWLRQDUHDIURPFXUUHQWFRQGLWLRQV 7KLV LQYROYHV LGHQWLI\LQJ DQG FRPSDULQJ WKH PD[LPXP GHYHORSPHQW SRWHQWLDO XQGHU FXUUHQW FRQGLWLRQV &RXQW\*HQHUDO3ODQ=RQLQJDQG8NLDK9DOOH\6DQLWDWLRQ'LVWULFWVHUYLFH DQGWKH SURSRVHG SURMHFW GHYHORSPHQW SRWHQWLDO %RXQGDU\ /LQH $GMXVWPHQW &LW\ *HQHUDO 3ODQ3UH]RQLQJDQG&LW\VHUYLFHV  7KHSURSRVHGSURMHFWGHYHORSPHQWSRWHQWLDORI6LQJOH)DPLO\'ZHOOLQJ8QLWVDQG$FFHVVRU\ 'ZHOOLQJ 8QLWV LGHQWLILHG IRU WKH 'HYHORSPHQW 3DUFHOV DSSHDUV DSSURSULDWH EDVHG RQ WKH 'HYHORSPHQW$JUHHPHQWDQGPD\UHVXOWLQDQRYHUDOOUHGXFWLRQRIHQYLURQPHQWDOLPSDFWVRU HQYLURQPHQWDOEHQHILWVIURPWKHFOXVWHUHGGHYHORSPHQWGHVLJQZKHQFRPSDUHGZLWKWKHFXUUHQW FRQGLWLRQV 6LQFHWKHUHLVQRGHYHORSPHQWDQWLFLSDWHGIRUWKH1RJXHUDSURSHUWLHVWKHGHYHORSPHQWSRWHQWLDO RIWKHVHSDUFHOVZRXOGEHWKHPD[LPXPGHYHORSPHQWSRWHQWLDOXQGHUERWKFXUUHQWFRQGLWLRQV &RXQW\*HQHUDO3ODQ=RQLQJDQG8NLDK9DOOH\6DQLWDWLRQ'LVWULFWVHUYLFH DQGWKHSURSRVHG SURMHFW &LW\*HQHUDO3ODQ3UH]RQLQJDQG&LW\VHUYLFHV  7KHFRPSDULVRQRIFXUUHQWDQGSURSRVHGGHYHORSPHQWSRWHQWLDOIRUWKH&RQVHUYDWLRQ3DUFHOVPD\ UHVXOWLQDQRYHUDOOUHGXFWLRQRIHQYLURQPHQWDOLPSDFWVRUHQYLURQPHQWDOEHQHILWVIURPORQJWHUP FRQVHUYDWLRQDQGDVVRFLDWHGQDWXUDOUHVRXUFHDQGODQGPDQDJHPHQWDFWLYLWLHV´ 5HVSRQVH$QDQDO\VLVRILPSDFWVDVVRFLDWHGZLWKFXUUHQWGHYHORSPHQWSRWHQWLDODQG GHYHORSPHQWSRWHQWLDOXQGHUWKH3URSRVHG3URMHFWLVSURYLGHGWKURXJKRXWWKH,601'DV DSSURSULDWH6SHFLILFDOO\6HFWLRQ3RSXODWLRQDQG+RXVLQJVWDWHVWKHIROORZLQJ “Discussion: (a) Less than significant impact. As previously discussed in the Project Description and Land Use Section (11) of this Initial Study, the Proposed Project would annex approximately 707 acres into the City. Once annexed, 54 acres could be developed with up to 14 residential units (seven single family homes and one associated ADU per lot) through the proposed Development Agreement. Although no development is proposed at this time, for this analysis it is assumed that future development would result in construction and development of residential uses on the site. Under the County’s General Plan and Zoning Ordinance, the entirety of the 707 acres has the potential to be developed with up to one dwelling per 40 acres, for a Page 580 of 800 total of 17 primary dwellings. In addition, an ADU may be constructed as of right on each parcel, resulting in the potential for up to 34 total units to be developed. The City of Ukiah’s General Plan land use designation of Low Density Residential (LDR) allows for a density of six dwelling units per acre. Under these regulations, the 54 acres for residential development could conceivably be developed with up to 330 units. However, the proposed Development Agreement would restrict development to one single family dwelling per parcel and one ADU (except in cases where the slope exceeds 50 percent, per the City’s Hillside Overlay Ordinance), for a total of up to14 units. Although Development Parcels 1-3 may be developed within the County’s jurisdiction prior to annexation by-right, they will be required to be developed to R1-H standards through CC&Rs. All Development Parcels would be prezoned to R1-H (with a Low Density Residential General Plan land use designation) and are located within the 95’ General Plan’s Unincorporated Planning Area, as well as the current UVAP/SOI boundary. The proposed Development Parcels are consistent with the density and intent of the LDR land use designation and R1H zoning. Additionally, the 14 units that could be developed under the Development Agreement would fulfil a portion of the moderate to above moderate income units required by the City’s RHNA for the 2019-2027 Planning Cycle. As a part of the Project, utilities would be extended to the area. However, because the extension of utilities would be limited to the seven Development Parcels that are currently zoned for rural residential development, the Project, including development of up to 14 units, would not directly induce substantial unplanned development and population growth in the area. The remaining 640 acres that would be preserved as open space would not be developed with residential uses that could result in an increase in population. For the aforementioned reasons, the Proposed Project would not induce substantial unplanned population growth in an area, either directly or indirectly. Impacts would be less than significant.” %HFDXVHWKH³1RJXHUD3URSHUWLHV´ZRXOGEHXVHGIRU H[LVWLQJ DFFHVVRQO\DQGDUHQRW LQFOXGHGLQWKH'HYHORSPHQW$JUHHPHQWDVQRGHYHORSPHQWLVSURSRVHG7KHUHIRUHWKH SDUFHOVZHUHQRWLQFOXGHGLQWKHGHYHORSPHQWDVVXPSWLRQVDQGDGHWDLOHG³PD[LPXP EXLOGRXW´VFHQDULRLVQRWDSSURSULDWH$VQRWHGLQ/$)&R¶VSUHYLRXVFRPPHQWDOOSDUFHOV PXVWEHLQFOXGHGLQWKHSUH]RQLQJDSSOLFDWLRQ7KHVHSDUFHOVOD\LQEHWZHHQH[LVWLQJ5 +SDUFHOVLPPHGLDWHO\WRWKHHDVWZLWKLQFLW\OLPLWVDQGWKHSURSRVHG'HYHORSPHQW3DUFHOV LPPHGLDWHO\WRWKHZHVWWKDWDUHSURSRVHGWRDOVREHSUH]RQHG5+7KHUHIRUHSUH]RQLQJ WKHVH SDUFHOV DQ\ RWKHU ]RQLQJ GLVWULFW ZRXOG FUHDWH³VSRW ]RQLQJ´ DQGZRXOG QRW EH FRQVLVWHQWZLWKH[LVWLQJODQGXVHSDWWHUQV 7KH&LW\DJUHHVWKDWSUHVHUYDWLRQRIWKH³&RQVHUYDWLRQ3DUFHOV´ DFUHVWRWDO DVRSHQ VSDFHJUHDWO\UHGXFHVHQYLURQPHQWDOLPSDFWVZKHQFRPSDUHGWRWKHH[LVWLQJGHYHORSPHQW SRWHQWLDOZLWKLQWKH&RXQW\¶VMXULVGLFWLRQ,QDGGLWLRQE\OLPLWLQJGHYHORSPHQWZLWKLQWKH SURSRVHG 'HYHORSPHQW3DUFHOV EH\RQG ZKDW LV FXUUHQWO\ DOORZHG ZLWKLQ WKH &RXQW\¶V ]RQLQJFRGHWKURXJKWKH&LW\¶V5+]RQLQJGLVWULFWWKH3URMHFWZRXOGUHVXOWLQDQRYHUDOO UHGXFWLRQRIHQYLURQPHQWDOLPSDFWVZKHQFRPSDUHGWRFXUUHQWFRQGLWLRQV &RPPHQW/$)&RVWDWHVWKDWSDUFHOVRXWVLGHRIWKH62,PXVWEHLQFOXGHGLQWKHSUH]RQLQJLQ *RYW&RGH D   Page 581 of 800 5HVSRQVH$IWHUIXUWKHU UHYLHZ RI*RYHUQPHQW&RGH 6HFWLRQ  D  &LW\ RI 8NLDK SURSRVHVWRSUH]RQHWKHHQWLUHW\RIWKH³&RQVHUYDWLRQ3DUFHOV´ DSSUR[LPDWHO\DFUHV RI DV³SXEOLF)DFLOLWLHV´IRURSHQVSDFHSXUSRVHV6HH0DVWHU5HVSRQVHIRUPRUHLQIRUPDWLRQ 7KH)LQDO'UDIW,QLWLDO6WXG\KDVEHXSGDWHGZLWKWKLVLQIRUPDWLRQ%HFDXVHWKHSURSRVHGXVH DVVRFLDWHGZLWKWKHVHSDUFHOVUHPDLQVWKHVDPHQRDGGLWLRQDOHQYLURQPHQWDOLPSDFWWKDWZDV QRWSUHYLRXVO\DGGUHVVHGLQWKH,QLWLDO6WXG\ZRXOGRFFXU &RPPHQW/$)&RVWDWHVWKHIROORZLQJ³,QRUGHUWRIXOO\DGGUHVVWKHDQQH[DWLRQFRPSRQHQWRI WKHSURSRVHGSURMHFWWKH,QLWLDO6WXG\QHHGVWRIXUWKHUDQDO\]HWKHSURYLVLRQRIPXQLFLSDOVHUYLFHV 7KLV LQYROYHV D FRPSDULVRQ RI FXUUHQW V\VWHP FDSDFLW\ DQWLFLSDWHG VHUYLFH GHPDQG RI WKH SURSRVHGSURMHFWEDVHGRQGHYHORSPHQWSRWHQWLDODQGWKH&LW\¶VDELOLW\WRVHUYHWKHSURSRVHG SURMHFWEDVHGRQDYDLODEOHFDSDFLW\DQGSURMHFWGHPDQG:KLOHQRWQHFHVVDULO\DSSOLFDEOHWRWKH SURSRVHGSURMHFWLQVLWXDWLRQVZKHUHVHUYLFHH[SDQVLRQVRULPSURYHPHQWVDUHQHHGHGWRDGGUHVV WKH SURSRVHG SURMHFW WKH SRWHQWLDO HQYLURQPHQWDO LPSDFWV RI VXFK H[SDQVLRQ DQGRU LPSURYHPHQWVVKRXOGDOVREHDQDO\]HG´ 5HVSRQVH$QDQDO\VLVRIXWLOLW\VHUYLFHV\VWHPVLVLQFOXGHGLQ,601'6HFWLRQ8WLOLWLHV DQG6HUYLFH6\VWHPV$GHWDLOHG3ODQIRU6HUYLFHVZLOOEHLQFOXGHGLQWKHDSSOLFDWLRQIRU DQQH[DWLRQ+RZHYHUWKHIROORZLQJLQIRUPDWLRQKDVEHHQDGGHGWRWKH)LQDO'UDIW,601'IRU FODULILFDWLRQ 6HZHUZDWHUDQGHOHFWULFXWLOLWLHVZRXOGEHSURYLGHGWRWKH'HYHORSPHQW3DUFHOV6HZHUDQG ZDWHUZLOOEHGHYHORSHGE\WKHSURSHUW\RZQHUZKLOHHOHFWULFLQIUDVWUXFWXUHZLOOEHGHYHORSHG E\WKHSURSHUW\RZQHUDQGRUWKH&LW\$OOXWLOLWLHVZRXOGEHRZQHGDQGPDLQWDLQHGE\WKH+2$ ZLWKWKHH[FHSWLRQRIHOHFWULFZKLFKZLOOEHXOWLPDWHO\PDLQWDLQHGE\WKH&LW\ :DWHUZLOOEHSURYLGHGE\WKHSURSHUW\RZQHUGHYHORSHURQVLWHYLDWZR  JDOORQZDWHU WDQNV  $FFRUGLQJ WR WKH ZDWHU WDQN SODQQLQJ VWXG\ PHPRUDQGXP SUHSDUHG E\ *+' 'HFHPEHU WKHH[LVWLQJZHOOVSURGXFHDSSUR[LPDWHO\JDOORQVSHUGD\DQG DUHORFDWHGDGMDFHQWWRWKHSURSRVHGWDQN$VDUHVXOWWKHGHYHORSHUSURSRVHVWRVXSSO\WKH WDQNVZLWKZDWHUIURPWKHZHOOVUDWKHUWKDQFRQVWUXFWLQJQHZERRVWHUSXPSVWDWLRQVWRSXPS ZDWHUXSWRWKHWDQNVIURPWKH&LW\¶VH[LVWLQJZHOOV$VQRWHGLQWKH*+'PHPRUDQGXPWKH SRWHQWLDOGHYHORSPHQWLQWKLVDUHDFRXOGEHVHUYHGZLWKDGHTXDWHSUHVVXUHE\DWDQNDWWKH SURSRVHGORFDWLRQ 7KH&LW\RI8NLDK8UEDQ:DWHU0DQDJHPHQW3ODQ 8:03 ZDVDGRSWHGE\&LW\&RXQFLO RQ-XQH7KH8:03FRQVLGHUVVHYHUDOJURZWKVFHQDULRVLQFOXGLQJDGGLWLRQDO DQGKRRNXSVDQGWKHUHLVFDSDFLW\WKUXWKHSODQQLQJKRUL]RQ 7KH &LW\¶V:DVWH:DWHU 7UHDWPHQW 3ODQW ::73  ZDV XSJUDGHG LQ 7KLV XSJUDGH LQFOXGHG WKH DGGLWLRQ RI  HTXLYDOHQW VDQLWDU\ VHZHU XQLWV (668V  $Q (668 LV DSSUR[LPDWHO\ZKDWLVXVHGE\DVLQJOHIDPLO\GZHOOLQJXQLW7KLVSURMHFWKDVVHYHQEXLOGLQJ VLWHV WKDWFRXOG KDYH VHYHQ DGGLWLRQDO $FFHVVRU\ 'ZHOOLQJ 8QLWV $'8V  7KLV SURMHFW LV DQWLFLSDWHGWRXVH(668V7KH::73FXUUHQWO\KDVDYDLODEOHEHWZHHQWKH&LW\RI8NLDK DQGWKH8NLDK9DOOH\6DQLWDWLRQ'LVWULFW 896' (668V &RPPHQW/$)&RVWDWHVWKDWWKH3URSRVHG3URMHFWVKRXOGLQFOXGHGHWDFKPHQWRIWKHDQQH[DWLRQ DUHDIURPWKH8NLDK9DOOH\6DQLWDWLRQ'LVWULFWWRDGGUHVVMXULVGLFWLRQDORYHUODSDQGGXSOLFDWLRQRI Page 582 of 800 PXQLFLSDO VHUYLFH LVVXHV DQG SRWHQWLDOO\ &RXQW\ 6HUYLFH $UHD  LI GXSOLFDWLRQ RI PXQLFLSDO VHUYLFHVLVDSSOLFDEOH 5HVSRQVH7KH&LW\RI8NLDKZLOOVXEPLWDQDSSOLFDWLRQIRUGHWDFKPHQWRIWKH8NLDK9DOOH\ 6DQLWDWLRQ'LVWULFWFRQFXUUHQWO\ZLWKWKHDSSOLFDWLRQIRUDQQH[DWLRQ &200(17/(77(5+(/(16,=(025( &RPPHQW7KHFRPPHQWHUH[SUHVVHVFRQFHUQVUHJDUGLQJWKHVPDOOJDWHGFRPPXQLW\DQGZRXOG UHFRPPHQGPXOWLIDPLO\VWUXFWXUHV 5HVSRQVH7KLVFRPPHQW LV QRWHG DQG LV LQFOXGHG LQWKH SXEOLFUHFRUGIRU 3ODQQLQJ &RPPLVVLRQDQG&LW\&RXQFLOFRQVLGHUDWLRQ Page 583 of 800 5(63216(72&200(176 $77$&+0(17$ Page 584 of 800 Providing shared management of fire protection services for the City of Ukiah and Ukiah Valley Fire District UKIAH VALLEY FIRE AUTHORITY 1500 SOUTH STATE STREET UKIAH, CA 95482-6709 Phone: (707)462-7921 Ƈ Fax: (707)462-2938 Ƈ Email: uvfd@sonic.net MEMORANDUM Date: 27 May 2021 To: Michelle Irace, Community Development Manager From: Doug Hutchison, Fire Chief Subject: Western Hills Annexation, aka “the Hull Properties” This memo is in regards to fire safety concerns that have been raised regarding the potential annexation of the Hull Properties in the Western Hills are of Ukiah. The largest issue for the Fire Authority will be the administration and oversight of the project area for fire prevention once it is annexed. Per State law, once the area is annexed into the city it will be re-designated from “State Responsibility Area” (SRA) to “Local Responsibility Area” (LRA), but will retain its classification as a Very High Fire Hazard Zone. As such, the city, through the Fire Authority, will be required to enforce the State’s fire safety standards on those lands. It is our understanding that the proposal includes the possibility of very limited future development of seven (7) parcels in the lower, mid-slope portion of the property. I performed a site visit with the property owner and went over the proposed development plans and believe that with the widening and paving of the road, and the installation of the water tank and fire hydrants we will be able to comply with the State’s fire safety regulations in that area. This is not to say that the area does not present challenges, but they are no different than many other areas that we currently protect, and in many cases the conditions currently present and proposed would be better than those other areas. In regards to the recently re-established shaded fuel break in the area, the addition of the small amount of structures would have minimal if any impact on its effectiveness. The Page 585 of 800 Providing shared management of fire protection services for the City of Ukiah and Ukiah Valley Fire District defensible spaces created by the home sites could even enhance its effectiveness in that limited area. Please do not hesitate to reach out if you need more information or have other questions or concerns. Page 586 of 800 Page 587 of 800 Page 588 of 800 May 31, 2021 Catherine Iantosca Environmental Scientist Southern 401 Water Quality Certification Unit North Coast Regional Water Quality Control Board 5550 Skylane Blvd, Ste. A Santa Rosa, CA 95403 RE: Response to 5/20/21 Regional Water Board Comments: City of Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Dear Catherine, Thank you for commenting on the Biological Resource Report for the City of Ukiah Western Hills Open Land Acquisition & Limited Development Agreement. With regards streams and riparian habitat Section 5.1.2, (5) Field Survey Results, (.1) Biological Communities (.2) Sensitive Biological Communities – Sensitive Aquatic Resources (page 16) states that six watercourses were observed and mapped in the Study Area. It additionally states that two sensitive biological communities, Quercus garryana Forest & Woodland Alliance (S3) and Umbellularia californica Forest & Woodland Alliance (S3) were observed within the Study Area. Please refer to section 6.1, (6) Assessment Summary and Recommendations, (.1) Biological Communities (page 27-28), for recommended mitigations to reduce the impact of the project to streams and sensitive biological communities including riparian habitat. For proposed work within watercourses, such as stream crossings, our recommendations include obtaining a CDFW LSA Agreement but should include obtaining a SWRCB 401 permit as well. With regards to wetlands, Section 3.4.2, (3) Field Survey Methodology, (.4) Biological Communities, (.2) Sensitive Communities-Aquatic Resources (page 8), is not a result or account of what we observed on site and is meant to describe our methodology in defining and describing wetlands for the purposes of the assessment. Generally, if a suspected wetland is observed during our biological assessment, it is referred to as a “wet area” until a wetland delineation is performed to determine whether the “wet area’ meets the criteria of wetlands as described by the USACE 1987 Manual. The NWI database is consulted at a reconnaissance level before our site visit and is not intended to substitute on-the-ground field assessments for wetlands. Please refer to section 5.1.2, (5) Field Survey Results, (.1) Biological Communities, (.2) Sensitive Biological Communities-Sensitive Aquatic Resources (page 16), for the results of the assessment concerning sensitive aquatic resources including wetlands. No wetlands were observed within the Study Area during the biological assessment. We will make these results clearer for future reporting. Page 589 of 800 If you have any questions, please do not hesitate to contact me. Sincerely, Alicia Ives Ringstad Senior Wildlife Biologist Jacobszoon & Associates, Inc. Page 590 of 800 August 8, 2021    RE: Response to 5/20/21 Public Comments: City of Ukiah Western Hills Open Land Acquisition & Limited  Development Agreement    To whom it may concern,    Thank you for commenting on the Biological Resource Report for the City of Ukiah Western Hills Open  Land Acquisition & Limited Development Agreement.    With regards to the following comments:    “I encourage the City to complete the botanical studies as planned. The study states that at least one  more site visit was recommended. I recommend that this be completed before CEQA is finalized. That  may mean waiting another year as many plants bloomed early this year and have already withered.”    As noted in the Draft ISMND, botanical surveys were completed on 03/30/2021 and 5/17/2021. As noted  in Draft ISMND Mitigation Measure BIO‐1, the third botanical survey was required to be completed  within the blooming period (March –July) and prior to any ground disturbing activities.  The third and  final botanical survey was completed and 7/9/2021. The surveys were conducted in accordance with  “Protocols for Surveying and Evaluating Impacts to Special Status Native Plant Populations and Natural  Communities” (CDFW 2018).  No special status species plants were observed during the surveys.  The  botanical surveys are now completed for the project and no further recommendations for sensitive  plants are required. Please refer to the Biological Resources Assessment Addendum for Rare Plant  Assessment and Botanical Survey for more information.      “There are year‐round springs adjacent to the road and I have heard that there are others in the area.  We have found giant pacific salamanders on our property that must be residents of the springs. I don’t  think the salamanders are a protected species but they are very unusual in the Ukiah Valley. I have found  native snails that I think are also unusual, if not protected, and I wonder what other species might be  residents of these springs? I hope the biological surveys included the areas around the creek drainage.”    The creeks within the Study Area were surveyed during the biological assessment and first botanical  survey and no special status species were observed; however, it is recommended in biological  assessment report in Section 6 that if any work is proposed within the streams to conduct pre‐  construction surveys for sensitive amphibian species.    “The unnamed creek drainage that runs along Redwood Avenue should be treated as a wildlife corridor  and a seasonal creek. The springs along the creek are an important water source for wildlife. I have this  drainage affected by sediment flows from improper grading, poor culvert placement, bright lights, tree  removal in the creek corridor, and recently, fencing of the creek, prohibiting wildlife passage. I am  concerned that these trends will continue if there is not educated oversight. Some of this has been on  county land and some within the city limits.”  Page 591 of 800         It is recommended in the Biological Assessment report in Section 6 that all earthwork within or adjacent  to the watercourse adhere to standard methods of erosion and sediment control and, if possible, to  complete all work while the channel is dry to reduce sediment load downstream. It is also  recommended that a qualified biologist be on site for any dewatering event to address the potential for  the presence of sensitive aquatic species such as foothill yellow‐legged frog (Rana boylii).    If you have any questions, please do not hesitate to contact me.  Sincerely,        Alicia Ives Ringstad  Senior Wildlife Biologist  Jacobszoon & Associates, Inc.                                                                           Page 592 of 800 Comments Received on the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project Draft ISMND Public Review Period April 16, 2021- May 20, 2021 Comment Letter #Commenter Date Received 1 Margo Frank May 3, 2021 2 Crispin B. Hollinshead May 6, 2021 3 Ulla Brunnberg Rand May 12, 2021 4 Allie Duggan May 13, 2021 5 Western Hills Fire Safe Council May 14, 2021 6 Chris Watt May 18, 2021 7 Jeanne Wetzel Chinn May 19, 2021 8 Andrea Vachon May 19, 2021 9 Michael Maynard May 19, 2021 10 Sharron Thomas (sent via email from Emily Thomas)May 19, 2021 11 Andrea Davis May 20, 2021 12 Margo Frank May 20, 2021 13 Heather Seggel May 20, 2021 14 Thomas Hunt (via email from Chris Watt)May 20, 2021 15 Steve and Jean Lincoln May 20, 2021 16 North Coast Regional Water Quality Control Board May 20, 2021 17 John and Delynne Rogers May 20, 2021 18 Pinky Kushner May 20, 2021 19 Mendocino County Local Agency Formation Commission (LAFCo)May 20, 2021 20 Helen Sizemore May 20, 2021 Page 593 of 800 From:Margo Frank To:Michelle Irace Subject:Commenting on draft for Western hills open land Date:Monday, May 3, 2021 7:17:20 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Hi Michelle, I read the lengthy and detailed draft of the initial study for the Western Hills development. We moved to Gardens Ave last fall after living at the top of Deerwood in the Eastern hills of the Ukiah Valley. While living there we were very aware of the danger of living in a high fire zone and having only one road for egress. It seems to me that this proposed Western Hills development would create a similarly dangerous situation. Many people I know who now live on the far western edge of Ukiah, up against the hills, are very concerned about fire risk. I don’t understand how development on those hills makes any sense! Thank you, Margo Frank 180 Gardens Ave. Ukiah Comment Letter 1 Page 594 of 800 From:Crispin B. Hollinshead To:Michelle Irace Subject:comments of proposed Western Hills annexation Date:Thursday, May 6, 2021 12:23:36 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Members of the Planning Commission, My name is Crispin B. Hollinshead. I am a neighborhood representative on the Western Hills FireSafe Council, and the proposed Western Hills annexation was a topic of discussion at our recent meeting. California is now headed into another drought, and the fire seasons over the last few years keep exceeding previous records. The proposed annexation includes 7 parcels for residential development, allowing up to 14 new homes. Emerging fire safe understanding suggests this kind of Wildland Urban Interface development is bad public policy, very risky for the potential home owners, and expensive for the community trying to protect that property. Historic fires in the area burned down to the valley floor as far a Todd Grove Park in the 1950’s. There is no reason to believe that the projected development wouldn’t be completely destroyed by such fires happening in the future. The projected development is to the west of the recently completed Shaded Fuel Break, putting it in the expected sacrifice zone. The single road access will be a problem in a fire emergency, and will likely violate emerging CalFire regulations. I urge you to take a serious look at the fire hazard being created, and revise the plans. Sincerely, Crispin B. Hollinshead 960m Dominican Way Ukiah, CA 95482 Gratitude, Love, and Global Awakening May All Beings Awaken From The Illusion Of Separation May You Awaken With This Breath Comment Letter 2 Page 595 of 800 From:Ulla Brunnberg Rand To:Michelle Irace Subject:Comments of proposed Western Hills annexation Date:Wednesday, May 12, 2021 2:08:58 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Members of the Planning Commission, My name is Ulla Brunnberg Rand. I am a neighborhood representative on the Western Hills Fire Safe Council, and the proposed Western Hills annexation was a topic of discussion at our recent meeting. California is now headed into another drought, and the fire seasons over the last few years keep exceeding previous records. The proposed annexation includes 7 parcels for residential development, allowing up to 14 new homes. Emerging fire safe understanding suggests this kind of Wildland Urban Interface development is bad public policy, very risky for the potential homeowners, and expensive for the community trying to protect that property. Historic fires in the area, one of them started by boys playing with matches, burned down to the valley floor as far as Todd Grove Park in the 1950’s. There is no reason to believe that the projected development would not be completely destroyed by such fires happening in the future. The projected development is to the west of the recently completed Shaded Fuel Break, putting it in the expected sacrifice zone. The single road access will be a problem in a fire emergency. It will likely violate emerging CalFire regulations. I urge you to take a serious look at the fire hazard being created. Please revise the plans to only allow one dwelling per parcel and possibly less parcels. In addition, please consider, allowing this Western Hill Development can become a precedent for future developments in the WUI area. I do not want to see any more developments in the hills. I am concerned that having more people living in high fire prone zones creates more possibilities for accidental fires and could potentially endanger the entire Ukiah Valley. Sincerely, Ulla Brunnberg Rand 109 Giorno Ave. Ukiah, CA 95482 Comment Letter 3 Page 596 of 800 1 Michelle Irace From:Allie Duggan <allie@studio4forty.com> Sent:Thursday, May 13, 2021 9:52 AM To:Michelle Irace Subject:Ukiah Western Hills Open Land Acquisition [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. I am writing to express my strong opposition to the development of homes on the Ukiah Western Hills Open Land Acquisition. This development would be detrimental to the area, nearly all residents in on Redwood Avenue are completely opposed to the development of homes that will cause traffic on a road not equipped for any more than it already sees, safety problems, and destroy local wildlife habitat. Additionally, I was under the impression that this land was originally donated for fire mitigation and recreation, not development. Traffic and safety of children on the street are major areas of concern. We don’t need any more cars and trucks going up and down this tiny street and we did not sign up for months of construction equipment going up and down the street on a daily basis. Most of the time with cars parked on the street it is a one lane road and not equipped to handle the high traffic this will cause. Wildlife has been observed in the area, and any development will destroy their habitat. Any planned development of the property should consider the continuing impact to local wildlife habitat which should be investigated by the appropriate agency prior to approving development. Among the impacts stated on the notice we got, wildfire is my, and should be the cities main concern. We do not need any more catalysts that could potentially cause a wildfire in this are, especially a high risk zone like the proposed land. This land was originally acquired for fire mitigation so this is completely going against what the land was originally donated for. Quoted from a news article from January 15, 2021 "the local government hopes to use the land to create and maintain fuel breaks to protect the city from fire, for conservation, and for recreation.” Link Absolutely no mention of development, so it is extremely discouraging to know that has been added to the plan now. I was disappointed that this project started on April 16, 2021 and the homeowners on Redwood Avenue, who would be majorly impacted, were given printed notice of it on May 13, 2021, nearly a month after this process has started. That is completely inconsiderate to all of us on this street who will have to deal with the issues that development will cause. I urge you to disapprove the proposed development, and from recent meetings and discussions with my neighbors, I know my opinions are shared by many who have not managed to write letters and emails. Thank you for your continued service and support of our communities. Best regards, ALLIE DUGGAN | CREATIVE DIRECTOR 916.539.9395 | allie@studio4forty.com | studio4forty.com Comment Letter 4 Page 597 of 800 2 Page 598 of 800 To the Ukiah Planning Commission and City Council Members: The Western Hills Fire Safe Council (WHFSC) is a FSC project under The Mendocino County Fire Safe Council (MCFSC), a 501.C3 organization. WHFSC has eighteen neighborhood sub-groups in and along the Western Hills that actively work on fire preparedness, prevention, emergency measures, and environmental protections. The ISMND states that Mr. Hull generously donated 188.57 acres (ISMND, Figure 2, parcel 10) to the City in December 2020. On December 11, 2020, there was an article in the Ukiah Daily Journal by Justine Frederiksen praising the gift from Mr. Hull. There was no mention of the annexation and acquisition of 693 acres (ISMND, p.2) or 740 acres (ISMND, p.4, para 2) or 640 acres (ISMND, p.4, para 6) (“Hull Properties”) when she interviewed City Manager Sangiacomo. On April 16, 2021, Notice of Intent was sent to a few Redwood Avenue and San Jacinta Drive property owners, and the scope of the project goes well beyond a land donation. The improvements Mr. Hull has made to his property go back at least to 2015 (ISMND, page 3, #3-Background – road improvements were made throughout 2015-2017 and the road extended further west in 2018). Changes included widening, improving, and extending the westward access road, vegetation management on proposed construction sites, and preparation of the water tank site. These improvements were followed by the December 2020, 188.57 acre land donation, followed by the current proposed annexation and acquisition agreement. The majority of the property is zoned PF, public facilities. It possible to change this zoning designation in the future to R1-H zoning (single family residential), should there be interest in further development. Clearly, the property was being prepared years ahead for development, as documented in the ISMND. Is it possible to change the zoning on the inside conservation PF zoned parcels (ISMND map p.13) to a Conservation Easement in perpetuity along with the outside conservation parcels for a Ukiah Wildlife Sanctuary? Regarding the proposed water tank, in the ISMND, page 8, it is stated, “…the City desires to add new water storage and fire protection facilities in the Western Hills.” What are the plans for the new water storage tank besides fire protection measures? Who will be responsible for maintaining the 150,000 gallon tank, pump, and well that supports the water tank? Is the water in this tank dedicated for fire department use or also for use of potential domestic purposes for the buildout? Will there be hydrants on the city water main extending up from Redwood Avenue? Neil Davis’ responses to WHFSC questions to Mr. Sangiacomo regarding the Hull Properties Limited Development Agreement included a question on water resources. Mr. Davis stated, “…this project provides sourcewater protection and will benefit the entire Ukiah Valley by protecting the sourcewater and ensuring that it reaches its maximum potential.” How does Mr. Davis define “sourcewater protection?” Historical wildland fires in the Western Hills includes the substantial 1945 Hayworth Fire that took out all the vegetation. The Fire Department came to the edge of development and set backfires that halted the fires. The Strong Mountain Fire occurred in 1950, and another scare Comment Letter 5 Page 599 of 800 about a decade ago was from 150 lightening fires to the west that didn’t result in fire in the Western Hills. The proposed buildout area is in the CalFIRE designated Highest Fire Severity Zone, as well as in a Wildland-Urban-Interface (WUI) area. It would be prudent to keep this landscape free of human habitation for the safety of citizens and to not further overburden our fire resources. “One of the first and most important considerations is how the location itself influences exposure to wildfire and potential for future losses of life and property.” (Moritz, Max, Butsic, Van, Building to Coexist with Fire: Community Risk Reduction Measures for New Development in California. UC ANR Publication 8680, April 2020, page 8) The potential development parcels buildout of 14 units (ISMND, p.7, para 3) are west of the fire break thus defeating the purpose of the Shaded Fuel Break for wildfire protection measures. Can the residential development of the 54 easternmost acres be taken out of the Development Agreement, or are they inextricably linked to acquiring the conservation lands? Will the lower elevation properties also west of the shaded fuel break that remain in Mr. Hull’s possession be considered for future buildout? Thank you for your attention to these matters. We look forward to your responses. The Western Hills Fire Safe Council Chair, Jeanne Wetzel Chinn, M.S. 395 San Jacinta Drive, Ukiah JeanneChinn@gmail.com Page 600 of 800 From:Christopher Watt To:Michelle Irace Subject:Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Date:Tuesday, May 18, 2021 11:25:40 AM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Hi Michelle - here are my comments/questions on the IS/MND. Please include in the record and provide responses. 1. Does the annexation require a tax-sharing agreement with the County of Mendocino? If so, what actions have been taken by the City to secure an access agreement? 2.Have the parcels proposed for development to be pre-zoned as Residential with Hillside Overlay been sized consistently with the Hillside Development Standards? If not, the parcels should be sized in accordance with the Hillside Development Standards and Subject to the Use Permitting Process and the Hillside Development Standards. 3.In 1991, the California Geological Survey prepared a report titled Landslide and Engineering Geology of the Western Ukiah Area, Central Mendocino County, California, Landslide Hazard Identification Map No. 24. Was this map consulted to determine the potential presence of landslide hazards with the parcels proposed for development and the access roads to the development? This report should be consulted and included as a reference in the IS/MND. 4. The California Building Code requires a Preliminary Soils Report for any subdivision of land. This project seeks to create parcels for development by lot line adjustment thus avoiding the requirements for subdivisions; however, given the known landslide hazards within the Western Hills as documented in the 1991 CGS Report, it seems imprudent to not perform a preliminary soils report to determine if the parcels proposed for development have soils or landslide hazards which would preclude development or at a minimum severely limit the development potential. 5. The Geology and Soils section of the IS/MND should also reference the requirement in the California Building Code to submit a Geotechnical Report for each lot. 6. The Wildfire section of the IS/MND indicates that fuel breaks are developed in the project area. However, fuel breaks requirement ongoing maintenance. The IS/MND does not describe how the fuel breaks will be maintained. Also does, the Ukiah Valley Fire District have capacity to defend the proposed development areas against wildfire given the Extremely High Fire Risk for the lands adjacent to the proposed development area? Why not subject these parcels to Wildland Urban Interface requirements? Perhaps include a benefit zone to pay for vegetation management and fire protection which is quite different from the urban parcels of the City. Sincerely, Chris Watt Comment Letter 6 Page 601 of 800 690 Mendocino Drive, Ukiah Page 602 of 800 From:Jeanne Chinn To:Michelle Irace Subject:Comments on proposed Western Hills Annexation Date:Wednesday, May 19, 2021 1:36:38 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. To Ukiah's Planning Commission: I applaud David Hull for donating 188 acres of wildlands to the City of Ukiah. I don’t take issue with transferring several of his individual parcels to be annexed to the City of Ukiah. However, there are concerns regarding how the additional acreage is planning to be utilized: 296ac for Conservation Lands on the most western area, 343ac for Recreational (zoned PF-Public Facilities) Lands in an odd shaped “C” pattern, and 54ac as Development Parcels (zoned R1-H) on the northeastern corner, as shown and stated in the ISMND map legend on p.13. Who owns the 5 parcels between the “C” Recreational Lands, and what are the plans for these parcels? The role of land use planning in communities with very high and high fire severity zones is to create wildfire resilience for protection of the community. CalFIRE has already supported this in calling out Ukiah’s Western Hills as one of their 35 top projects in 2017. That alone tells us these Western Hills are fragile and at risk. CalFIRE’s follow-through was exemplary in dozering the ridge tops and working with the County/City to re-establish and extend the Shaded Fuel Break from Low Gap Road to Robinson Creek Road. The Western Hills is in a Wildland-Urban-Interface (WUI) area. Given the recent uptick in wildfires and drought years, to be further exacerbated by climate change into the future, it is counter-intuitive to plan a buildout of [up to 14] any more homes in the WUI/highest fire severity zone. Further, this buildout would be west of the Shaded Fuel Break, creating additional risk and expense to fire fighting resources and potentially life-threatening to the residents. These homes would be exclusive and a gated community. I’m not opposed to gated communities, and the City is also working on additional low and moderate income housing. However, in this case it is the Ukiah community whose tax dollars would pay for undergrounding plumbing and utility lines up to this area for the benefit of a few in a higher income category. And, who would pay for the maintenance of the 150,000 gal. water storage and fire facilities tank, pump, and well? It would be more appropriate to plan this gated community in a non-WUI area with a lower fire hazard zone rating where wild lands are not being developed. In 2005, the Mendocino County Fire Safe Council (MCFSC) co-sponsored a report, the Mendocino County Wildfire Protection Plan. On page 86 in reference to the western hills of Ukiah, the report states the following: “These hills have experienced large-scale fires since the turn of the century, with major fires occurring in 1950 and 1959. The City of Ukiah’s encroachment into these hills since then has created the significant probability of a very destructive wildland interface fire.” (https://firesafemendocino.org/wp-content/uploads/2015/02/CWPP-FINAL.pdf) Comment Letter 7 Page 603 of 800 At the most recent Paths, Open Space, and Creeks Commission (POSC) meeting, we were told there will be no infrastructure on the recreation lands, including no public bathroom facilities or parking areas for potential hikers & bikers. Who would be responsible for patrolling those areas to pick up cigarette butts and other trash, and keep transients from establishing camps? As a Commissioner for POSC, I support protection of open space for wildlife. There is documented wildlife in the Western Hills that City Manager Sangiacomo mentioned at a POSC meeting over a year ago from footage taken on wildlife cameras. These wildlife include a mountain lion and her cub, bobcat, bear, fox, occasional coyote, many deer, and smaller mammals. In addition, Doolan Creek is a Class I watercourse that has steelhead trout and frogs, and there are Class II and Class III watercourses that likely have other aquatic species. These different wildlife species have overlapping territories and need landscape level space for their survival. I would like to see the Conservation and Recreational Lands be annexed together and retained as “Ukiah’s Wildlife Sanctuary” and conserved in perpetuity. That would be a feather in the cap for Ukiah and our wildlife! Rather than further fragmenting the lands with hiking trails and e-bike paths, the accompanying noise, and recreation lands that can in the future be rezoned for housing, let’s protect this area for nesting, denning, fawning, and a place for wildlife. Sincerely, Jeanne Wetzel Chinn, M.S. Commissioner, POSC Page 604 of 800 May 19, 2021 TO: Michelle Irace, Planning Manager, City of Ukiah Community Development Department and Ukiah City Council Members RE: UKIAH WESTERN HILLS OPEN LAND ACQUISITION AND LIMITED DEVELOPMENT AGREEMENT PROJECT Here are comments and questions regarding the Draft Initial Study and Mitigated Negative Declaration (ISMND). Traffic on Redwood Avenue This is a quiet cul-de-sac of approx. 20 properties. • Additional traffic from fourteen (14) more residences would significantly negatively affect the quality of life of existing residents. • Additional volume of traffic due to a 300+ acre Public Facility (park) accessible to the public according to Division 1, Chapter 12 of Ukiah City Code (see ISMND p. 42) would severely impact existing residents' quality of life. https://www.codepublishing.com/CA/ Ukiah/#!/Ukiah01/Ukiah0112.html • In what circumstances are secondary access roads required by the Fire Code? Is a secondary access road available or planned for the proposed housing development? Parking If a Public Facility is established on the 343-acre Inside Conservation Parcels, where are its users expected to park their motor vehicles? Utilities Numerous statements in the ISMND suggest uncertainty that housing will be developed on the 54 acres (examples below). In view of this uncertainty, why is the City proposing to pay for extension of utilities to the site? And should this not be the future developer's responsibility? "The Project does not propose any residential development at this time..." (p7) "...sites would not be developed until an applicant submits a project site plan..." (p7) "However, no purchasers have been identified, and the timing of the sale and development of the properties is unknown." (p7) "It is unknown whether all of the single family homes, and ADUs in particular, would be developed..." (p12) Protected Open Space If the City is going to preserve the Outside Parcels via a Council resolution (ISMND pp 5, 42-43), why not include the Inside Parcels also? This would effectively create valuable local wildlife habitat, and perhaps allow limited public access seasonally or by permit. (As an avid hiker and mountain bicyclist, I welcome new opportunities for recreation, but do not think this project is an appropriate location for a large public park.) Wildfire Risk Section V 11 of the ISMND (particularly p 43) discusses how the 14 housing units would constitute a portion of the City's Regional Housing Needs Allocation (RHNA). It is my understanding that the development site lies to the west (i.e., the "wrong side") of the shaded fuel break, as well as being in a zone of highest fire risk. How can this be considered a wise location for new housing? Thank you for your attention. Sincerely, Andrea Vachon 537 Redwood Ave. Ukiah, CA 95482 avachon1@mindspring.com Comment Letter 8 Page 605 of 800 Ukiah City Planning Commission 300 Seminary Drive Ukiah CA 95482 5/18/2021 Subject: Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Honorable Members, From November 2010 to December 2020, I was the CAL FIRE Battalion Chief for the Ukiah Valley area. During this period, I was responsible for the fuel reduction efforts in State Responsibility Area of the Ukiah Valley and surrounding areas. I write to support the Ukiah Western Hills Open Land Acquisition and Limited Development Agreement and hope to provide some history and context to the fuel reduction efforts in the western hills of Ukiah and how it relates to this project. Beginning in 2012 I began working with representatives from the City of Ukiah and private owners to discuss, plan and reduce the fire hazard and improve public safety in the Ukiah Valley. The westside was chosen for several reasons. There was no recent fire history, and little had been done to address the fuel loading. Access was limited with more residents in the wildland-urban-interface at risk. The western hills were nearly inaccessible to firefighting resources. In the subsequent eight years we planned, funded and completed multiple projects that were too big for any one individual to complete on their own and met the standard of ‘good for the community’. Through these projects multiple access routes have been developed for firefighting vehicles to use during a fire, landing zones constructed for helicopters to land, 435 acres of prescribed burn were completed, twelve miles of fire breaks constructed in 2015 and again in 2018. Nine miles of shaded fuel breaks were cut from Low Gap to Highway 253 continuing the work completed in 2002 and 2004. These accomplishments were the result of three levels of government; City, County and State, dropping boundaries and jurisdictions, working in concert on a singular goal to reduce the risk of a catastrophic fire that have become all too frequent in the State. The fourth critical component that made it all possible was the property owners that allowed the work to be completed for the good of the community. The common denominator was the conclusion that vegetation fires were now a Ukiah community problem, not an individual problem, that put the entire community at risk. Among the nearly one hundred properties that participated, one of the most critical properties is the “Hull Properties”. From a firefighter perspective, they are kind of a key in middle that holds the three elements of the prevention work together- fire breaks, fuel breaks and prescribed burning. The Hull Properties provide access to the top of the western hill of Ukiah for fire resources that did not exist prior to 2018. This property is one of the few bisecting fire breaks, natural or man-made, on the western side of Ukiah. The roads and fire breaks are the foundation for future prescribed burns that reduce the fuel loading on the hills that have not burned since the late sixties. Comment Letter 9 Page 606 of 800 All the work done since 2002 needs to be maintained and the work continue. I believe that the best way to maintain the roads, continue fuel reduction projects and reduce the risk of a catastrophic fire in Ukiah Valley, to have the City of Ukiah acquire the Hull Properties. The consolidation of the parcels under City guidance will allow for a single entity to manage the fuel reduction work, manage the watershed and reduce risk to the community. It is my opinion that the proposed mid-slope development of the parcels would not add any additional risk to the community and may even reduce risk. There are many narrow, steep streets on the west side of Ukiah that present far greater risk due to development without wildland fires in mind. This development would benefit from the knowledge and experience in the current fire environment. Developed parcels are more likely to be maintained versus being converted to open space and dependent on the CAL FIRE funding and time to maintain. A homeowner would have a vested interest to maintain the property to a defensible space standard. Any improved road surfaces in the development would provide a permanent fire break and development of a water system could be critical to fire extinguishment on the west side of Ukiah. This development could be a model for the future that combines modern pre-fire planning with rural development at the landscape level expanding the current shaded fuel break. There will be challenges and new responsibilities with annexation and I would hope the City would adopt road and clearance standards like PRC 4290 and 4291 for any development off the valley floor. The City would become the stewards for a large portion of the western hills and would be challenged to manage it appropriately. Based on my interaction with the City of Ukiah over the years and the community attention and concern, I believe the City is up to the task and I appreciate a new, local approach. We must think outside the box find new ways to engage at all levels to change the trend of the fires. It is critical that the work to reduce the risk of a catastrophic fire continue to be a top community priority and worked on at the community level, not at the individual parcel or owner level. It is not realistic to expect individual owners to maintain what has been done. The City acquiring the Hull Properties will keep the western hills fuel reduction a viable community level project and will provide the best chance of continued success. Thank you for your time and please do not hesitate if you have any question. Michael Maynard Page 607 of 800 Page 608 of 800 From:EMILY THOMAS To:Kristine Lawler; Michelle Irace Subject:Proposed Western Hills Annexation and Development Date:Wednesday, May 19, 2021 1:46:24 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Subject: comments of proposed Western Hills annexation Date: May 19, 2021 TO:  Members of the Planning Commission & City Council Members My name is Sharron Thomas. I am a neighborhood representative on the Western Hills FireSafe Council, and the proposed Western Hills annexation was a topic of discussion at our recent meeting. California is now headed into another drought, and the fire seasons over the last few years keep exceeding previous records. The proposed annexation includes 7 parcels for residential development, allowing up to 14 new homes. Emerging fire safe understanding suggests this kind of Wildland Urban Interface development is bad public policy, very risky for the potential home owners, and expensive for the community trying to protect that property. Historic fires in the area burned down to the valley floor as far as Todd Grove Park in the 1950’s. There is no reason to believe that the projected development wouldn’t be completely destroyed by such fires happening in the future. The projected development is to the west of the recently completed Shaded Fuel Break, putting it in the expected sacrifice zone. The single road access will be a problem in a fire emergency, and will likely violate emerging CalFire regulations. Turnouts are unlikely to mitigate congestion for fleeing residents in such an emergency. I urge you to take a serious look at the fire hazard being created, and revise the plans. Sincerely, Comment Letter 10 Page 609 of 800 Sharron Thomas Page 610 of 800 May 20, 2021 Dear Ms. Irace and members of the City of Ukiah Planning and Building Department, I am writing to express my concerns and questions regarding the Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Project. I have been a resident of Redwood Avenue for 11 years. During the last 4 years, I have seen many changes to our neighborhood. The road that extends from the end of Redwood Avenue (first graded in 1960 per the draft study) should never have been constructed. It is overly steep, approaching slopes of 30% for much of its length. I realize that much of what has occurred up to this point in time was under Mendocino County’s jurisdiction and we are now stuck with their poor planning. When I first saw this road, it was overgrown with vegetation, much of it native grasses, shrubs and forbs. The road bed was stable due to the vegetation that prevented erosion. When the new property owners started grading the road, there was significant erosion, sometimes resulting in mud running down Redwood Avenue and often resulting in significant mud on the road tracked by vehicle tires. The topography in this area prevents road widening or contouring to decrease the steepness of the road bed. It also prevents best practices in disconnecting the hydrology from road to creeks. Redwood Avenue is in a small canyon that traps dust and smoke. There have been several times that I’ve looked outside, or have been returning home, and thought that the canyon was on fire only to realize that dust was thick in the air from travel on the dirt road. Burning in the lower canyon likewise results in smoke trapped between the ridges and there have been winter days when I’m sure our air quality and the ash floating in the air was as bad as some of our worst summer wildfire days. Any plans should acknowledge this aspect of the topography. What will be the regulations for burning on the lower elevations of annexed properties? What will be done to enforce speed limits to decrease dust? The study indicates that with development, the first ½ mile of the road would be paved, but I’m not sure how much activity will continue on the road before that would happen. Steep topography increases the noise from vehicles traveling up the road. Noise is likely amplified by the encompassing ridges, but I think it is mostly the result of the low gearing needed to go up the steep hill. Trucks are often loud enough to wake us up at night. I am not sure how this can be mitigated. Traffic on narrow, short Redwood Avenue is already surprisingly heavy. I am disappointed to see plans that will cause an increase. When I first moved here, children commonly played on the street and it felt safe for them to do so. The CEQA study indicates that the increased costs of providing fire and police coverage will be covered by development fees. I wonder about the logistics of the coverage when this will essentially be a locked gate community located on a very steep, very narrow road? I don’t think we have a precedent for this in Ukiah? Included in the Energy and Green House Gas Emission discussions in the study should be the consideration that the development will encourage vehicle fuel consumption due to the location of the housing. I disagree with the statement in the study that “The assumed low-density development pattern is consistent and contributes to the rural ‘small town’ character of the Ukiah Valley.” Comment Letter 11 Page 611 of 800 I encourage the City to complete the botanical studies as planned. The study states that at least one more site visit was recommended. I recommend that this be completed before CEQA is finalized. That may mean waiting another year as many plants bloomed early this year and have already withered. There are year-round springs adjacent to the road and I have heard that there are others in the area. We have found giant pacific salamanders on our property that must be residents of the springs. I don’t think the salamanders are a protected species but they are very unusual in the Ukiah Valley. I have found native snails that I think are also unusual, if not protected, and I wonder what other species might be residents of these springs? I hope the biological surveys included the areas around the creek drainage. I worry about enforcement of some of the practices recommended in the report. In the last few years, I have seen trees removed during nesting periods without nesting surveys and wildlife corridors fenced; 2 practices that the study states will be prohibited. The unnamed creek drainage that runs along Redwood Avenue should be treated as a wildlife corridor and a seasonal creek. The springs along the creek are an important water source for wildlife. I have this drainage affected by sediment flows from improper grading, poor culvert placement, bright lights, tree removal in the creek corridor, and recently, fencing of the creek, prohibiting wildlife passage. I am concerned that these trends will continue if there is not educated oversight. Some of this has been on county land and some within the city limits. I believe this project has many desirable aspects if implemented as planned, primarily in protecting the views of western hills as well as protecting open space and watersheds. I recommend that information about the project be presented in a form that will be easier for the public to understand, with pros and cons transparently written out. I sincerely believe that if development is inevitable, it will be better managed by the City of Ukiah than the County of Mendocino while at the same time believing that the area is unsuitable for road building and development and that the county should never have allowed it to proceed. Thank you for your consideration, Andrea Davis 607 Redwood Ave Ukiah, CA 95482 Page 612 of 800 From:Kristine Lawler To:Michelle Irace; Maya Simerson Cc:Craig Schlatter Subject:FW: Western Hill Development Date:Thursday, May 20, 2021 11:22:14 AM From: Margo Frank <margo@margofrank.com>  Sent: Thursday, May 20, 2021 11:04 AM To: Kristine Lawler <klawler@cityofukiah.com> Subject: Fwd: Western Hill Development Begin forwarded message: From: Margo Frank <margo@margofrank.com> Subject: Western Hill Development Date: May 20, 2021 at 8:48:36 AM PDT To: lauraem@sbcglobal.net Cc: mshilliker@comcast.net, roody@pacific.net Dear Ukiah Planning Commission Members, I am at a loss to understand how the Ukiah Planning Department could even consider building homes with only one egress/access route in the Western Hills at this time. We know that this area is at high risk of fire devastation. Having homes in a gated community in heavily wooded hill land seems incredibly short-sighted. As the planet warms and droughts in the West become the norm, we will all be at risk. When the City builds housing in vulnerable areas with only one way out, we mislead home purchasers, implying they will be safe. I also do not understand why this development would be a gated community, one that shouts “We are special, we need protection from the rest of Ukiah”. Please do not approve this development. If I am correct that the current landowner is demanding this development in order to create/donate the nature conservancy. parkland in the Western Hills then we are all being held hostage by him. I urge you to look at the bigger picture, to consult with local fire chiefs before seriously considering approval of this project. Thank you for serving on the Planning Commission. Margo Frank 180 Gardens Ave. Ukiah, CA. 463-1834 Comment Letter 12 Page 613 of 800 From:Kristine Lawler To:Michelle Irace Subject:FW: cc-ing you my note to the planning commission Date:Thursday, May 20, 2021 11:46:30 AM From: Heather Seggel <heatherlseggel@gmail.com>  Sent: Thursday, May 20, 2021 11:26 AM To: Kristine Lawler <klawler@cityofukiah.com> Subject: cc-ing you my note to the planning commission Ms. Lawler, I should have copied you on this at the time, but here it is, for inclusion in the public record of comments. Thanks very much, Sincerely, Heather Seggel From: Heather Seggel <heatherlseggel@gmail.com> Date: 5/20/21 6:36 AM (GMT-08:00) To: lauraem@sbcglobal.net, mshilliker@comcast.net, roody@pacific.net Subject: western hills development Dear members of the planning commission, I'm writing to voice my concern about a planned development in the western hills of Ukiah. While I know the need for housing is dire, I have also lived through more stress and peril than I ever thought possible due to the wildfires that have ravaged our county. The location of this development seems like a double-whammy of negatives-- it's beyond the reach of our fire breaks and in the path of potential fires, which means resources that can be used to save more populated areas will have to choose what to prioritize in the very literal heat of the moment. Let's create housing in areas that are easier to protect, and let the land rest where and whenever we can. Thanks for your consideration, Heather Seggel 306A W. Church St Ukiah CA 95482 707-467-9067 Comment Letter 13 Page 614 of 800 From:Christopher Watt To:Michelle Irace Subject:Fwd: Western Hills Open Space / Land Development Agreement Date:Thursday, May 20, 2021 12:36:50 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Michelle - see below. Another comment for you. -Chris Sent from my iPhone. Forgive the brevity, typos and lack of nuance. Begin forwarded message: From: Thomas Hunt <thomashuntpe@gmail.com> Date: May 19, 2021 at 9:11:50 AM PDT To: mirace@cityofukiah.org Subject: Western Hills Open Space / Land Development Agreement  Michelle- Here are some additional comments prepared as a local resident in the vicinity of this project: 1.The proposed IS/MND appear to not comply with  the criteria for lot line adjustments is that each qualifying parcel of a lot line adjustment must have a recorded certificate of compliance that the lot is a viable conforming lot, and was created prior to the Subdivision Map Act of in compliance with the Subdivision Map Act.  To qualify for a Certificate of Compliance the existing parcel has to comply with Map Act and local development ordinances. The reconfiguration of parcels using the lot line adjustment method becomes a violation of the Subdivision Map Act if greater than Four parcel reconfigurations (LLA) are performed.  A development of this nature should be required to prepare a tentative subdivision map, preliminary engineering of the access road, lot layout in conformance with the hillside slope ordnance, and provide a slope analysis study in conformance with the Hillside ordinance using accurate topographic mapping.  If the proposed project is to be approved a final subdivision map would be required per the California Subdivision Map Act and improvements would be in conformance with subdivision standards. 2.The proposed IS/MND appears to lack an analysis of the geologic slope stability Comment Letter 14 Page 615 of 800 effects of a new road that meets Fire Safety Road Standards for width and turning radius, turnouts, and turnarounds on the existing hillside slopes.  If the Road is to be private how is it to be maintained, or would the City except the roadway for public use and maintenance. 3.The proposed IS/MND does not address whether the existing City Utilities provide adequate sewer and water capacity for the proposed homes.  The  IS does not identify “Who” would own and maintain the water storage tank and booster pump(s) stations to serve the development, or what fire agency will protect these homes. 4.The proposed IS/MND does not address the following issues: The clearing limits of the Fire Safety zone around the homes, it is typically recommended by CalFire to clear a 100 foot radius, that is approximately a minimum of 1.2 acre per home.  The proposed homes sites, plus roads, would clear over 10 acres of the last remaining unimprovement scenic hillside area left surrounding the Ukiah valley, and convert the scenic view of the native trees into homes and roads. This same area burned approximately 60 years ago in a wildfire and will continue to be a hazardous area even if developed. Allowing this development regardless of the fire safe clearing requirements around these proposed buildings would be unsafe for future residences, including the existing residences at the toe of the hillside, and irresponsible of a public agency to allow.  Once you build homes in this area it will become increasing more difficult to control fuel loads because of the potential danger to the homes.   The potential increase in the drainage runoff and erosion impacts of converting 10 plus acres of vegetated watershed into roof tops, driveways, roads and areas of cleared vegetation is not considered in the IS as any increase in runoff will end up in Mendocino creek drainage and the Redwood Avenue.   The impact on these drainages may be significant to require the repair of failing culverts particular on Mendocino Creek at Mendocino Drive,  the capacity of the Redwood Creek downstream drainage structures should analyzed as most of this drainage has be placed in culverts east of Helen Avenue. Thank you for considering these issues. Sincerely, Thomas Hunt 420 Cochrane Ave Ukiah Ca 95482 Email: thomashuntpe@gmail.com Cell: 707-499-0152 Page 616 of 800 From:Steve & Jean Lincoln To:Michelle Irace Subject:opposition to more residences high in Ukiah"s western hills Date:Thursday, May 20, 2021 2:10:23 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. To: Ukiah City Planning Commission We wish to express our strong oppostion to the proposed residential property parcels on the Hull property in the western foothills. It is our very great concern that it is simply too dangerous to build more residences in this area which is ripe for burning - especially as we experience an increase in the length of wildfire season with increased temperatures and reduced soil and vegetation moisture. We live at the base of these hills and, every day, see the tremedous fuel load that has accumulated on them since the last wildfires there in the 1950's. Not only would these new homes be in a very vunerable position with the shaded fuel break downhill from them, but, during a wildfire, they will take a large amount of firefighing efforts at a time when the higher density of homes downhill will probably also need much firefighting effort. We trust you to make the wisest decision for Ukiah. Thank you for your consideration, Steve and Jean Lincoln 104 North Highland Ave, Ukiah Comment Letter 15 Page 617 of 800 From:Iantosca, Catherine M.@Waterboards To:Michelle Irace Cc:Filak, Jordan@Waterboards Subject:Regional Water Board Comments: City of Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Date:Thursday, May 20, 2021 2:53:38 PM [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Dear Michelle Irace, Thank you for providing staff of the North Coast Regional Water Quality Control Board (Regional Water Board) the opportunity to comment on the Draft Initial Study/Mitigated Negative Declaration (IS/MND) for the Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project, SCH #2021040428. We offer the following comments based on our review of the IS/MND. Our comments are focused on the planned infrastructure improvements and construction components of the proposed project, including plans to pave/improve existing roadways, construct new roads for access to the development parcels, extend underground utilities, and construct a City water tank, and how these activities might impact waters of the state. California Water Code defines waters of the state as “any surface water or groundwater, including saline waters, within the boundaries of the state” (Water Code §13050 (e)). Projects that adversely impact waters of the state require permits from the Regional Water Board in the form of 401 Water Quality Certifications or Waste Discharge Requirements. Regarding waters of the state in the IS/MND study area, the IS/MND’s Biological Resources section contains information that conflicts with Attachment B, the Biological Assessment Report. IS/MND Biological Resources Discussion Section b-c (IS/MND page 25) says “no sensitive biological communities, including riparian habitat or wetlands, were observed within or immediately adjacent to the study area.” However, the Biological Assessment Report (Assessment) identified six watercourses in the study area and did not definitively determine the presence or absence of wetlands in the study area. With regard to wetlands, Assessment Section 3.4.2 Sensitive Biological Communities – Aquatic Resources states that a wetland delineation has not been performed in the study area (Assessment page 8). Instead, the Assessment referenced the United States Fish and Wildlife Service National Wetlands Inventory (NWI), which does not provide sufficient detail to determine the presence or absence of wetlands on at a property-specific level. The Assessment states that any wet areas onsite (which the Assessment defines as areas with hydrophytic vegetation and/or other hydrologic indicators) should be given the same protections as wetlands “until a wetland delineation is conducted to confirm the presence and extent of wetlands” (Assessment page 8). Please note that these hydrologic indicators are often difficult to identify during the summer and fall, particularly during a drought year. If the City of Ukiah determines that wetlands are present in the study area and that wetlands will be impacted by the project, a permit from the Regional Water Board will be required. With regard to streams and riparian habitat, Assessment Section 5.1.2 Sensitive Biological Communities – Sensitive Aquatic Resources states that six watercourses were observed and mapped in the study area (Assessment page 16). These watercourses are depicted in the Assessment on a map titled “MCV2 Classification Map.” These watercourses are considered waters of the state. The MCV2 Classification Map shows existing roads crossing several of the watercourses. The IS/MND states that the existing gravel access road will be paved to serve the future development sites, and new access roads may be constructed. Work within watercourses or in their riparian areas, e.g. installation of new culverts or replacement of existing culverts during road improvement/construction, requires permits from the Regional Water Board. If other construction activities, such as utility installation or water tank construction, will impact waters of the state, those activities will require permits too. Comment Letter 16 Page 618 of 800 If you determine that the proposed project will impact waters of the state, please contact the Regional Water Board prior to starting work to obtain the required permits. Impacts to waters of the state should be avoided or minimized as much as possible, and any unavoidable impacts will require compensatory mitigation. More information about the Regional Water Board’s permitting can be found on our website: https://www.waterboards.ca.gov/northcoast/water_issues/programs/water_quality_certification/. Thank you. Please contact me if you have any questions. Catherine Iantosca Environmental Scientist Southern 401 Water Quality Certification Unit North Coast Regional Water Quality Control Board 5550 Skylane Blvd, Ste. A Santa Rosa, CA 95403 P: (707) 576-2501 E: catherine.iantosca@waterboards.ca.gov Page 619 of 800 City of Ukiah Community Development Department May 20, 2021 ATTN: Michelle Irace 300 Seminary Avenue Ukiah, CA 95482 Subject: Initial Study and Mitigated Negative Declaration for Western Hills Open Land Acquisition and Limited Development Agreement Project Dear Ms. Irace, We are very concerned about potential fire impacts from the proposed land development project in the western hills of Ukiah. The City of Ukiah would annex and acquire land for open space preservation in exchange for allowing the developer to develop seven residential parcels with the potential for two houses per parcel or 14 total houses. While the project has fire protection benefits (open space preservation), the potential for residential development raises serious fire safety concerns in the western hills of Ukiah. The project area is in a very high fire hazard severity zone. With an increased frequency of drought conditions and impacts from climate change, the probability of a major wildland fire increases in the western hills of Ukiah. In 2005, the Mendocino County Fire Chiefs’ Association, including the California Department of Forestry and Fire Protection (now Cal Fire) published a report, the Mendocino County Wildfire Protection Plan. On page 86 in reference to the western hills of Ukiah, the report states the following: “These hills have experienced large-scale fires since the turn of the century, with major fires occurring in 1950 and 1959. The City of Ukiah’s encroachment into these hills since then has created the significant probability of a very destructive wildland interface fire.” The parcels currently lie outside the city limits and city utilities are not available – power, sewer, water. Once annexed, the parcels will have access to city utilities with the ability for new development to connect to those utilities, increasing the likelihood for future residential development in the western hills. We live at the end of San Jacinta Drive and adjoin one of the parcels in the project. We are in close proximity to the project and with the increased number of wildland fires in northern California over the last several years, we are very concerned about the increased potential of a wildland fire in our area. We urge you to take a serious look at the potential fire hazard created by the proposed project and the potential for future development beyond the current project. Sincerely, John and Delynne Rogers, Members of the Western Hills Fire Safe Council Comment Letter 17 Page 620 of 800 Comments on the ISMND May 20, 2021 Submitted by Pinky Kushner 504 N. Oak St., Apt #1 Ukiah, CA I thank you for allowing me to comment on the environmental assessment document for the Western Hills project. 1. For the portion of the Conservation Parcels located outside of the SOI (“Outside Conservation Parcels,” consisting of approximately 296 acres), the City will ensure that they remain preserved as open space through City Council resolution or other means, rather than prezoning them PF. Proposed Parcels 8 and 10 would effectively be “split zoned”; the portion within theSOI would be prezoned PF, while the remaining portion outside of the SOI would not be prezoned, but subject to a conservation easement, or other City Council action prohibiting development and preserving it as open space. The language in the underlined section is weak and/or unclear. The land “will be subject to …easement or other City Council action.” The document should specify that this land will be dedicated open space in perpetuity by the City. By saying it ‘could be’ put into a conservation easement implies that the ownership of the property will not be the City and could be a private party. Thus the city might not be gaining the proposed proposed promise of open space with approx. 640 acres, only approx 340 acres. 2. “City-owned parcels proposed for annexation are not required to be located within the City's SOI. City-owned parcels can be located anywhere in the County as long as they are less than 300 acres, owned by the City, and used for municipal purposes at the time of the annexation application.” It is not clear how this project satisfies any of those limitations. In fact it seems clear that none of the provisions are satisfied. The property that is proposed to be designated PF, will not be for municipal purposes in the ordinary legal meaning of the word “municipal.” In order to be designated as ‘municipal’, the City should assign the area, the entire 640 acres, as a protected natural area in perpetuity. The proposed designation of PF could be changed by the current or any future City Council. 3. Leapfrog development: The City should demand a codicil to the private road access that will require that a keyed entrance gate be built on the road at the entry to the developed (housing) area and also at the distal end of the developed (housing) area. Furthermore, no third party, other than the owners of the developed housing and the City, can be given rights to trespass those two gates. Comment Letter 18 Page 621 of 800 Without such a codicil, it is obvious that this proposed development will be able to leapfrog further development into the County property that lies further to the west along the roadway. These further lying parcels are designated County lands, and any development/construction will not be subject to City of Ukiah’s reviews and will be without City limitations (as mentioned in the neg dec in the argument for the present annexation). It is egregious that the potential for leapfrogged development is not even mentioned in the ‘neg dec.’ 4. Aesthetics: The view shed of the City of Ukiah is unique and beautiful. Ukiah, derived from native language meaning ‘deep valley,’ indeeds lies in a narrow deep trough, approximately 2 miles wide and 20 miles long. Standing in the flat mid-point, one sees these 20 miles of wooded hillsides on either side. This project will affect this view in a deleterious manner, removing native vegetation, adding roads, lights and paved areas, in the south-western hills, in addition to a large 30’ high water tank. This project for up to 14 dwellings, presumably large imposing houses with large, turn-around driveways, and lights, will be a significant blow to Ukiah’s unique view shed. The potential damage is not “less than significant.” Moreover, painting a house ‘earth-tones’ is not adequate mitigation for forest removal. 5. Forestry Resources: According to the ISMND the project should evaluate “forest carbon measurement methodology provided in Forest Protocols adopted by the California Air Resources Board.” No data have been provided. CO2 levels continue to increase in the Ukiah Valley. The removal of forests will add to the carbon increases. This effect cannot be said to be less than significant unless carbon measurements are established. In order to ‘neg dec’ the project, current, pre-project baseline data must be measured. The heat effect of forest removal must be evaluated. 6. Air Quality: The removal of forest and the on-going and continuing increase in carbon may contribute significantly to the atmospheric inversions that occur routinely in the Ukiah Valley. This issue cannot be said to be less than significant unless data about the Valley’s atmospheric inversions are calculated. No data are found in the ‘neg dec.’ 7. Biological Assessment: This report is inadequate and cannot be said to evaluate the biological features of the project. At the beginning of the document prepared for the assessment, Jacoobzooms and Associates state, “A site visit was conducted on February 5, 2021. A botanical survey was conducted on March 30, 2021. Additional botanical survey results will be amended in once completed.” This statement is clear— the biological assessment at the present is inadequate to support the neg. dec. Interspersed in the document, the authors admit that they did not evaluate the plants and animals sufficiently. For example, birds of interest may be nesting, but not during February; plants of interest may appear but not be observable on March 30. And so on. The neg dec is incomplete since the biological assessment has not been completed. I believe the assessment only reviewed the 55 acres for housing development. Am I wrong? What about the rest of the acreage in the annexation project? The large acreage, described as 640 acres at one point but not consistently, has not been Page 622 of 800 surveyed. Yet the project will allow (some might say promote) the roadway to access not only the area proposed for development, but also the further Western Hills. This is not a mere city lot with only traffic and noise to worry about on a small acreage. The acreage of the project is almost as large as Golden Gate Park in San Francisco and deserves a thorough biological assessment done in various seasons of the year for the entire project area. 8. Fire: It appears that a portion of the area proposed for housing lies beyond a fire- break. How is it justified to propose development beyond the fire-break? Relative to this project are the following questions for a neg dec analysis: What is the potential for a firestorm in the Western Hills? What is the history of firestorms in the Western Hills? What is the state of drought in the Ukiah Valley? Has this drought increased the fire potential in the Western Hills? Does the proposed development, occurring in a naturally wooded area increase, decrease or have no effect on the potential for fires? On the potential for a fire storm? What is the moisture content of the soil annually in the summer and fall months? Will the roadway increase or decrease the moisture content of the surrounds? What will be the speed of the fire’s path were there to be a Western Hills fire originating in the project area? 9. Feasibility: What is the likelihood of any home development in a fire-prone acreage in the Western Hills? Will there be fire insurance for the developers/new home-owners? How will this development project be different from the homes in Deerwood that cannot get fire insurance? 10. Location and site plan: The maps are inadequate and not well integrated into the context of the document. There are no topographical maps. This is in spite of the fact that the site has very steep slopes. The slopes should be described precisely with the various grades of the roadway and possible driveways included. For fire management and the water tank accessibility these data are very important in an environmental assessment. The maps should have better satellite over-lays, with more indications of where the roadway and driveways will be located, complete with fire vehicle turn- arounds, etc. The photos included in the biological assessments are described only as “to the south” or “to the west”, with no indication as to geographical or topographical whereabouts. 11. Land Use Planning: The goal of the City of Ukiah is densification, not suburban sprawl. This project is suburban sprawl. What is the mitigation? What is the justification? Page 623 of 800 12. Alternatives: an EIR is required to have alternatives, including a no project alternative and other alternatives that achieve the same or equal provisions. a. Housing: Recently, the Ukiah Planning Department sponsored a public review of housing possibilities within the current boundaries of the City of Ukiah. Where are the results of that review in this environmental evaluation and why don’t the areas identified satisfy the needs for housing/development, even at all ends of the housing market? The Western Hills proposed project is clearly for the high end market. What is the need for high end housing in a fire prone area when those needs can be met within the existing boundaries of the City where the infrastructure improvements exist with good roads, good sidewalks, bike paths, trees, and parks? b. Water: The water tank is said to help with supplying water to the southwestern portion of the City. Alternative sites for the water tank must be identified, sites that are more accessible to more developed areas of south Ukiah and to a larger population of residents. The proposed site must be evaluated for efficiency and sufficiency in providing water to the urban population and for its use should a fire in south Ukiah occur, relative to other sites closer to the already built-out urban area. Page 624 of 800 MENDOCINO Local Agency Formation Commission Ukiah Valley Conference Center | 200 South School Street | Ukiah, California 95482 Telephone: (707) 463-4470 | E-mail: eo@mendolafco.org | Web: http://mendolafco.org May 20, 2021 Michelle Irace Planning Manager, City of Ukiah 300 Seminary Avenue Ukiah, CA 95482 RE: Responsible Agency Comments regarding the City of Ukiah Draft Initial Study and Mitigated Negative Declaration for Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Project Dear Ms. Irace, We have reviewed the Draft Initial Study and Mitigated Negative Declaration for the Ukiah Western Hills Open Land Acquisition and Limited Development Agreement Project and identified the following items as a Responsible Agency related to the annexation component of the proposed project. Further Growth Inducing Analysis for Annexation Component In order to fully address the annexation component of the proposed project, the Initial Study needs to further analyze the change in development potential of the annexation area from current conditions. This involves identifying and comparing the maximum development potential under current conditions (County General Plan/Zoning and Ukiah Valley Sanitation District service) and the proposed project development potential (Boundary Line Adjustment, City General Plan/Prezoning, and City services). The proposed project development potential of 7 Single-Family Dwelling Units and 7 Accessory Dwelling Units identified for the Development Parcels appears appropriate based on the Development Agreement, and may result in an overall reduction of environmental impacts or environmental benefits from the clustered development design, when compared with the current conditions. Since there is no development anticipated for the Noguera properties, the development potential of these parcels would be the maximum development potential under both current conditions (County General Plan/Zoning and Ukiah Valley Sanitation District service) and the proposed project (City General Plan/Prezoning and City services). The comparison of current and proposed development potential for the Conservation Parcels may result in an overall reduction of environmental impacts or environmental benefits from long-term conservation and associated natural resource and land management activities. Further Municipal Service Analysis for Annexation Component In order to fully address the annexation component of the proposed project, the Initial Study needs to further analyze the provision of municipal services. This involves a comparison of current system capacity, anticipated service demand of the proposed project based on development potential, and the City’s ability to serve the proposed project based on Comment Letter 19 Page 625 of 800 available capacity and project demand. While not necessarily applicable to the proposed project, in situations where service expansions or improvements are needed to address the proposed project, the potential environmental impacts of such expansion and/or improvements should also be analyzed. Prezoning The Outside Conservation Parcels are subject to Prezoning pursuant to GOV §56375(a)(7) and should be addressed in the Initial Study. Concurrent Detachment Please modify the proposed project to include detachment of the annexation area from the Ukiah Valley Sanitation District, to address jurisdictional overlap and duplication of municipal service issues, and potentially County Service Area 3 if duplication of municipal services is applicable. Based on interest expressed from City of Ukiah staff in support of a proposed Ukiah Valley Fire District annexation of City Limits, per LAFCo Pre-application No. P-2020-03, concurrent detachment from the Ukiah Valley Fire District does not appear appropriate at this time. By addressing the above items in the Initial Study, the Mendocino Local Agency Formation Commission will be able to rely on the City’s CEQA Determination in consideration of the annexation proposal. Please note that we are available to assist in modifying the Initial Study to address these items. Please feel free to contact me if you need additional information or have any questions. Sincerely, Uma Hinman Executive Officer Cc: Craig Schlatter, City of Ukiah Community Development Director Page 626 of 800 From:Kristine Lawler To:Michelle Irace; Maya Simerson Subject:FW: ISMND and proposed project Date:Friday, May 21, 2021 7:44:27 AM From: Helen Sizemore <helensize@gmail.com>  Sent: Thursday, May 20, 2021 9:55 PM To: Kristine Lawler <klawler@cityofukiah.com> Cc: Laura Christensen <lauraem@sbcglobal.net>; Mark Hilliker <mshilliker@comcast.net>; roody@pacific.net Subject: ISMND and proposed project [EXTERNAL EMAIL] DO NOT CLICK links or attachments unless you recognize the sender and know the content is safe. Kristine - please forward to City Council Members. TY To the Planning Commission and the City Council: I am very concerned to hear about the development of a small gated development in the western hills, at Redwood Avenue. There is a housing shortage in California and in Ukiah. It would be so much more appropriate to construct condominium housing. Your future vision must consider our climate changing, drought emergency prone times. Continuing the economic and cultural division in our town is not vision it is backward thinking. A gift of land to the city does not have to be given back to the wealthy. The clustering of a condo project would be more easily defended from fire threat and be less damaging to the hillside when putting in utilities. Ukiah can be the change we need. Single family housing is so last century. Thank you, Helen Sizemore Comment Letter 20 Page 627 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Margo Frank ‐‐‐‐‐Original Message‐‐‐‐‐  From: Margo Frank <margo@margofrank.com>   Sent: Tuesday, September 14, 2021 7:42 PM  To: Meeting <meeting@cityofukiah.com>  Subject: Agenda item #11    Dear City Council,      I am writing to express my concerns, once again, about the proposed Western Hills development. In this time of  increasing fire risk everywhere in the West, approving housing in a high risk location is not only foolish but also  dangerous.    We can no longer look to the past as a model of how to do development. We are in a new era, and it is imperative that  the City of Ukiah recognize this and plan accordingly.    As we saw on Sunday with the Hopkins Fire, a blaze can take off quickly and hillsides covered with trees (which help us  sequester carbon) can burn swiftly, destroying high end homes.    I was only able to attend part of the recent Planning Commission meeting and wasn’t able to figure out how to make a  comment or unmute myself to speak. It would be helpful in the future if this was clearly explained at the beginning of all  your meetings and the beginning of public comment times. Your meeting platform works very differently than the Zoom  setup I am very familiar with.    I did hear Mr. Hull state that if the City doesn’t approve this then he will go to the County for approval. I doubt that the  County would approve this development as they are very aware of fire risk.    I urge you not to approve this project. We cannot be held hostage by a developer, putting future homeowners in a risky  situation, unable to obtain fire insurance and blaming poor planning for the disaster that lies ahead.    Thank you,  Margo Frank  180 Gardens Ave.    Page 628 of 800 From: Vishnu <vishnuvishnu@sbcglobal.net>    Sent: Tuesday, September 14, 2021 4:43 PM  To: Meeting <meeting@cityofukiah.com>  Subject: Agenda Item 11.a ~~ Eminent Domain alternative  Dear City of Ukiah Council Members, Even if the counterproductive “Ukiah Western Hills Open Land Acquisition Project” were not before you tonight, the only realistic approach to controlling the western hills, for the fire safety of Ukiah’s residents is via the city of Ukiah’s right of Eminent Domain. Instead of a complicated plan that would provide Ukiah some limited amount of protective land, while at the same time introducing a Faustian bargain that could only increase fire possibility, there is a much simpler and more comprehensive way to protect Ukiah from the threat of a fire in the western hills. I would like to propose an alternate plan. Please allow me to explain: It was gratifying to read, in discussing reasons for going ahead with the annexations of the Hull properties, that city personnel were expressing how Ukiah would be safer, owning and controlling what would be the several hundred newly acquired acres. Unfortunately however, this line of thinking is much too limited in scope to be useful for real fire protection. The point I wish to make is that Ukiah IS at severe fire risk from the dense forest and chaparral covering those rugged western hills at the city’s very threshold. Recognizing this threat, which faces all Ukiah residents today, in 2021, and which will continue to face Ukiahans EVERY foreseeable year into the far, far future, it is incumbent upon the city to take complete control of as much of the western hills as may be required to afford its citizens reasonable security. The only practical way to accomplish this, as far as I can see, is for the City Council to asses what acreage will be needed for the virtual elimination of a fire threat from the west, and then to immediately, via eminent domain, acquire all necessary parcels. At that point the city will have control of a quite large, partially forested, area of trees and chaparral. It will then need to carefully clear that area while fencing it and establishing grasses, probably both native bunch grasses and good fodder grasses that can support the ruminant animals that will maintain the vegetation on the property. If the property can be simultaneously utilized for hiking and other recreational activities all the better, but the bottom line there will be assuring that the sheep & goats & llamas, etc. can thrive, while they protect the valley. At its discretion the city could develop an Animal Husbandry Dept. (to complement its Airport, Electric Utility, etc., Depts.) or perhaps simply sub-contract the care of the herds to local farm entities. Thank you for your time and attention to this proposal. Let’s all keep well and safe, Vishnu Addendum: Without study, I have no idea how much land will actually need to be acquired via eminent domain. My own semi-educated guess, would be approximately 1/2 to 3/4 of a mile in the east / west direction, starting above the neighborhoods, as along Helen Ave. and Mendocino Drive. From north to south I am imagining the required land would start at Low Gap Rd. and extend as far south as Oak Knoll Rd., or close to there. The land will need to be purchased but, as steep, undeveloped hillside land, I think the amount would be affordable and a very wise expenditure. (Also, my own thought would be not to acquire anyone’s already built and lived in home, only properties undeveloped as of September 2021.) Page 629 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Daphne Macneil From: Daphne Macneil <daphnemacneil@yahoo.com>   Sent: Tuesday, September 14, 2021 8:28 PM  To: Meeting <meeting@cityofukiah.com>  Subject: RE: Item #11 Western Hills annexation    I am very concerned that gravely inadequate mitigations were accepted by the City Planning Commission and pressing  issues of  wildfire, hydrology and soil erosion/stream pollution are not addressed in a serious manner.     I urge the Council to push for more meaningful 21st century climate conscious requirements be put on this project.    Thank you,  Daphne Macneil   817 N Oak St  Ukiah      Sent from Yahoo Mail for iPad  Page 630 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Jeanne Chinn ‐‐‐‐‐Original Message‐‐‐‐‐  From: Jeanne Chinn <jeannechinn@gmail.com>   Sent: Tuesday, September 14, 2021 9:22 PM  To: Meeting <meeting@cityofukiah.com>  Subject: City Comment re Council Meeting 9/15, Item #11 on Agenda ‐     Comment on Agenda Item #11, Western Hills Hull Development    Please be informed that I'm against the above‐named project that calls for buildout in the Western Hills in the highest  fire severity zone, nor am I for recreational trails up there in the highest fire severity zone and on steep slopes. I would  support the City doing an extensive effort (Make a call out to the entire community ‐ there must be some philanthropists  who would care) to come up with grants/funding to purchase the lands for preservation of habitat and wildlife. The  General Plan calls for preservation of the Western Hills ‐ let’s stick to that.    Should Mr. Hull want to gift Ukiah with the lands, and the lands are maintained as Ukiah’s Wildlife/Wildlands Sanctuary  that would be a feather in our cap and Kudos to Mr. Hull.    Thank you for your consideration,  Jeanne Wetzel Chinn  395 San Jacinta Drive  Ukiah resident  Page 631 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Bonnie Tillotson From: Bonnie Tillotson <jonnibean@me.com>   Sent: Wednesday, September 15, 2021 1:45 PM  To: Meeting <meeting@cityofukiah.com>  Subject: City Comment re Council Meeting 9/15, Item #11 on Agenda    Comment on Agenda Item #11, Western Hills Hull Development  I am extremely concerned about the proposed Western Hills development. Considering the recent fires throughout the  state this year, and our recent "Hopkins Fire”, any development in the woodlands interface areas that are designated  extreme risks strikes me as imprudent. Perhaps, at a future time when we have effectively reduced the intense fuel  loads that surround our communities, considering developments in these areas might be possible, but that is not our  current reality.  I am also concerned that the mitigations in the plan that were accepted by the City Planning Commission are  inadequate, especially statements of "little to no significant impact". I do not believe that the commission addressed  these issues and concerns with any true and serious concern. I was disappointed with their blatant and casual dismissal  of previous concerns.    I believe that the City Council should not act to approve this project that will put our community at greater risk during  this time of numerous climate and social changes.       Thank you,  Bonnie Tillotson         Page 632 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Eileen Mitro ‐‐‐‐‐Original Message‐‐‐‐‐  From: Eileen Mitro <eileenm234@gmail.com>   Sent: Wednesday, September 15, 2021 1:48 PM  To: Meeting <meeting@cityofukiah.com>  Subject: Agenda Item 11 concern about Western Hills Project    City Council Members:    While I do not live in the City of Ukiah I do depend heavily on the goods and services the City provides and make it a  practice to buy locally, i.e. in Ukiah.  I live in an area that has had frequent fires this year and am in constant worry about  the threat of fire.  The Western Hills Project is of great concern because it is just such a project that could take the whole  City of Ukiah with it if any fire starts there through lightning, arson, carelessness, even barbecues and lawnmowers.  It  seems to me that many of us are still functioning as though our weather patterns are the same as they were even a  decade ago, but that is not the case.  All decisions must be made with a different frame of reference now that we are in  danger of fire similar to what happened to Paradise two years ago.  Please keep in mind that your decision tonight could  affect the heathy future of Ukiah even in the near term.  Developing land in those hills just invites seriously dangerous  conditions.    Eileen Mitro  707 234 0380  Page 633 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Sharon Kiichli From: kiichli@pacific.net <kiichli@pacific.net>   Sent: Wednesday, September 15, 2021 1:46 PM  To: Meeting <meeting@cityofukiah.com>  Subject: Agenda Item 11 ‐ Vote NO    Deny the approval of the Western Hills Development.   Hello. I am a long time resident of Ukiah, residing on the west side of Ukiah for more than 50 years.  I am writing to urge you to vote No on the proposed Western Hills Development.   There are so many obvious problems with this development that it is quite amazing to me that the Planning Commission  sent it forward to the Council for consideration.  The first and most obvious issues are related to our current drought and the fire hazards of this development, during the  construction process and in the area once the homes are occupied. This is a high‐risk fire area immediately adjacent to a  densely developed area of the community.  Obviously, given the current severe drought conditions, we are living in a  tinder box. Any fire that might be started during the development process or once the homes are occupied would  obviously spread quickly into the residential and commercial areas of Ukiah.  Why would the City take such a risk? To  line the pockets of the developer?  That is what it appears to be happening.  Associated with the risk of fire is the issue of whether the new properties could even be insured for fire. Many residents  whose home currently sit at the bottom of those hills are already struggling with potential cancellations.  I could add a long list of additional environmental concerns associated with this development, as well as concerns that  the proposed “mitigations” are grossly inadequate, but for now I will limit my comments to the FIRE risks. Look what just  happened East of Calpella—do you want to be responsible for risking that level of loss in central Ukiah?     Please act responsibly and do not approve this project.  Sharon Kiichli  1103 West Perkins Street  Ukiah    Page 634 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Sharron Thomas From: SHARRON THOMAS <sharron_thomas@sbcglobal.net> Sent: Wednesday, September 15, 2021 4:53 PM To: Meeting <meeting@cityofukiah.com> Subject: Agenda # 11 on tonight's meeting Dear City Council, I'm writing to express my opinion regarding the proposed Western Hills development. I am opposed to the creation of the private lots for home development. Our community is keenly aware of the fire risks fueled by climate change. We see mounting evidence every year all around us. To continually allow new development in areas interfacing with wild and heavily wooded areas seems inherently foolish to me. It is doubly foolish when the access is limited. One way in and out, may have been acceptable at one time, but that time has long passed with increasing fire threats. Additionally, while I am aware that Ukiah proper is not experiencing water shortages at the present time, we also also know that many neighboring communities are. In fact, we're currently trucking water from Ukiah to our coastal neighbors. I have no problem with that. That's what we do to help one another survive! However, we, like most of California, are in the midst of a multi-year drought. We don't know how we'll be affected if this drought persists, or how much we'll be called upon to help with our neighboring communities drought issues. Scientists agree that fire and droughts are likely to increase in California, fueled by climate change. Are those increasing threats being taken into consideration when you talk of mitigating "negative effects"? I don't think they can be adequately mitigated in that location. Please take another look at current scientific evidence regarding our changing future threats of wildfire and drought effec ts on our community. Thank you, Sharron Thomas 146 Giorno Ave Ukiah CA Page 635 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Ulla Brunnberg Rand From: Ulla Brunnberg Rand <ulla@pacific.net> Sent: Wednesday, September 15, 2021 5:00 PM To: Meeting <meeting@cityofukiah.com> Subject: Western Hills Development, agenda #11 Regarding today's meting 9/15/2021 Item #11 To the Elected Officials on the City Council, I repeat my concerns and my comments made to the Planning Commission regarding this issue: Increasing human activity in the high fire severity zone of the Western Hills is a really bad idea. Development or access to trails into the hills above the "shaded fuel break" will increase fire danger and potentially threaten the Ukiah Valley. Human activities in the hills will disturb wildlife and nature. We are now experience climate change, with an increasingly dry landscape exacerbated by on-going drought conditions, water shortages (yes, we will feel it even in Ukiah at some point) and longer fire seasons. Today 96% of CA fires are human caused. Fires starting from power lines, car sparks, cigarettes, lawn mowers, electrical equipment and thoughtless actions have caused nearly all contemporary wildfires in California. When development metastasizes into fire prone communities and landscapes, the probability of a large fire dramatically increases. Building new developments in high fire-risk areas increases these ignitions, thereby placing more people and the environment in great danger. Planning for a future with less resources, reducing the fuel loads in the hills and protecting wildlife should be the primary driver of policy in high fire severity zones, and not the short-term financial interests of residential developers. Please vote no on this item! I recall a sincere concern for nature and wildlife and a robust opposition to development in the western hills back in 2000 when Hull/Phiffero was first to be granted a go to develop high up in the Western Hills. Many restrictions where put on the building project to appear less intrusive from the valley floor. As I understand, back then, limitations was put on the amount of acreage approved for sale by owner. But 20 years have gone by and memory fades. New people occupy leadership posts and a certain virus prevents people to take an active roll in local politics. Seems to me this development is metastasizing into our hills without opposition and robust debate. Sincerely, Ulla Brunnberg Rand 109 Giorno Ave. Page 636 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Katherine McElwee From: Katherine McElwee <kmcelwee@pacific.net> Sent: Wednesday, September 15, 2021 5:36 PM To: Meeting <meeting@cityofukiah.com> Subject: Western Hills Development, agenda #11 Expansion of the Western Hills is a horrible idea. We are in a drought, there are water shortages and the fire season is longer and longer. Adding more homes is dangerous. The Western hills are already at danger of a large out of control fire. To quote a friend of mine “When development metastasizes into fire prone communities and landscapes, the probability of a large fire dramatically increases. Building new developments in high fire-risk areas increases these ignitions, thereby placing more people and the environment in great danger. Planning for a f uture with fewer resources, reducing the fuel loads in the hills and protecting wildlife should be the primary driver of policy in high fire severity zones, and not the short-term financial interests of residential developers.” Please vote no on this item! Katherine McElwee 1144 West Church Street Ukiah CA 95482 Page 637 of 800 1 Kristine Lawler Subject:11a Correspondence Received - Catherin Lair From: calsll2005 <calsll2005@comcast.net> Sent: Wednesday, September 15, 2021 5:14 PM To: Meeting <meeting@cityofukiah.com> Subject: Western Hills Project item #11 To the council, Who is paying for the roads, utilities and water infrastructure, that will be going to 14 high end houses? If the land was given to City of Ukiah...is this part of the deal? A way for citizens/taxpayers to pay, for the exspensive infrastructure for only 14 houses? When Janix drive was put in, it was without permits. But the land owners paid, for the costs. It was a big deal when it happened. Is this a way to get permits, and utilities etc ..for free...by donating land? Is water even available or will it be taken out of ground....disturbing Gibson Creek....a salmon spawning creek fed by springs? Shouldn't taxpayers have fire abatement in creek area and western hills houses, already in red and orange zones, be helped with protecting homes and Ukiah Valley as first defences, against a fire intruding into town completely? Why is it the burden of just some homeowners, to protect whole town? Taxpayer money should be spent on fire abatement, of already existing houses, on parameters of valley. Not on 14 new homes, roads, utilities and infrastructure engineer fees, if that's what the city, will be doing. After this last week, how fast a fire travels. How can the city, even think about putting homes, in that drought devastated hill area?? Those homes would be surrounded by fuels. And if you clear land, water run off comes down hill. Down roads. To where? I don't quite understand how this donation of land, turned into housing development for private development? Can someone explain this? And if the land is Ukiahians property, now. Just because it's on the way to 52 acres of someone elses idea/land...does not mean we are obligated to develope it. Does it? Catherine Lair Sent from my U.S.Cellular© Smartphone Page 638 of 800 City Council September 15, 2021 Craig Schlatter, Director Michelle Irace, Planning Manager Maya Simerson, Project Administrator  City of Ukiah Community Development Department  Ukiah Western Hills Open Land Acquisition & Limited Development Agreement Project and Initial Study/Mitigated Negative Declaration Page 639 of 800 2 PROJECT LOCATION Page 640 of 800 PLANNING COMMISSION   May 31, 2017 | 3 PROJECT SITE AND HISTORY Existing access road Existing “house site” on proposed Development Parcel Existing water tank pad siteOpen space Page 641 of 800 4 PROJECT COMPONENTS 1)Acquisition and annexation of the parcels;  2)Prezoning the parcels to “PF” Public Facilities, and “R1-H”  Single-family Residential-Hillside Overlay; 3)Sequential Lot Line Adjustments to reconfigure the  existing parcels into seven lots (“Development Parcels”)  for future potential development;  4)Development Agreement between Hull Properties and  the City allowing up to one single-family home and one  accessory dwelling unit on each Development Parcel (up  to 14 units total); and  5)Site improvements including extension of utilities, road  improvements, and construction of water storage tanks.  Page 642 of 800 AGENCY/DEPARTMENT REVIEW •City of Ukiah Public Works Department •City of Ukiah Police Department •City of Ukiah Electrical Utility Department •City of Ukiah Building Division •City of Ukiah Municipal Airport Operations  Manager •Ukiah Valley Fire Authority •California Department of Forestry and  •Fire Protection •Mendocino County Planning and Building •Mendocino Transit Authority •Mendocino County Local Agency  Formation Commission •California Department of Fish and Wildlife •U.S. Fish and Wildlife Service •Regional Water Quality Control Board •U.S. Army Corps of Engineers •Native American Heritage Commission •Local and California Native American  tribes •Sonoma State University Northwest  Information Center •Ukiah Valley Sanitation District •Willow Water District Page 643 of 800 ENVIRONMENTAL REVIEW •In accordance with the California Environmental Quality Act (CEQA) an  Initial Study & Mitigated Negative Declaration (ISMND) was prepared for  the Project. •ISMND circulated for public review and comment from April 16, 2021  through May 20, 2021. •Mitigation Measures associated with construction and ground disturbing  activities were identified for Air Quality, Biological Resources,  Cultural/Tribal Cultural Resources, Geology and Soils, Hazards and  Hazardous Materials, Hydrology and Water Quality, Noise, Utilities and  Service Systems, and Wildfire.  •All impacts would be reduced to a less than significant level with the  incorporation of Mitigation Measures. Page 644 of 800 STAFF RECOMMENDATIONS Staff recommends Council: 1)Adopt an Initial Study and Mitigated Negative Declaration (SCH  No.2021040428);  2)Conditionally Approve the Ukiah Western Hills Open Land  Acquisition & Limited Development Agreement Project; and  3)Introduce by Title Only an Ordinance to Prezone the Conservation  Parcels to “PF” Public Facilities and the Development Parcels to  “R1-H” Single Family Residential-Hillside Overlay District  Page 645 of 800 I move to make a motion to 1) adopt the Initial Study and Mitigated Negative  Declaration (SCH No. 2021040428) for the Ukiah Western Hills Open Land  Acquisition and Limited Development Project; and 2) conditionally approve the  Ukiah Western Hills Open Land Acquisition and Limited Development Project  including: acquisition and annexation of approximately 707 acres, prezoning, Lot  Line Adjustments, a Development Agreement between Hull Properties and the  City of Ukiah, and associated site improvements; and 3) introduce by Title Only an  Ordinance to Prezone the Conservation Parcels to “PF” Public Facilities and the  Development Parcels to “R1-H” Single Family Residential-Hillside Overlay District  SAMPLE MOTION Page 646 of 800 Page 647 of 800 10 EXISTING AND PROPOSED PARCEL CONFIGURATION Page 648 of 800 Page 649 of 800 Annexation Parcels, Proposed Lot Line Adjustments and Prezoning Assessor’s Parcel Number (APN) Existing Size (+/acres) Proposed Size (+/- acres) through Lot Line Adjustments Resulting Parcel Configuration, Intended Use and Proposed Prezoning 001-040-83 77.6 9.8 Parcel 1 will become a Development Parcel intended for single family housing  and prezoned R1-H. 157-070 01, 157-070- 02, 003-190-01 & 157- 050-09 148.2 5.1 Parcel 2 on Existing Conditions Tentative Map, contains several APNs but is  one legal parcel (149 acres total). This parcel will become a Development  Parcel intended for single-family housing and prezoned R1-H.  157-050-11 40.0 9.9 Parcel 3 will become a Development Parcel intended for single-family housing  and prezoned R1-H. 157-050-02 40.5 9.0 Parcel 4 will become a Development Parcel intended for single-family housing  and prezoned R1-H.  157-050-01 40.3 5.0 Parcel 5 will become a Development Parcel intended for single-family housing  and prezoned R1-H. 157-030-02 20.0 9.7 Parcel 6 will become a Development Parcel intended for single-family housing  and prezoned R1-H. 157-050-12 40.0 5.0 Parcel 7 will become a Development Parcel intended for single-family housing  and prezoned R1-H. 157-050-04 & 157- 060-02 38.7 391.5 Parcel 8 will become a Conservation Parcel and be prezoned PF. The  proposed water tanks will be placed on this parcel within the existing water tank  pad site (on existing Parcel 2).  157-030-03 60.0 60.0 Parcel 9 will become a Conservation Parcel and will be prezoned PF. 157-030-03 & 157- 060-03 188.5 188.5 Parcel 10 (City-owned “Donation Parcel”) will become a Conservation Parcel  and will be prezoned PF.  “Noguera Properties”  003-190-09 & 003-110-90     10.20 4.14     10.20 4.14 These parcels contain the existing access road that will be improved but remain  under private ownership. It will be included in the annexation proposal and  prezoned R1-H, consistent with surrounding zoning and land uses, but no  development is proposed; this parcel is not included in the Lot Line Adjustment. TOTAL +/- 707 acres Page 650 of 800 PUBLIC NOTICING The Notice of Intent to adopt the ISMND and conduct a public hearing was provided in the following  manner, in accordance with Ukiah City Code (UCC) §9267 and California Environmental Quality Act  (CEQA) Guidelines Section 15073: •Provided to property owners within 300 feet of the project parcels, as well as agencies and  departments with jurisdiction or interest over the project on April 16, 2021, June 1, 2021 and  August 13, 2021; •Provided to members of the public, agencies, and interested parties who submitted written  comments on the Draft ISMND during the public review period on August 13, 2021; •Published in the Ukiah Daily Journal on April 24, 2021, June 5, 2021 and August 14, 2021;    •Posted on the Project site on May 3, 2021, June 1, 2021, and August 11; •Posted at the Civic Center (glass case) 72 hours prior to the public hearing; •Noticed for continuance at the May 26, 2021 Planning Commission hearing to a date certain of  June 9, 2021; and •Notice for continuance at the June 9, 2021 Planning Commission to a date uncertain.  In addition, based on the amount of interest in the Project additional public noticing was conducted in  the following manner: •Posted on the City of Ukiah website on April 16, 2021 and August 16, 2021; •Emailed to Planning Commissioners and City Councilmembers on April 16, 2021 and August 13,  2021; •Hand-delivered to all residences (in addition to and beyond the 300-foot requirement) on  Redwood Avenue on May 13, 2021 and mailed to all residences on Redwood Avenue on August  11, 2021. Page 651 of 800 Page 1 of 2 Agenda Item No: 12.a. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2020-352 AGENDA SUMMARY REPORT SUBJECT: Receive Status Report and Consider Any Action or Direction Related to the Novel Coronavirus (COVID-19) Emergency Including Operational Preparedness and Response; Continuity of City Operations and Services; Community and Business Impacts; and Any Other Related Matters. DEPARTMENT: City Manager / Admin PREPARED BY: Tami Bartolomei, Office of Emergency Management Coordinator PRESENTER: Tami Bartolomei, Office of Emergency Management Coordinator ATTACHMENTS: None Summary: The City Council will receive a status report and consider any action or direction related to the Novel Coronavirus (COVID-19) Emergency including operational preparedness and response; continuity of City operations and services; community and business impacts; and any other related matters. Background: On March 4, 2020, California Governor Gavin Newsom declared a State of Emergency in California in response to the COVID-19 pandemic. The County of Mendocino declared a State of Emergency related to the COVID-19 on March 4, 2020. On March 17, 2020, the City Manager, acting as the Director of Emergency Services, declared the existence of a local emergency. On March 18, 2020, City Council approved a Resolution ratifying the proclamation declaring the existence of a local emergency. Since the onset of the emergency, the City of Ukiah has worked to respond to the public health and safety needs of the community in cooperation with the County of Mendocino and other partners. The local response for public health is lead regionally by the County of Mendocino and the County's Public Health Officer. In addition, the City of Ukiah has worked to maintain the continuity of public services including public safety, water, sewer, electric, airport, public works, and other essential activities. Discussion: As the coronavirus “COVID-19” continues to evolve, the City of Ukiah continues to monitor the situation and respond to emerging needs of the community. The City is in continued contact with local and state agencies, as well as community partners, hospitals, schools, and neighboring cities to ensure we have the most updated information pertaining to COVID-19 and are coordinating efforts. Reports and/or information from the City of Ukiah's Emergency Operation Center (EOC) may include, as necessary: * Emergency Operation Center (EOC) Status * COVID-19 Case Updates * Public Information Officer * Medical Services Page 652 of 800 Page 2 of 2 * School/Education * Public Safety (Police/Fire/EMS) * Shelter in Place Monitoring and Compliance * Community Service Groups * Homeless Response * Business Impacts/Services * Public Infrastructure/Construction Status * City Finance * Recovery Efforts and Planning * Other Related matters Staff will provide a status report to City Council and will seek direction or action on operational preparedness and response; continuity of City operations and services; community and business impacts; and any other related matters. Go to the City's website (www.cityofukiah.com) for direct access to information related to the Novel Coronavirus (COVID-19) emergency including local updates, City Services, Community/Resident Information, and Business Resources. Recommended Action: Receive status report and consider any action or direction related to the Novel Coronavirus (COVID-19) Emergency including operational preparedness and response; continuity of City operations and services; community and business impacts; and any other related matters. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Sage Sangiacomo, City Manager Page 653 of 800 Page 1 of 3 Agenda Item No: 12.b. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1033 AGENDA SUMMARY REPORT SUBJECT: Presentation of Findings to Improve the Efficiency and Productivity of the Paths, Open Space and Creeks Commission (POSCC) and the Parks, Recreation, and Golf Commission (PRGC); and Seeking Direction from Council Regarding the Reformation of the Commissions as a Single Public Spaces Commission. DEPARTMENT: Community Services PREPARED BY: Neil Davis, Community Services Director, Craig Schlatter, Community Development Director PRESENTER: Neil Davis, Community Services Director; Craig Schlatter, Community Development Director ATTACHMENTS: 1. PowerPoint Presentation Shown at Meeting Summary: Staff will present a report related to the Paths, Open Space and Creeks Commission (POSCC) and the Parks, Recreation, and Golf Commission (PRGC) and seek direction from Council regarding the reformation of the Commissions as a single Public Spaces Commission. Background: In late 2020, the Council directed Staff to create a new Diversity and Equity Commission with the understanding that other commissions might need to be merged or eliminated. In January of 2021, due to concerns related to workload created by staffing both the POSCC and PRGC, Staff requested and received direction from Council to “develop a recommendation, or alternatives, to merging the Paths, Open Space and Creeks Commission (POSCC) and Parks, Recreation, and Golf Commission (PRGC), including developing a new charter and name for the commission.” To complete the research and analysis directed by Council, Staff initiated conversations with Commissioners, reviewed meeting minutes and other historical documents, and completed a survey of current and former commissioners. The Discussion section that follows presents this research for Council's review and provides recommendations for Council consideration. Discussion: The City of Ukiah currently maintains 14 permanent commissions and boards, 31 special assignments, and nine ad hoc groups to provide research, gather public input, and provide policy and procedure recommendations to the City Council. Commissioners and board members of the 14 permanent commissions and boards are appointed by the City Council and hold public meetings in accordance with the Brown Act. Many of the boards and commissions have certain functions and responsibilities outlined in Ukiah City Code. Commissioners and board members may also respond to requests from the Council and/or the public as well as pursue interests they determine among themselves as requiring attention. Creation and Early History of the PRGC and POSCC The PRGC was created in 1999. Per the Ukiah City Code (UCC), the PRGC has the power and duty to recommend and advise on: policies to be adopted and enforced for the operation, use and management of all recreation activities and facilities, parks and parkways; policies for the planning of recreation and parks programs for the inhabitants of the city, promote and stimulate public interest therein, and to that end, solicit to the fullest extent possible the cooperation of school authorities and other public or private agencies interested therein; policies for the acquisition, development and improvement of parks, playgrounds and facilities for Page 654 of 800 Page 2 of 3 recreation. Although not codified, the PRGC has traditionally had one member who specifically represents the golfing community. The POSCC was created in 2003 due to an increased interest in the preservation of open space, the creation and maintenance of trails, and concern for the environmental state of the City’s creeks. Per the UCC, the POSCC has the power and duty to recommend and advise regarding: the efficient implementation of the open space and conservation element of the 1996 Ukiah general plan; the efficient implementation of the pathway sections of the transportation element of the 1996 Ukiah general plan, and the procedures and funding mechanisms for acquisition, preservation; effective stewardship of city paths, open space, and creeks. In the early 2000s, the POSCC and PRGC developed policies and provided input that proved to be significant contributions to the community. The POSCC was a leader in identifying the opportunity to build City View Trail and helped guide the City through the construction process. The POSCC conducted studies on creek health and created creek care guidance documents. The PRGC was useful in giving feedback to the City’s recreation team and an important resource as the City has transitioned through various management strategies with the Golf Course. Recent PRGC and POSCC History and Role Due to Brown Act requirements, coordination, posting of the agenda, updating the website, keeping minutes, etc. there is a cost to the City to maintain these advisory Commissions. Although there is a cost, the enhancement in higher quality work product and more responsive governmental services is, in Staff's opinion, a worthwhile investment for the City. However, when Commissions are not productive and/or do not assist in the development of higher quality work product, such as what has occurred in the last six to seven years, it is appropriate to re-analyze and investigate how effectiveness may be improved. Survey Results and Analysis At the direction of Council, Staff attempted to initiate discussions with the POSCC and PRGC on the potential benefits of a merger of the two groups, or other options that might improve efficiency and productivity of the commissioners and staff assigned to support them. However, after over three dozen emails attempting to convene a joint meeting, efforts were discontinued. Staff then conducted a review of POSCC and PRGC minutes and historical information, interviewed staff who have at various times worked in a support role to the commissions, and provided commissioners a survey to solicit their input on an evaluation of the Commissions’ work. These investigations and survey results revealed the following: 1) Vacancies on the commissions are chronic and absences are common. From January 2019 to June 2021 each Commission has had only two meetings with all five commissioners in attendance. 2) The average commissioner attendance for both groups is 3.5. There is a high staff to commissioner ratio at meetings: POSCC = 2.5 staff present to 3 commissioners in attendance; PRGC = 1.5 staff present to 3.7 commissioners in attendance. 3) The PRGC provides comment on staff activities but has not produced recommendations that require Council attention. Since January 2019 there have been no action items that required a vote of the commissioners and no reports or recommendations have been forwarded to Council. 4) POSCC has provided four opinion letters to Council in the last three years. Two of these were on issues with no technical input provided to council. 5) Staff typically prepares reports for at least one agenda item for each POSCC meeting. 6) Preparation of agendas, meeting minutes, and reports, along with website updates and communications with Commissioners take a minimum of 3-8 hours of staff time per meeting. A staff member recently spent 12 hours preparing one report for the POSCC meeting. 7) 75% of commissioners spend less than three hours of preparation for the monthly meetings, and half of those commissioners spend less than one hour per month preparing for meetings. Page 655 of 800 Page 3 of 3 8) Five of eight respondents disagreed with the statement: “This commission's work has led to substantive changes in city policies and procedures related to our mission.” 70% of commissioners disagreed with the statement: “The City Council has taken action on our commission's written recommendations.” In conclusion, the review suggests the commissions are duplicative, produce little substantive work product, and display a high rate of dissatisfaction with both staff and commissioners. Staff Recommendations Staff recommends Council direct the reforming of the two commissions into one "Public Spaces Commission." Staff would suggest Council consider appointing current commissioners to the new Commission, as well as encouraging commissioners to use ad hoc working groups to address specific areas of interest in collaboration with staff and/or Councilmembers. Staff also recommends Public Spaces Commission meetings be held four times a year- in February, April, July, and November- and that community forums be convened twice per year. Should Council approve the recommended actions, Staff will return at a future meeting with a proposed ordinance for introduction. Recommended Action: Receive report and approve staff initiation of processes to reform the Paths, Open Space and Creeks Commission (POSCC) and the Parks, Recreation into a combined Public Spaces Commission. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 656 of 800 Regarding the Reformation of the Paths, Open Space and Creeks Commission and Parks, Recreation, and Golf Commission as a Single “Public Spaces Commission.” Neil Davis – Director, Community Services Shannon Riley- Deputy City Manager Page 657 of 800 State of the Commissions 14 Permanent Commissions and Boards 31 Special Assignments 9 ad hocs All require some degree of staff support. Most operate under Brown Act requirements. Page 658 of 800 Addressing the Workload of Commissions Diversity and Equity Commission formed in late 2020 with understanding other commissions may need to be consolidated or removed. Paths, Open Space, and Creeks (POSCC) and Parks, Rec, and Golf (PRGC) identified as likely candidates for consolidation/reformation. Page 659 of 800 Comparing POSCC and PRGC Charters “to recommend and advise” 1) PRGC Key Words – “…for the operation, use and management of all recreation activities and facilities, parks and parkways,…” 1) POSCC Key Words - “…city paths, open space, and creeks.” 2) PRGC Key Words – “Policies for the planning of recreation and parks programs..” 2) POSCC Key Words – “…implementation of 1996 General Plan.” “pathway sections of the transportation element” Page 660 of 800 City Council Direction “…develop a recommendation…” In early 2021 City Council provided direction to staff: “to develop a recommendation, or alternatives, to merging the Paths, Open Space and Creeks Commission (POSCC) and Parks, Recreation, and Golf Commission (PRGC), including developing a new charter and name for the commission.” Page 661 of 800 Outreach to Commissioners Convening a group meeting Staff placed this item on the Agenda for each of the commissions. Agenda item was intended to introduce the topic and plan for a joint meeting for both commissions and staff to discuss options Joint meeting best for communication, relationship building, efficiency, and for Brown Act compliance. PRGC Commissioners expressed uniform opposition to a merger and shared a consensus they did not want to meet and discuss this. POSCC Commissioners expressed overall opposition to the idea but agreed to meeting. Staff was unable to find a mutually agreed upon time with a number of commissioners declining to participate. Page 662 of 800 Outreach to Commissioners Background research In place of the preferred group meeting: Staff created an online survey to solicit input. Twenty current and former commissioners for whom we had contact info were included. Staff reviewed two years of agendas: Agenda items Votes Action Items Reports or Comments provided to staff or City Council Page 663 of 800 Observations from review of POSC and PRGC activities Vacancies on the commissions are chronic and absences are common. From January 2019 to June 2021 each Commission has had only two meetings with all five commissioners in attendance. There is a high staff to commissioner ratio at meetings: POSCC = 2.5 staff present to 3 commissioners in attendance; PRGC = 1.5 staff present to 3.7 commissioners in attendance. Preparation of agendas, meeting minutes, and reports, along with website updates and communications with Commissioners take a minimum of 3-8 hours of staff time per meeting. Page 664 of 800 Observations from review of POSC and PRGC activities The Parks, Rec, and Golf Commission; Provides public comment but has not produced recommendations that require Council attention in many years. Agendas are typically the same for every meeting. Staff reports out to PRGC each month for comment. Since January 2019 there have been no agendized action items that required a vote of the commissioners and no reports or recommendations have been forwarded to Council. Staff did express appreciation for the public comments received from Commissioners. Page 665 of 800 Observations from review of POSC and PRGC activities In last three years POSCC has provided four opinion letters to Council. Two of these were on issues with no technical input provided to council. Staff typically prepares reports for at least one agenda item for each POSCC meeting. Recently, in response to the Commission’s request, a Staff member spent twelve hours preparing a report. Survey Results; 75% of commissioners spend less than three hours of preparation for the monthly meetings, and half of those commissioners spend less than one hour per month preparing for meetings. Five of eight respondents disagreed with the statement: “This commission's work has led to substantive changes in city policies and procedures related to our mission.” 70% of commissioners disagreed with the statement: “The City Council has taken action on our commission's written recommendations.” Page 666 of 800 Staff Conclusions; This is not a reflection on the performance of individual Commissioners or Staff. This is not a reflection on the performance of individual Commissioners or Staff. Evidence of system failure and an opportunity to improve efficiencies and effectiveness. The research suggests the Commissions are duplicative with overlapping charters produce little substantive work product and display a high rate of dissatisfaction with both staff and commissioners. Page 667 of 800 Recommendations: 1) To reduce duplication of missions and goals; Combine the Commissions into one “Public Spaces Commission.” Page 668 of 800 Recommendations 2) To refocus the Commissions’ work on productivity Encourage the use of ad hoc working groups that include staff and or council members with a shared understanding of ad hoc goals. Reduce the number of Brown Act regulated meetings to four per year and encourage work to be done between meetings in ad hocs, as opposed to during meetings. Page 669 of 800 Recommendations 3) To ensure the continuation and improvement of public input and engagement; Schedule twice per year community forums with a goal of increasing the number of residents who are engaged and able to provide input. Page 670 of 800 Questions? Staff is prepared to return at a future meeting with a proposed ordinance for introduction with specifics of charter and composition for the new Commission. Page 671 of 800 Page 1 of 2 Agenda Item No: 12.c. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1057 AGENDA SUMMARY REPORT SUBJECT: Adoption of Resolution of the City Council of the City of Ukiah Opposing the Application from the North Coast Railroad Company and Encouraging the Surface Transportation Board to Support Railbanking Between Willits and Humboldt County. DEPARTMENT: City Manager / Admin PREPARED BY: Shannon Riley, Deputy City Manager PRESENTER: Shannon Riley, Deputy City Manager ATTACHMENTS: 1. Proposed Resolution Summary: The City Council will consider adopting the Resolution of the City Council of the City of Ukiah Opposing the Application from the North Coast Railroad Company and Encouraging the Surface Transportation Board to Support Railbanking Between Willits and Humboldt County. Background: After decades of failed attempts to restart freight service on over 300 miles of the Northwestern Pacific Railroad, which at one point ran from Marin County to north of Eureka, State Sen. Mike McGuire, D- Healdsburg, in February 2018 introduced the Great Redwood Trail Act (SB1029), a bill to convert the publicly owned line into a destination for bikers and hikers. That bill was passed, and the process of unraveling the North Coast Railroad Authority (NCRA) and its holdings began. In the meantime, the City of Ukiah obtained grants to construct a rail trail in several segments that spanned the city limits; that trail would become the first official segment of the Great Redwood Trail. In an effort to facilitate the further development of that trail, NCRA has recently submitted an application to the federal Surface Transportation Board to railbank the section of rails between Willits and Humboldt County. Railbanking allows for the removal of tracks if necessary to facilitate trail development, but also preserves the rail corridor for future transportation-related uses, including the restoration of rail travel/freight transport. Discussion: City Staff has recently been made aware of an application that could potentially prevent the railbanking effort, even though it is largely without substance and would face a number of significant obstacles and offers no visible plans for mitigation. An anonymous corporation called North Coast Railroad Company, based in Wyoming, has submitted paperwork to the federal Surface Transportation Board objecting to the railbanking for the Great Redwood Trail, saying they intend to purchase the railroad. The proposed use is suspected to be for the transportation of coal that is mined in the Wyoming region and bound for Asian nations. The North Coast Rail line was built on notoriously unstable ground, leading to erosion and washouts on a regular basis. This instability is significant, given the proximity to the Eel River and the possible impacts to the drinking water supply for nearly one million people in Northern California. The necessary repairs are widely regarded as cost prohibitive, hence the lack of use in recent decades. Page 672 of 800 Page 2 of 2 An additional part of the suspected plan from North Coast Railroad Company involves the Humboldt Bay, necessary for shipments by barge. This facility would also require significant modifications, subject to local and Coastal Commission approval, in order to accommodate the proposal. Finally, the City of Ukiah and other agencies have invested significantly in the development of the Great Redwood Trail and support the concept of railbanking in order to preserve the rail corridor for viable, beneficial transportation uses. Therefore, Staff presents the attached resolution for Council's consideration (Attachment #1) and requests Council's discussion and direction on the matter. Recommended Action: Adopt Resolution opposing the application from the North Coast Railroad Company and encouraging the Surface Transportation Board to support railbanking between Willits and Humboldt County. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Sage Sangiacomo, City Manager Page 673 of 800 1 RESOLUTION NO. 2021-XX RESOLUTION OF THE CITY COUNCIL OF THE CITY OF UKIAH OPPOSING THE APPLICATION FROM THE NORTH COAST RAILROAD COMPANY AND ENCOURAGING THE SURFACE TRANSPORTATION BOARD TO SUPPORT RAILBANKING BETWEEN WILLITS AND HUMBOLDT COUNTY WHEREAS: 1.The North Coast Railroad Authority has recently sought permission from the federal Surface Transportation Board to abandon failed, unused rail segments between Willits and Humboldt County and have them railbanked for the development of the Great Redwood Trail; and 2.A corporation, whose principals have not been made public, called North Coast Railroad Company and based in Wyoming, has recently submitted paperwork to the federal Surface Transportation Board objecting to the railbanking for the Great Redwood Trail and saying they intend to purchase the railroad; and 3.The proposed use is suspected to be for the transportation of coal that is mined in the Wyoming region and bound for Asian nations; and 4.The North Coast Rail line was built on unstable ground, leading to erosion and washouts on a regular basis, with possible impacts to the drinking water supply for nearly one million people in Northern California, with the necessary repairs widely regarded as cost prohibitive; and 5.The Humboldt Bay, necessary for shipments by barge, would require significant modifications, subject to local and Coastal Commission approval, in order to accommodate the proposal; and 6.The City of Ukiah and other agencies have invested in the development of the Great Redwood Trail and support the concept of railbanking in order to preserve the rail corridor for viable, beneficial transportation uses. NOW, THEREFORE, BE IT RESOLVED that: 1.The City of Ukiah hereby notifies the Surface Transportation Board of our strong opposition to this application and declare that should be rejected outright; 2.Be it further resolved that we encourage the Surface Transportation Board to grant the request of the North Coast Railroad Authority to railbank their rail line from Willits to Humboldt Bay. PASSED AND ADOPTED this 15th day of September, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: ATTACHMENT 1 Page 674 of 800 2 Juan V. Orozco, Mayor ATTEST: Kristine Lawler, City Clerk Page 675 of 800 Page 1 of 2 Agenda Item No: 13.a. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1043 AGENDA SUMMARY REPORT SUBJECT: Award Professional Services Agreement to GHD Inc. in the Amount of $312,491 to Prepare the Plans, Specifications, and Estimate for the Great Redwood Trail Phase 4 Project. DEPARTMENT: Public Works PREPARED BY: Andrew Stricklin, Associate Engineer PRESENTER: Tim Eriksen, Director of Public Works / City Engineer ATTACHMENTS: 1. Great Redwood Trail Phase 4 Proposal_GHD - Council Summary: The City Council will consider awarding a professional services agreement to GHD Inc. for preparation of plans, specifications, and estimate for the Great Redwood Trail Phase 4 Project. Background: This work involves the completion of the design and preparation of the plans, specification, and estimate for the Great Redwood Trail Phase 4 (GRT4) project. The GRT4 will extend the existing rail trail phase 2 from Commerce Drive south approximately 1.9 miles past Plant Road near the City's wastewater treatment plant. The new phase will provide connectivity from the Redwood Business Park to the Ukiah Animal Shelter, Plant Road. Staff obtained the same California Natural Resources Agency grant through the Urban Greening Program that provided funding to phase 3 of the trail. This funding will provide for both design and construction of this project. Discussion: Staff issued a request for proposals (RFP) and sent it to six prospective consultants. In response to the City's RFP, one consulting firm, GHD, submitted a proposal with a separate fee proposal (Attachment 1). The City's consultant selection committee reviewed the proposal and found it to be very thorough in its response to the RFP. GHD has extensive knowledge of the project and has designed phases 1-3 of this trail project. The proposed fee of $312,491 is consistent with staff's estimate for providing services and within the grant budget for the design. Staff found the fee to be commensurate with the scope of work. Urban Greening Grant funding for this project will be provided to the City on a reimbursement basis. Staff recommends approval of a professional services agreement for this work. Recommended Action: Award Professional Services Agreement to GHD Inc. in the Amount of $312,491 to Prepare the Plans, Specifications, and Estimate for the Great Redwood Trail Phase 4 Project. BUDGET AMENDMENT REQUIRED: No CURRENT BUDGET AMOUNT: 51124210.80230.18253 $347,000 PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: Urban Greening Program Grant PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Tim Eriksen, Director of Public Works / City Engineer Page 676 of 800 Page 2 of 2 Page 677 of 800 → The Power of CommitmentSeptember 2, 2021 City of Ukiah Great Redwood Trail Phase 4 Specification No. 21-02 Attachment 1 Page 678 of 800 → The Power of Commitment © GHD 2021 This document is and shall remain the property of GHD. The document may only be used for the purpose for which it was commissioned and in accordance with the Terms of Engagement for the commission. Unauthorized use of this document in any form whatsoever is prohibited. Contents 1. Cover Letter 4 2. Project Approach and Schedule 6 3. Project Team 19 4. Example Work Product 31 5. Fee Proposal (separate attachment) 37 6. References 39 7. Exceptions 50 Appendix: Resumes 52 Page 679 of 800 → The Power of Commitment → 1. Cover Letter 3 Page 680 of 800 → The Power of Commitment 4 September 2, 2021 GHD Proposal No. 12557341 City of Ukiah Andrew Stricklin, Associate Engineer astricklin@cityofukiah.com (707) 463-6297 RE: Proposal for the Great Redwood Trail Phase 4 Project, Specification No. 21-02 Dear Mr. Stricklin and Members of the Selection Panel: GHD is excited to submit the following proposal to the City of Ukiah for Phase 4 of the Great Redwood Trail project. Together with our teaming partner, Alta Planning + Design (Alta), we worked with the City to complete Phases 1, 2 and 3 of this important trail project and we hope to continue our service on this next phase. During the Great Redwood Trail ribbon-cutting ceremony on January 31, 2020, attended by local notables (including Senator Mike McGuire), GHD was profoundly moved by the sense of community. It was clear what this legacy meant to the local residents and to the state, and the economic growth it would bring to the community. And it was then during this momentous occasion that City Director/Engineer, Tim Eriksen, announced the application for an Urban Greening Grant to extend the project from the terminus of Phase 2 (Commerce Drive) south toward the City's wastewater treatment plant. Here we are today, a year and a half later, realizing the dream as the Great Redwood Trail continues its journey into Phase 4 design and construction. GHD is honored to have been a part of the process thus far and we hope to continue our partnership with the City of Ukiah to see this project through to fruition. WHY CHOOSE US? GHD understands Phase 4 is a key section of the North Coast Great Redwood Trail corridor. Alta, is leading the feasibility study of this 200+ mile rail-to-trail and rail-with-trail multimodal facility under the guidance of Deven Young. The new phase will provide connectivity to the Redwood Business Park, the Ukiah Municipal Airport, the Ukiah Animal Shelter and nearby wineries. The design of Phase 4 will continue south eventually extending to the City of Hopland and other key landmarks and destinations. We rise to the challenge to complete Phase 4 on the City's fast-track schedule. The GHD/Alta team knows the City of Ukiah and the Great Redwood Trail project better than any other consultant team. −GHD has worked with the City on numerous projects over the years, providing design and engineering services primarily in the area of transportation improvements (Road Diet projects), sanitary sewer master plans, Letter of Map Revisions (Doolin Creek), and other multidisciplinary work. −Alta’s experience with the Great Redwood Trail dates back to the 1999 Bicycle and Pedestrian Master Plan, in which the need to implement the Northwestern Pacific Rail Trail project was first identified. Alta developed and delivered the Northwestern Pacific Rail Trail Feasibility Study, which included a preliminary design and cost estimates for the approximately 1.5-mile rail-with-trail (RWT) facility. Alta is currently leading the feasibility study for the North Coast Great Redwood Trail. −GHD's involvement in this project began during the 2012 Mendocino County RWT Corridor Plan. This work set the stage for the Northwestern Pacific Rail Trail Phase 1 project, in which GHD and Alta teamed up to provide a full suite of environmental, engineering, permitting and SWPPP services for the North Coast Railroad Authority (NCRA) Railroad Corridor. The GHD/Alta team brings unparalleled expertise in rail-with-trail planning, design and construction. −We have highly qualified team members with vast RWT experience in Northern California and extensive knowledge of Planning and Project Approval, Public Outreach, RWT Design, CEQA and Environmental Permitting, California Public Utilities Commission (CPUC)/NCRA Coordination and Rail Crossings, Bridge Engineering, Rail Engineering, Active Transportation Program (ATP) Grant Requirements, and Construction Management. GHD Office Address 2235 Mercury Way Suite 150 Santa Rosa CA 95407 www.ghd.com Mailing Address PO Box 7967 Santa Rosa CA 95407 Page 681 of 800 −We have ample permitting experience with the NCRA, Northwestern Pacific Railroad (NWP), and the California Western Railroad (CWR). −We are very familiar with both California Natural Resources Urban Greening Grant and Caltrans Local Assistance requirements after having completed several trail projects. −GHD has worked on several RWT and Safe Routes for Schools projects for the Mendocino Council of Governments, SMART, and Northern California cities and counties including the City of Ukiah within the past five years. −Alta led a major three-year study in 2002 for the Federal Highway Administration (FHWA) entitled Rails with Trails: Lessons Learned, which developed the best practices for RWT projects. Since then, Alta has worked on dozens of RWT projects across the nation and has partnered with GHD on several. The GHD/Alta Team has the right Approach. −We have an established relationship with City staff enabling us to focus on the project immediately and quickly move from the feasibility study into the detailed design phase. −The GHD/Alta team will follow much of the same project-tested approach as developed in Phases 1, 2 and 3. Timing is key. To meet the accelerated schedule, it is critical that the approach be efficiently executed task by task. We will complete the topographic survey, right-of-way mapping and geotechnical analysis right away. The survey will be completed by GHD’s in-house resources, reducing costs and allowing us to put our focus towards the Preliminary (30%) Design. −GHD will coordinate with the City on the new CEQA exemption and other related environmental studies. −In preparing for this proposal, GHD looked back on all three phases of design and construction to determine an effective and timely way to manage this project and get a good understanding of the required scope. GHD reviewed the Urban Greening Grant and how it outlines the trail improvements and landscaping elements. We have developed a few renderings for specific portions of the Phase 4 trail amenities, which are included in Section 2 of this proposal. −GHD will assist the City and contractor with obtaining permits as soon as possible to avoid schedule delays. Acknowledgments −This proposal is signed by Matt Kennedy, Principal-in-Charge, who is authorized to negotiate and bind GHD contractually. Matt's address is 2235 Mercury Way, Suite 150, Santa Rosa, CA 95407. His telephone number is (707) 540-9687. −This proposal is a firm offer for a minimum period of thirty (30) days after the submittal date of September 2, 2021. −GHD acknowledges receipt of Addendum 1 to the RFP, dated August 11, 2021. We look forward to your response and appreciate the opportunity to continue serving the City, both with the continuation of this vital trail project and for many years to come. Sincere regards, GHD, Inc. Matt Kennedy, PE, TE Pat Tortora, PE, LEED AP Principal-in-Charge/Authorized Official Project Manager (707) 540-9687 (971) 925-3751 Matt.Kennedy@ghd.com Pat.Tortora@ghd.com → The Power of Commitment 5 Page 682 of 800 → The Power of Commitment → 2. Project Approach and Schedule 6 Page 683 of 800 Figure 1: Aerial of Phases 1 and 3 GHD City of Ukiah Great Redwood Trail Phase 4 7 further development of the NWP Rail Trail project, a 25- year agreement that is critical to the overall success of this four-phase endeavor. Most of the detailed requirements referenced in the agreement are described in the NCRA Policy & Procedures Manual, §0907 Trail Projects on the NWP Line Rights- of-Way: Design, Construction, Safety, Operations, and Maintenance Guidelines (Rail-with-Trail Guidelines). These guidelines encompass requirements for licensing, permitting, and planning for trail projects in the NCRA R/W. Two of the key planning documents required by these guidelines are a feasibility study and safety plan. GHD incorporated the feasibility study and safety plan documentation in the Phase 1 Trail Corridor Management Plan, a document that addresses management issues throughout the study area relating to use and design of the facility. This study and documentation are also needed for Phase 4. The feasibility study was required to demonstrate a project’s comprehensive viability, as well as to present an alternatives analysis. The 2012 Mendocino County Rail with Trail Corridor Plan meets these requirements and identifies this Phase 4 project segment as Segment No. S8 and S9. The safety plan lays out engineering standards, trespassing and crime prevention strategies, signage, access points, and methods/processed for coordination with police and fire protection. GHD and Alta have completed these documents for previous projects, including, as previously mentioned, the Phase 1, 2 and 3 portions of the Great Redwood Trail (NWP Rail Trail project). →2. Project Approach and Schedule The Great Redwood Trail Background (formerly Northwestern Pacific Rail Trail) In 1999, the City of Ukiah began to plan a new Class I trail adjacent to the Northwestern Pacific (NWP) railroad tracks in the North Coast Railroad Authority (NCRA) right-of- way (R/W) corridor. The trail concept first appeared in the City’s 1999 Bicycle Master Plan, completed by GHD's teaming partner Alta Planning + Design (Alta). The planning for the overall NWP Rail Trail Project was further advanced in the 2002 Rail Trail Feasibility Study, completed by Alta. The project was ranked as the highest priority in the Bicycle Master Plan in the 2006 Mendocino County Regional Bikeway Plan. The NWP Rail Trail project has experienced broad community support and the support of NCRA. Within the City of Ukiah, the NWP Rail Trail project was divided into three segments, to be implemented in three phases: −Phase 1: Clara Street in the north to Gobbi Street in the south −Phase 2: Gobbi Street in the north to Commerce Drive in the south −Phase 3: Brush Street in the north to Clara Street in the south In 2012, the City selected the GHD/Alta team to deliver Phase 1 of the project, which was the first rail-with- trail project to be designed and constructed within the NCRA R/W in Mendocino County. The project involved surveying and mapping, preparation of the Trail Corridor Management Plan, Safety Plan, and Trail Policy. Services provided by the GHD/Alta included a public workshop and engineering design. Construction of Phase 1 was completed in 2015, with GHD providing construction management and inspection services. In 2018, the GHD/Alta team was successively selected to prepare construction documents for both Phases 2 and 3 of the trail. Construction commenced in the winter of 2019. GHD assisted the City in obtaining approvals from the California Public Utilities Commission (CPUC), California Department of Fish and Wildlife (CDFW), Caltrans and NCRA. In addition, GHD assisted with the development of a License Agreement between the City and NCRA for the Page 684 of 800 Figure 2: Aerial of ADA ramp GHD City of Ukiah Great Redwood Trail Phase 4 8 The Great Redwood Trail Assessment outlines plans for the corridor to be railbanked between Cloverdale and Samoa. With the passing of State Bill 69 (2021), NCRA has begun the preliminary steps to repurpose the valuable rail line as a recreation and active transportation corridor that will generate economic benefits for dozens of communities. Railbanking allows railroad owners to preserve established rail lines by transferring them, through sale, donation, or lease, to a qualified public or private entity to manage the ROW as an interim trail. This entity becomes legally and financially responsible for managing the rail corridor ROW. The corridor can be used as a trail until the need for rail service resumes, at which point the ROW can be converted to, or shared with, the active rail. Phase 4 Project Understanding In May 2021 the City received an Urban Greening Grant from the state administered by California Natural Resources Agency to complete the Phase 4 segment of the Great Redwood Trail. The Urban Greening Grant supports projects that reduce Green House Gases (GHG), by enhancing, expanding and creating neighborhood parks, provide greening of public lands, mitigating urban heat islands, or developing non-motorized urban trails that provide safe routes to travel between residences, workplaces, commercial centers and schools. In the summer of 2021, the City is expected to complete and file environmental documentation through a CEQA Notice of Exemption under Section 15304 (Class 4, construction of a bicycle/multi-use trail within an existing right-of-way). The Phase 4 trail is approximately 1.9 miles long, which include three new roadway crossings (Airport Road, Norgard Lane and Plant Road), as well as two existing rail bridge enhancements to support the new trail. At this time it is not clear who will be removing the existing rail and wood ties, but once the existing rail and rail ties are removed, the trail will be placed on the existing ballast after minor repairs, localized widening and grading have been completed. The trail alignment will match the existing centerline of the existing rail. These opportunities and constraints are described below, under “Approach." The City has established a schedule for the project, with the goal of completing design in March 2022 in order to comply with the Performance Period as indicated in the Urban Greening Grant Agreement. This schedule is an important goal for the City, as it will ensure that construction moves forward during spring and summer of 2022. Achieving this schedule is contingent on overcoming key project issues, which are also described below, under “Approach." Developed over the past 15 years, the GHD/Alta team has a very deep understanding of this project. As a result, we are able to leverage our experience from Phases 1, 2 and 3, as well as other similar rail-with-trail projects (described in Sections 3 and 6 of this proposal) to successfully meet the ambitious schedule and deliver all project components to the satisfaction of the City. Over the past five years, the GHD/Alta team has also worked directly with NCRA and NWPR/W staff on the development of numerous rail-with-trail projects in Northern California. Our trail designs have become the centerpiece of communities. As trails gain popularity, we recognize the potential for under-utilized land to increase in value, creating the potential for trail-front businesses. In addition to our combined experience, Alta is also recognized as a nationwide leader in the development of trail projects within railroad rights-of-way. Alta has published reports in collaboration with the U.S. Department of Transportation that examine safety, design, and liability issues associated with the development of shared use paths and other trails within or adjacent to active railroad and transit rights-of-way. Page 685 of 800 Phase 4 Approach In preparing for our proposal, we met with City staff multiple times to discuss specific details and potential challenges regarding Phase 4 of the project. We walked the site, photo-documented, and conducted a drone fly over to obtain video and aerial photos of the Phase 4 alignment. See figure 3. We obtained and reviewed all background documentation, including NCRA R/W mapping and applicable policies, goals, and objectives outlined in the 2015 Ukiah Bicycle and Pedestrian Master Plan (prepared by Alta). Through our historic understanding of the project and our recent investigative efforts, we have identified some key challenges within Phase 4. The following section identifies these key challenges and GHD’s proposed approach to each. Schedule Constraints To meet the schedule established for this project, it is critical that the approach be efficiently executed with each task. As noted in Section 3, GHD’s project management and design team has worked with the City on numerous projects, one of which is under construction. We have an established relationship with City staff, as well as with the City’s Project Manager on this project (Andrew Stricklin), enabling us to focus on the project immediately and quickly move from the feasibility study into the detailed design phase, as outlined in the RFP (No. 21-02). The GHD/Alta team is ready to start immediately in order to meet this ambitious schedule. The critical path is to complete the topographic survey and the right-of-way and geotechnical analyses. GHD previously completed a portion of the base mapping at Commerce Drive, where the Phase 3 trail begins. This will allow us to build upon the existing base map and interconnect the base maps from previous projects. We propose to conduct a focused topographic survey along the existing rail extending out to the R/W to capture the existing ballast, drainage patterns, trees, road crossing, and railroad equipment. In order to quickly complete the survey, we will use a combination of aerial drone equipment with limited manual survey at specifically and strategically chosen locations, such as at the existing bridges, culvert crossings, and road crossings. The survey will be completed by GHD’s in-house resources. This survey approach will minimize costs and allow us to quickly focus on the Preliminary (30%) Design. Preliminary (30%) Design Key goals of the Preliminary Design are to verify that the existing rail and rail ballast prism have adequate width and identify where the ballast may need to be widened to accommodate the Class I multi-use trail. The goal is to minimize the amount of ballast widening and impacts to the existing storm drainage swales, potential sensitive habitat and culvert crossings. In addition, the new trees, native grasses, and native shrubs that are selected and planted by the North Coast Opportunities, will be incorporated by the GHD team in the preliminary design considering the plants functions, i.e., provide shade for the Family gathering area, existing storm water features, wetland enhancement, or simply decoration. GHD in conjunction with Alta will develop a preliminary plan for the outdoor family gathering space and its amenities, along with other site furnishings along the trail corridor. The preliminary engineering or 30% design drawings will be utilized to begin conversations with CPUC and the systems needed for the road crossings. The site or street lighting for the Phase 4 trail will not contain trail lighting, but rather lighting only at the roadway crossing for public safety. The intent of the “No” trail lighting is to promote dark sky’s and limit light pollution in the surrounding area. Right-of-Way Impacts Based on the current concept trail alignment, no R/W or easement acquisitions are needed. The concept drawings included in the City’s RFP (21-02) show the trail alignment extending from Commerce Drive south to approximately 340 feet south of Taylor Drive on the existing rail ballast. From our field review the only railroad equipment is at Commerce Drive, being a control cabinet, and at Norgard Lane being warning flashers. GHD measurements indicate there is adequate space between all these features to install the new trail and not affect the existing railroad equipment, utilities, or existing R/W. Figure 3: Aerial image of existing rail corridor GHD City of Ukiah Great Redwood Trail Phase 4 9 Page 686 of 800 Proposed Alignment The proposed alignment or concept for this phase of Trail is to follow the existing centerline of the existing rail as feasible. The trail maybe offset from the existing centerline to avoid widening any areas beyond the existing ballast slope. The goal is to avoid importing fill material, reduce or eliminate temporary and/or permanent impacts to wetlands along the corridor. See figure 4. Placing the trail on the existing ballast will minimize impacts to the environment and and prevent disturbance of drainage patterns. The trail will be sloped to allow stormwater runoff to drain toward the existing stormwater features and infrastructure that currently runs parallel along the corridor. The City of Ukiah adheres to the City of Santa Rosa Storm Water Low Impact Development Technical Design Manual for storm water quality and quantity improvements related to new projects. This project is exempt from providing storm water low impact improvements. We will include storm water features where feasible. There are three existing short bridge crossings that need to be modified to support the construction of the trail. Provided the foundations and major structural components are adequate to support the loads from the new trail, GHD will explore possible modification to the existing bridges in an attempt to keep the major structural components as they are indicative of traditional rail construction. GHD’s preliminary review and modifications include keeping the existing foundations and beams, while removing the existing cross beams and installing a new concrete deck with curbing and guardrails on both sides. See figure 5. We will use the new data collected during the topographic survey and continue the approach of avoiding impacts as much as practical. This will reduce the need for costly drainage improvements and reduce the potential for having to revisit the City’s CEQA analysis. Where the drainage options in the project area are limited, we will seek to balance the runoff created by the construction of the trail with vegetated buffers to improve the infiltration adjacent to the trail to avoid any increase in the amount of runoff. The estimated area of disturbance of the project is anticipated to be greater than two acres, resulting in the need to develop a Stormwater Pollution Prevention Plan (SWPPP) and the rest of the NPDES stormwater regulatory requirements. Permitting GHD will assist the city and the contractor, in obtaining and securing a right-of-way encroachment permit for the removal of the existing rail and construction of the trail crossing the public streets. An encroachment permit will be needed from Caltrans (where the trail crosses under the Redwood Hwy 101) and county roads at Norgard Lane and Plant Road. The city will process the encroachment for Airport Road internally. GHD will also coordinate with NCRA and their engineering representative in obtaining approval for this project and obtaining an encroachment. Existing Bridges GHD is assuming that the existing foundations and wooden beams will be reusable. This will be verified during the Preliminary (30%) Design. For preliminary design purposes, GHD will remove the existing rails and wood-cross ties and install and new concrete deck with handrails to support the new trail. If the wooden beams are inadequate, GHD will work with the city on a more efficient design to replace them. Recycled Water GHD will investigate the location of the existing reclaimed water system during the Preliminary (30%) Design. GHD will recommend tie-in locations to provide irrigation for the Phase 4 trail planting areas. Figure 4: Rendering of Phase 4 path along wetlands Figure 5: Rendering of Phase 4 bridge GHD City of Ukiah Great Redwood Trail Phase 4 10 Page 687 of 800 GHD's Code of Conduct and Core Values GHD’s Code of Conduct establishes our behavior expectations and conduct requirements. We promote ethical business and personal behavior consistent with our core values of Safety, Teamwork, Respect and Integrity. This coincides with City of Ukiah’s core values of Professionalism, Service, Teamwork, Innovation and Safety. We believe that the success of our projects with the City directly correlates. See figure 6. Phase 4 Scope of Work The proposed scope of work to complete the planning and design of Phase 4 of the Great Redwood Trail project is described in the following tasks. We welcome the City’s review of the proposed scope and are open to discussing any changes which may better suit the project needs. Task 1. Project Management GHD will be responsible for managing the coordinated effort of GHD, Alta Planning + Design, and Crawford staff. This task includes the efforts required for GHD’s Project Manager, with administrative assistance, to manage the project contract, coordinate team personnel and sub- consultants, maintain the project schedule, coordinate, and perform quality assurance and quality control reviews, prepare invoicing, and attend field and deliverable review meetings. GHD will organize and facilitate a kick-off meeting with the City, Alta, and other key members of the project team. The purpose of the kickoff meeting will be to: −Discuss the project goals −Discuss and refine the project’s scope of work and schedule as needed −Confirm roles and responsibilities −Confirm the expectations of the City −Confirm the schedule for project status meetings −Confirm and request available background data. Task 2. Review and Evaluate Existing Documents and Data The GHD team will review and summarize existing data from the site visits, previous studies and plans, survey and record information, and relevant City planning documents. GHD will specifically review: −Urban Greening Grant Application and agreement −2012 Mendocino County Rail with Trail Corridor Plan (prepared by GHD and Alta) −NCRA Rail-with-Trail Guidelines −License Agreement between the City and NCRA −1999 and 2015 Ukiah Bicycle and Pedestrian Master Plans (prepared by Alta) −2002 Ukiah NWP Rail Trail Feasibility Study (prepared by Alta) GHD will also review other relevant zoning ordinances and General Plan policies, addressing data gaps with further field review and data collection from the City, NCRA, and local agencies, if necessary. Specific items to be resolved for project context include: −Adjacent land uses (both existing and future) −Access points (vehicular and bike/pedestrian) −Street crossing conditions/configurations −Potential environmental impacts Deliverables: −No specific deliverables for this task; the results of this task will be reflected in other deliverables, below. Figure 6: GHD's Core Values GHD City of Ukiah Great Redwood Trail Phase 4 11 Page 688 of 800 Assumptions: −The City will provide access to relevant documents, GIS data, and other documents, as needed, to complete this task. Task 3. Topographic Survey and Right- of-Way Determination Right-of-Way and Easement Research and Review The GHD team will complete research and review of City mapping and adjacent parcel boundaries, as well as of the NCRA R/W, to document the locations of the existing railroad R/W and City of Ukiah R/W, Mendocino County R/W and Caltrans R/W with the goal of designing the trail corridor improvements to be within either the railroad R/W or the City/County R/W. GHD is in receipt of the NCRA R/W mapping for the Phase 4 corridor, and has previously completed partial mapping of the R/W between Commerce Drive for the Transportation Improvements for Redwood Business Park project. Project Control Survey The GHD team will establish project survey control and prepare R/W mapping for the project. Our surveyors, Richard Maddock and Brian Howard, will set horizontal and vertical control points for project mapping in accordance with City of Ukiah horizontal and vertical control requirements, which also entails locating monuments on streets adjacent to the railroad R/W, if practical. A “Survey Control Data Sheet”—which will be semi-permanent in nature to serve as project control during construction, or subsequent survey activities—will exhibit these survey control points. Our surveyors will make field measurements using GPS and conventional survey methods on the same horizontal basis as the Transportation Improvements for Redwood Business Park project, which will allow the work to seamlessly be brought into the City’s GIS system, which is based upon the California State Plane Coordinate System. The horizontal datum will be based on the North American Datum 83 (NAD 83). The vertical datum will be based on the North American Vertical Datum of 1988 (NAVD 88), which is consistent with the most recent FEMA flood mapping in Ukiah. GHD will ensure that all surveying and mapping is in compliance with City of Ukiah standards, or with Caltrans standards when not otherwise specified by the City. All of the control can be located by GPS methods at one time. Mobile LiDAR Topographic Mapping The GHD team proposes mobile LiDAR topographic mapping that would cover the project site and immediate surrounding area. GHD will set control using Global Positioning System (GPS) methods. GHD will map the project limits using a drone flyover with mounted mobile LiDAR system. A scalable point cloud of the project will be provided and georeferenced to the project datum. The LiDAR mapping will be suitable for compiling a topographic map with the following specifications: −Finish mapping scale 1 inch = 20 feet −Contours at 1-foot intervals GHD will acquire data on all areas obstructed by tree cover or heavy vegetation via ground-based surveys. In addition to topography, the resultant map will show planimetric features such as roads, railroad tracks, crossing signals, buildings, fences, power poles, trees, brush, and other features according to standard practice. Accuracy will equal or exceed National Map Accuracy Standards for topographic maps compiled by mobile LiDAR methods. Supplemental Topographic Field Surveys The mobile LiDAR mapping will be supplemented with ground-based topographic surveys in obstructed areas and at conforms, utility features, and drainage. GHD will provide field verifications of topographic features, such as trees, fences, etc. This survey will, at a minimum, include: −Cross sections of the trail corridor and crossing streets at 25’ intervals (surface data will be sufficient to create a Triangular Irregular Network [TIN] for Civil 3D design) −Surface evidence of the storm drain system (ditches, culverts, catch basins, drop inlets with flow line elevations) −Surface evidence of utilities −Power poles, rail equipment, guy wires, and overhead lines −Fencing and gates −Streetlights, signs, striping, pavement legends, and markings −Mailboxes, driveway, and ramps −Tree trunk locations and diameter GHD City of Ukiah Great Redwood Trail Phase 4 12 Page 689 of 800 CAD file set-up and TIN The GHD team will prepare computer files to include field control points, topographic surveys, utility data, property surveys, and preparation of the TIN used for three- dimensional calculations (i.e., earthwork, cross-sections, and profiles). Vegetation/Tree Survey Kristine Gaspar, GHD’s environmental scientist, will oversee the identification of trees along critical segments of the NCRA R/W, compiling a description of the trees and identifying any potential constraints to the trail location created by trees. She will use a handheld GPS location device to map these vegetative resources as they are evaluated. The tree locations will be included in the base map. Deliverables: −Survey Control Base Map and Topographic Map in 2016 AutoCAD Civil 3D file format point files and the surface model (DTM) Assumptions: −No Record of Survey is required. −All work will be within existing NCRA and City of Ukiah R/W and no additional property boundaries will be mapped except at roadway intersections. Task 4. Geotechnical investigation and report Limited Geotechnical Investigation The objective of the GHD team’s geotechnical investigation is to evaluate and understand the geology and geotechnical engineering properties of the site to provide geotechnical recommendations for foundation design, pavement design, retaining wall design, and earthwork. All work will be under the responsible charge of a Chris Trumbull, our team’s licensed Geotechnical Engineer. Exploration will include up to four (4) borings drilled to depths of 10 to 50 feet in the pathway alignment (one south of Commerce Dr, one north of the Airport Road crossing, one by Norgard Lane, one south of Plant Road). Samples will be obtained for lithology development and laboratory testing. The borings will be drilled and backfilled with grout under the guidelines of the Mendocino County Environmental Health Department guidelines. GHD will facilitate laboratory testing for strength, corrosion, index, and pavement, as well as provide engineering analysis for soil compressibility, expansion, liquefaction, earthwork, foundations, retaining walls, and pavements. GHD will then summarize findings and conclusions in a design- level geotechnical investigation report, which will include characteristics of the soil and groundwater conditions, a plan showing boring locations, seismicity and geology, liquefaction potential, expansion potential, corrosivity, and lab test data. The report will also include recommendations for questionable soils (expansive, compressible, liquefiable), earthwork, trenches, foundation bearing and lateral capacities, settlement, CBC seismic design values, and flexible pavement section thickness alternatives. Deliverables: −Draft and Final Geotechnical Investigation Report Assumptions: −Access to the project site is provided to GHD for geotechnical exploration; encroachment permits or rights of entry are provided to GHD. −Rail safety training or coordination is not required. −Drill sites are accessible by a truck-mounted drill rig. −Drill spoils may be left on site. Task 5. Preliminary (30%) design GHD will collaborate with Alta to review the preliminary plans included with the Urban Greening Grant application. GHD and Alta will prepare a preliminary trail design to meet the requirements of the local codes, AASHTO Guide for the Planning, Design and Operation of Pedestrian Facilities, Caltrans Highway Design Manual Chapter 1000 – Bicycle Transportation Design, FHWA, MUTCD-CA, the NCRA Rail-with-Trail Guidelines, the License Agreement between the City and NCRA, and the intended design and use of the trail and surrounding lands. Once developed, the GHD team will submit the preliminary plans with a cover letter to the following entities for their review: −City of Ukiah −NCRA −Utility companies −CPUC We will request that the City, the NCRA, California Public Utilities Commission (CPUC), and the utility companies provide summarized, written comments on the preliminary plans. An engineer’s opinion of probable construction cost will also be prepared and submitted. Following completion of the Preliminary Design, GHD will review the CEQA Categorical Exemption (CatEx) for the project in the context of the Preliminary Design. The GHD team will also review the CEQA code sections cited that GHD City of Ukiah Great Redwood Trail Phase 4 13 Page 690 of 800 were used to qualify the project as a CatEx. Based on past experience with similar projects, we have observed that the trail should have minimal environmental impacts. Therefore, it is the GHD team’s assumption that the City’s CatEx will be sufficient, and therefore we are not aware of any additional CEQA work that would be necessary. If additional CEQA efforts are needed, however, they cannot be quantified at this time. If determined to be necessary, we proposed to develop a supplemental CEQA scope during Preliminary Design. Drainage Study The GHD team will conduct field and office research to evaluate the drainage systems adjacent to the trail prior to beginning the mapping effort. Available drainage studies will be reviewed. Topographic mapping will include the structures and open ditch conveyances adjacent to the eastern side of the railroad. Runoff calculations for the 10-year design storm event will be performed and used to verify drainage system sizing. A brief, written drainage memorandum will summarize the constraints and recommendations for the drainage improvements necessary for the construction of the trail, including addressing flood zones and the three unnamed creek crossings at existing bridges. The GHD team will use this drainage study to guide the design to address drainage needs. Preliminary Plans The 30% concept level design plans will contain a conceptual level trail alignment, furnishings, and outdoor family gathering area. Trail alignment, irrigation, furnishings and family gathering area: −Intersection designs at the intersections of Commerce Dr, Airport Road, Norgard Lane and Plant Road −Finalizing trail alignment −Develop typical trail cross sections throughout project reach for each type of section −Location and type of proposed bollards and barriers −Family gathering area layout design, hardscape materials selection, site furnishings (benches, drinking fountains, waste receptacles, etc) −Coordination with North Coast Opportunities (NCO) to integrate their plant selection into the overall design −Coordination of landscape and site elements with trail lighting at intersections −Irrigation connection to the existing reclaimed water system. Determine feasibility and complexing of system extension and serviceability. −Identify locations for rainwater capture and use for irrigation. −Wayfinding and interpretive sign locations (content not to be developed in this plan set) Deliverables: −Preliminary Plans −Preliminary Opinion of Probable Construction Cost −Preliminary Drainage Study Assumptions: −There are no meetings associated with this task. −LID improvements are not required for the project. Task 6. Engineering Design (60%, 90%, and final) Once comments have been received by the City, NCRA, CPUC, and utility companies for the 30% design submittal, the GHD team will proceed with the development of the 60% design. Depending on the timing of these comments, GHD may request authorization to proceed with the 60% design sooner in order to meet the City’s deadline for design completion. The engineering design will consider review comments received on the 30% design, which will be incorporated into the plans, technical specifications, and an opinion of probable construction cost. Submittals will be made to the City and NCRA for review at the 60% and 90% stages of completion. The final submittal will be the stamped and signed final bid documents for submission to NCRA, CPUC and California Natural Resources Agency for approval. Engineering design will include: −Trail alignment −Design of trail cross sections throughout the corridor for each type of typical cross section −Pavement section design −Intersection designs at the intersections of Commerce Dr, Airport Road, Norgard Lane and Plant Road −Location of trail amenities and amenity details to be included in the project GHD City of Ukiah Great Redwood Trail Phase 4 14 Page 691 of 800 −Trail lighting at roadway intersections to comply with required safety lighting standards −Grading and drainage −Wayfinding and interpretive sign locations −Location and type of proposed bollards and barriers −Signing and striping −Landscaping design Construction Plans The project will be designed using English Standard units in AutoCAD Civil 3D at a scale of 1 inch = 20 feet depicting the preferred alignment. Electronic copies of the graphic files will be provided in PDF and/or AutoCAD format using GHD’s AutoCAD standards, including project folder structures, layer names, line styles and font resources, color tables, etc. GHD will develop the Construction Plans 22” x 34” sheets that allow 50% scaled reduction to 11” x 17” sheets. Design plans will include the title sheet, sheet index, notes/ symbols and abbreviations, typical cross sections, civil site plan and profiles, demolition, site and grading plans for each intersection design, civil and typical details, lighting, signing and striping, landscaping, erosion control, and other sheets and details as necessary for a constructible project and to convey the design intent. All final plans will be stamped and signed by a California Licensed Professional Civil Engineer. Construction plans will be submitted to the City for review at the 60% and 90% stages. Review comments received will be addressed in the 90% and Final submittals. Specifications GHD will prepare technical specifications using the City’s standard format for technical specifications (Sections 12 and 13 of the City boilerplate construction contract). The technical specifications will be developed and submitted to the City for review at the 60% and 90% stages. Review comments received will be addressed in the 90% and final 100% submittals. Engineers Opinion of Probable Construction Cost: GHD will prepare the Engineer’s Opinion of Probable Construction Costs using standard engineering estimate procedures for each design submittal (30%, 60%, 90%, and Final). Actual construction costs may vary due to availability of labor, equipment, materials, or market conditions. Applicable review comments received will be addressed in the 90% and final 100% submittals. An appropriate contingency and qualifications will be included with each estimate. Permitting and Agency Coordination The project is a state funded project through the California Natural Resources Agency (CNRA) Urban Greening Grant Program and will require final review and approval from CNRA. GHD will coordinate with the city and provide plans for submittal to CNRA, as well as address any review comments. In addition to CNRA, plan approval will be required by CPUC and the NCRA. We will submit and coordinate plan review and approval with these agencies. If a SWPPP is required, we can develop the SWPPP (optional task) utilizing the California State Water Resources Board SMARTS (Stormwater Multiple Application and Report Tracking System) web-based interface. We have completed several recent projects on this web-based interface for the City. Deliverables: −60% Submittal will include five (5) hard copies of 11” x 17” plans, specifications, and opinion of probable construction costs, submitted with electronic PDF files −90% Submittal will include five (5) hard copies of 11” x 17” plans, specifications, and opinion of probable construction costs, submitted with electronic PDF files −100% Submittal will include the final plans, specifications, and opinion of probable construction costs ready for bidding purposes, submitted as PDF electronic files, AutoCAD electronic files of the plans, one (1) set of stamped and wet-signed 22” x 34” reproducible mylar plans, one (1) copy-ready set of specifications, 10 copies of 22” x 34” plans on bond, 10 copies of 11” x 17” plans on bond, and 10 copies of bound specifications Assumptions: −The City will provide an electronic copy (MS Word format) of their current front end contract requirements, technical specifications, and bid forms. −The project is anticipated to disturb more than 1 acre, therefore a SWPPP is needed. An optional task for SWPPP preparation is included. −Landscaping will be minor and limited to areas near street crossings, based on the available budget. Related irrigation will be limited to drip irrigation, if necessary, at those locations. −No trail lighting is included, only lighting at the road crossings will be provided. −The trail design will conform to the following design standards where applicable: GHD City of Ukiah Great Redwood Trail Phase 4 15 Page 692 of 800 •FHWA/FRA “Best Practices” for Planning and Designing Rails-with-Trails •AASHTO Guide for the Development of Bicycle Facilities •California Manual on Uniform Traffic Control Devices •Caltrans Chapter 1000: Planning and Designing Bicycle Facilities •American with Disabilities Act Task 7. Supporting Biological Resources Surveys and Studies Desktop Review of Available Biological Information Prior to on-site surveys, GHD will review biological resource databases including the California Department of Fish and Wildlife (CDFW) California Natural Diversity Database (CNDDB), the California Native Plant Society (CNPS) Rare Plant Inventory, and species lists provided by the U.S. Fish and Wildlife Service (USFWS) and/or National Marine Fisheries Service (NMFS). Pre-project scoping will include generation of a table showing each special status species’ potential to occur in the project area and inform the optimal time period(s) for biological field surveys. Deliverables (all electronic PDFs): −PDF table indicating potential for presence of sensitive biological resources within the project area Sensitive Natural Community Mapping, and Habitat Assessment Vegetation communities within the project area will also be documented in the field and classified at the alliance level according to the Manual of California Vegetation using the Rapid Assessment method. Rare plants and Sensitive Natural Communities will be mapped using GPS and aerial imagery. Potential habitat that may support sensitive wildlife species will also be evaluated at this time, based on an analysis of on-site habitats, known home ranges and/or distribution of target species, and other biological characteristics. Presence of these resources will be summarized in the project’s Biological Resources Report, as described below along with supporting data forms, site photos, and a map. Biological Resources Report The Biological Resources Report (BRR) will summarize the potential for special status plants and wildlife, aquatic resources, and Sensitive Natural Communities to occur within the project area. The BRR will compile: data found during database surveys described above as well as any available maps, databases, literature specific to local ecology, and any additional information from the client pertaining to the site shall be reviewed. The BRR will also summarize the results of the rare plants surveys, Sensitive Natural Community mapping and wildlife habitat assessment. Recommendations for further actions or mitigation measures to protect biological resources during project implementation will conclude the report. The report will support the project’s CEQA documentation and anticipated permits. Deliverables (all electronic PDFs): −Draft and Final BRR (including maps of sensitive biological resources detected during surveys) Aquatic Resources Delineation (Optional) During a preliminary site visit, several swales and drainages were noted along the rail corridor which could potentially be jurisdictional features. Therefore, GHD recommends preparing an aquatic resources delineation to support the design engineers so they can avoid these features to the extend feasible. In addition, the City would need the aquatic resources delineation to support any resource agency applications that we understand will be prepared by the City. Therefore, we have included this as an optional task for the City’s consideration. GHD will conduct a delineation of potential wetlands and waters of the United States and/or State in accordance with the USACE 1987 manual, the Western Mountains, Valleys, and Coast Region Supplement, the 2020 Navigable Waters Protection Rule and the State Wetland Definition and Procedures for Discharges of Dredged or Fill Material to Waters of the State adopted by the State Water Resources Control Board on April 2, 2019. Field work for the delineation will be conducted on the same day as the initial habitat assessment described below. A separate delineation report will be prepared that describes the findings of the delineation and can be submitted to USACE and RWQCB for their jurisdictional determination. The report will include a delineation map, data sheets, and supplemental information to support the delineation analysis. The delineation will include all the information required by USACE and Water Board to make a formal jurisdictional determination. As part of the report, the following information is required: a locality map; USGS quad sheet or copy with the project boundary outlined; and a delineation map on an aerial or topographic base. GHD will prepare the figures to support the delineation report. Deliverables (all electronic PDFs): −Draft and Final Aquatic Resources Delineation GHD City of Ukiah Great Redwood Trail Phase 4 16 Page 693 of 800 Task 8. Project Stormwater Pollution Prevention Plan (SWPPP) optional The GHD team (featuring three State of California Qualified SWPPP Developers) will prepare a site-specific risk assessment to determine risk level for the SWPPP. The risk level is a function of the erosive potential of the soil and receiving water body risk during periods of soil exposure. Risk level 2 will require sampling of stormwater for pH and sediment, and significantly more effort than a Risk level 1 site. Risk level 3 sites may require bioassessment studies of the receiving water body, and active stormwater treatment systems. It is assumed the project will be a Risk level 2. GHD will prepare the SWPPP document assuming the project is Risk level 2. The SWPPP will include site maps and water pollution control drawings, a Construction Site Visual Monitoring Program, a Sampling and Analysis Plan for non- visible pollutants, a Sampling and Analysis Plan for pH and sediment, a Construction Site Non-Visible Pollutant Sampling Program, selection of appropriate BMPs for Erosion and Sediment Control and for Construction Site Management, and preparation of a partial water pollution control schedule (WPCS). Other required documentation will be provided partially complete, such as the Rain Event Action Plan (REAP), site inspection forms, and contractor or material suppliers notification forms. This documentation would be finalized following project bid. The project SWPPP will include certifications for GHD’s SWPPP Developer. GHD will provide Notice of Intent (NOI) information suitable to initiate the waste discharge permit process using the State’s Stormwater Multiple Application and Report Tracking System (SMARTS). GHD will also provide assistance during the initial use of the SMARTS system via phone or email. Deliverables: − SWPPP document in electronic PDF format Schedule Please see our proposed project schedule on the following page. GHD City of Ukiah Great Redwood Trail Phase 4 17 Page 694 of 800 ea te GREAT REDWOOD TRAIL PHASE 4Enter Company Name in cell B2. Enter the n e Di 1 lls 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 1 2 3 4 5 6 7 8 9 is ro TASK START END M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S M T W T F S S ll B Consultant Selection 9/6/21 9/6/21 ll B Council Award / Notice to Proceed 9/15/21 9/15/21 o w Task 1: Project Management 9/16/21 3/25/22 Project Mangament 9/16/21 3/25/22 Kick of Meeting 9/28/21 9/28/21 Task 2: Review Existind Documents and Data 9/16/21 11/26/21 e ce Task 3: Topographic Survey and Right of Way 9/16/21 10/15/21 R/W and Easement Research 9/16/21 9/22/21 Field Data Collection (topography, drainage, vegetation, etc.)9/16/21 9/24/21 Develop Base Mapping (topography and R/W resolution)9/27/21 10/14/21 Submit Topographic Survey and Right of Way Mapping 10/15/21 10/15/21 Sam Task 4: Geotechnical Investigation and Report*9/16/21 11/12/21 Geotechnical Field Investigatoin (drilling Permit and Drilling)10/25/21 10/27/21 Laboratory Testing and Report 10/27/21 11/12/21 Submit Geotechnical Investigation Report 11/12/21 11/12/21 Sam Task 5: Preliminary (30%) Design 9/16/21 10/18/18 Prepare 30% plans 10/18/21 12/3/21 30% Design Review Meeting 11/15/21 11/15/21 Revise 30% Plans and Develop Cost Estimate 11/16/21 12/3/21 Submitt to CPUC and NCRA for review 12/3/21 12/3/21 Task 6: Engineering Design 12/6/21 3/25/22 Prepare 60% Plans, Specifications and Cost Estimate 12/6/21 12/31/21 Submit 60% Plans, Specifications and Cost Estimate 12/31/21 12/31/21 City & NCRA Review of 60% Design 1/1/22 1/8/22 60% Design Review Meeting 1/9/22 1/9/22 Prepare 90% Plans, Specifications and Cost Estimate 1/10/22 2/4/22 Submit 90% Plans, Specifications and Cost Estimate 2/4/22 2/4/22 City & NCRA Review of 90% Design 2/7/22 2/14/22 90% Design Review Meeting 2/7/22 2/7/22 Prepare Final Plans, Specifications and Cost Estimate 2/14/22 3/9/22 Submit Final Plans, Specifications and Cost Estimate 3/10/22 3/10/22 Task 7: Resource Agency Permitting (optional)12/6/21 3/25/22 Task 8: Stormwater pollution prevention plan 2/14/22 3/9/22 Project Start: Display Week:Oct 4, 2021 Oct 11, 2021 Mon, 9/6/2021 Sep 6, 2021 Sep 13, 2021 Sep 20, 2021 Sep 27, 2021 Jan 3, 2022 * We anticipate permitting of the exploratory borings to take 2 weeks. Drilling will take place within one week of receipt of the drilling permit and should take no more than one day to complete. Laboratory testing would take about one week to complete. The geotechnical report will be issued within two weeks after completion of testing. Nov 29, 2021 Dec 6, 2021 Dec 13, 2021 Dec 20, 2021 Dec 27, 2021Nov 1, 2021 Nov 8, 2021 Nov 15, 2021 Nov 22, 2021Oct 18, 2021 Oct 25, 2021 GHD City of Ukiah Great Redwood Trail Phase 4 18 Page 695 of 800 → The Power of Commitment → 3. Project Team 19 Page 696 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 20 GHD's Trail and Transportation Experience Since 1928, GHD has provided exceptional multi- disciplinary engineering, transportation, and environmental services to the public via projects for municipal, State, and federal clients. Our extensive experience in both Ukiah and throughout California providing holistic services makes us ideally suited to assess needed pedestrian and bicycle pathway improvements for the Ukiah community. Working closely with our engineering staff are GHD’s experienced traffic engineers who assist with all aspects of transportation planning. Our firm has managed numerous transportation studies and design projects, transforming travel corridors to serve more livable conditions, creating traffic calming schemes, and designing traffic control systems which favor local bicyclists and pedestrians. We specialize in designing active transportation improvements to create safer communities for motorists, cyclists, and pedestrians alike, as well as utilizing existing infrastructure to promote safety and non-motorized transportation. We have worked on several such rail-with-trail and Safe Routes for Schools projects for the Mendocino Council of Governments; SMART; the cities of Arcata, Eureka, Rio Dell, Cloverdale, Fortuna, San Jose, and Ukiah; and for Humboldt County, all within the past five years. Many of these projects are described, in detail, in Section 6 References. In 2018 the City received an Urban Greening Grant from the state administered by the California Natural Resources Agency for the design and construction of Phase 3 segment of the Great Redwood Trail. For this project, GHD and the design team will support the City as it did with Phase 3 in processing the support documentation needed for project approvals and releasing funds at various stages of the project design and construction. A short section of the Trail runs under the existing Redwood Highway (Hwy 101), requiring a Caltrans Encroachment Permit. GHD will make initial contact with Caltrans to assure →3. Project Team Qualifications and experience of GHD as related to the project GHD is one of the world’s leading engineering and environmental consulting companies. Established in 1928, GHD employs more than 10,000 people across five continents, serving clients in the markets of water, energy and resources, environment, property and buildings, and transportation. Wholly owned by its people, GHD is a global network of engineers, scientists, technicians, landscape architects, and planners collaborating to deliver international expertise and sustainable outcomes for local clients and regional communities. With a staff of over 450 professionals on the West Coast, GHD possesses deep local knowledge and experience but is able to expand on our regional capabilities by leveraging the expertise of our global network. GHD has a deep history serving clients along the northern California Coastal Zone from our offices in Santa Rosa, Roseville, Eureka, San Francisco, Sacramento, Concord, Emeryville, and Cameron Park. This project will be led by our management staff in Santa Rosa, less than an hour’s drive from the project. GHD will be the lead firm on this project, coordinating a team that welcomes long-term partner Alta Planning + Design. Together, our two firms completed Phases 1, 2 and 3 of this section of The Great Redwood Trail for the City of Ukiah. We are able to begin immediately and without unnecessary delay regarding data collection or getting up to speed with project details. Why GHD? −GHD has worked on nearly all designed or completed sections of the Great Redwood Trail. We understand the larger context, vision, and benefits of this project. −GHD has abundant rail-with-trail and rail-to-trail experience in Northern California. We have worked with California Public Utilities Commission (CPUC), North Coast Rail Association (NCRA) and Sonoma-Marin Area Rail Transit (SMART) and know how best to coordinate with and achieve permitting. −We understand the City's goals for this trail as a community destination, economic stimulus, and neighborhood connector. −Existng successful relationship with the City of Ukiah, the NCRA and CPUC −Proven approach to meet your fast-tracked schedule Page 697 of 800 a smooth process when the contractor applies for the Encroachment Permit. Effective environmental impact assessment, permitting, and monitoring requires a solid basis in science. Our staff of scientists is recognized for experience and expertise in wetland ecology, invasive species management, protected species, and habitat restoration. GHD’s approach is to have scientists involved in projects early, to help identify possible environmental issues, and offer feedback on how to minimize impacts through design. GHD biologists and planners prepared biological reports, relevant regulatory permit applications, and a habitat mitigation and monitoring approach for Phase 2 and Phase 3 of the Great Redwood Trail. With input from our environmental team, GHD engineers were able to minimize impacts to the Orrs Creek and Doolin Creek crossings. This ultimately led to more productive engagements with the regulatory agencies, and a streamlined permitting process. For this project, GHD scientists will support the City by preparing necessary biological reports to support CEQA and regulatory permitting efforts lead by the City. GHD's Experience with the City of Ukiah GHD has been working with the City of Ukiah for over a decade, primarily in the context of transportation improvements, though our staff has also completed sanitary sewer master plans and Letter of Map Revisions (LOMR) on, notably, Doolin Creek (which has a bridge that is an important part of this Phase 2), amongst a wide variety of other multidisciplinary work. This includes Phase 1, 2 and 3 of the Great Redwood Trail projects, but also covers such experience as: −Downtown Streetscape, Road Diet & Utilities Project −Redwood Business Park Transportation Improvements −Talmage Interchange Roundabout Conceptual Designs −Perkins Street and Orchard Avenue Intersection Improvements −Replacement Well #4 and New Well #9 Project Additionally, GHD has completed County work located in Ukiah, furthering our understanding of both the region and the relationships therein between municipal and regional agencies and entities: −Rail-with-Trail Corridor Plan | Mendocino Council of Governments (MCOG) −Single Route Project, Mendocino County DOT −Hill Road Bridge Project, Mendocino County DOT −Comptche Road Slide, Mendocino County DOT −Mendocino County Courthouse Infrastructure Project Phases 1, 2, and 3 −Transit Operations and Maintenance Facility, Mendocino Transit Authority (MTA) This experience with and within the City, combined with our experience in trail related projects, transportation infrastructure, and environmental permitting, as well as with our first-hand, extensive knowledge of the project from inception through Phase 1, enables GHD to provide the City of Ukiah with unparalleled service—balancing budget, schedule, and the City’s goals—regarding Phase 4 of the Great Redwood Trail project. Subconsultants Alta Planning + Design Alta Planning + Design (Alta) is North America’s leading multimodal transportation firm that specializes in the planning, design, and implementation of multimodal trail corridors and systems. Founded in 1996, Alta has more than 150 staff in 21 offices across North America and an international workload. Alta is committed to activating communities through innovative design, inclusive planning, and creative encouragement programs. Alta’s experience with trail projects spans a wide range of landscapes from urban to rural including sensitive natural resource areas, parks, rail and utility corridors, street right-of-ways, and suburban and industrial settings. Alta has managed trail projects large and small, from regional, federally-funded to locally-funded projects in small towns across North America. The team understands the complexities of trails and their regulations, funding partners, and politics. Alta also understands the specific needs of trail users including pedestrians, bicyclists, equestrians, mountain cyclists, and those with mobility impairments. Alta employs an outreach process that is inclusive, interactive, and productive. The firm can provide for translation and interpretation to make sure that communities with multi-lingual residents have a voice. Alta’s professionals are experts at listening to the public, conveying technical issues in a clear manner, and explaining trade-offs. Through Alta's straightforward communication style, ability to engage citizens, and Spanish-speaking team of consultants, the team is able to produce outreach strategies and successful designs and plans that meet the needs of the community. GHD City of Ukiah Great Redwood Trail Phase 4 21 Page 698 of 800 GHD's Teaming Experience with Alta Alta and GHD have worked together on several trail projects including the recent Ukiah Great Redwood Trail (Rail with Trail), Phases 1-3, the Humboldt Bay Trail North, and Humboldt Bay Trail South (Great Redwood Trail Segments) in Humboldt County, and the Guadalupe River Trail/Coleman Road Undercrossing in San Jose. Crawford & Associates Crawford & Associates, Inc. (Crawford) was established in 2012 and is a registered Small Business Geotechnical Engineering firm (Certification ID: 1744908) that specializes in large-scale public works projects. In 2016, Crawford merged with Taber Consultants, one of the nation’s oldest Geotechnical Engineering companies. The principals of both firms bring significant geotechnical engineering experience on a wide variety of projects throughout Northern California. Crawford has experience working with various oversight agencies including Counties, Cities, Caltrans, AREMA, Regional Transit, Building Departments, Regional Water Quality Control Boards, FEMA, FHWA, Cal OES, DWR, USACE, DSA, UPRR, CA Fish and Wildlife, Water and Irrigation Districts, Utilities and Environmental Health Departments. Crawford's Experience with the City of Ukiah −Annual Stormwater Monitoring and Reporting - Ford Road Facility −City of Ukiah - Hydroelectric Plant −City of Ukiah Chloride Contact Basin Replacement −City of Ukiah Country Manor Mobile Home Park −City of Ukiah Courthouse Project −City of Ukiah High School SWPPP NOT −City of Ukiah Lake or Streambed Alteration for Three Creeks −City of Ukiah On-Call Planning Services −City of Ukiah Recycled Water Project −City of Ukiah WTP Basin Rehabilitation Project −East Hill Road Bridge over Davis Creek −Ukiah Recycled Water Pipeline-Phase 4 −Industrial Stormwater Monitoring Services - Gobbi −Coal Mine Quarry Closure and Reclamation −North State Street Overcrossing Widening at Haul Road −Hollow Tree Road Intersection at North State Street GHD’s Current and Previous Work with the City of Ukiah −City of Ukiah, Great Redwood Trail Phases 1, 2 and 3 −City of Ukiah, Downtown Streetscape, Road Diet & Utilities Project Phase 1 −City of Ukiah, Downtown Streetscape, Road Diet & Utilities Project Phase 2 −City of Ukiah, Talmage Interchange Improvements −City of Ukiah, Redwood Business Park Transportation Improvements −City of Ukiah, Replacement Well #4 and New Well #9 −City of Ukiah, Perkins Street and Orchard Avenue Intersection Improvements Though we have these current assignments, the team will be committed to the delivery of the Great Redwood Trail Phase 4. GHD City of Ukiah Great Redwood Trail Phase 4 22 Page 699 of 800 Humboldt Bay Trail North: This segment of the Great Redwood Trail in Humboldt County, California has been well received by the public. GHD's team, led by Josh Wolf, provided design and construction management. GHD's key personnel bring unmatched value to your project −Principal-in-Charge, Matt Kennedy has been a project manager on multiple projects with the City of Ukiah for years. −Project Manager, Pat Tortora provided project management and/or design for the recently completed Great Redwood Trail Phases 1, 2 and 3. −Bill Silva, QA/QC reviewer was the Principal-in- Charge on Phases 1, 2 and 3 of the Great Redwood Trail and will continue to work on Phase 4 as QA/QC oversight. −GHD's Frank Penry has vast CPUC experience, having provided both on-call traffic engineering and Railroad At-Grade Crossing Design and Implementation Services to SMART. −Alta's Brian Burchfield and Deven Young is currently working on the Great Redwood Trail Feasibility Study. Overview of GHD's Team GHD has assembled a talented team with an emphasis on demonstrated technical ability and proven track records. The majority of our team members have worked together developing and delivering trail projects for numerous Northern California locations. A number of our team members have also worked with the City on various projects over the past decade. The GHD team has developed valuable skills to efficiently complete complex, high-profile projects by integrating seamlessly and operating as an extension of agency staff. As illustrated in the Organizational Chart on the following page, we offer a comprehensive team and have access to a large network of additional resources to deliver a quality project, within budget and on schedule to help the City achieve its goals. The team is streamlined to be responsive and efficient, yet dynamic, including technical expertise in civil engineering, bridge engineering, stormwater, drainage, grade crossings, utilities coordination, environmental documentation, environmental studies, and planning for environmental mitigation and monitoring. Our team also includes expertise in rail engineering, should it be needed. In addition, we have included subconsultants with expertise in planning and project approval, public outreach, geotechnical engineering, survey, stormwater compliance, and cultural resources. Our team’s combination of experts and rail-trail-savvy individuals, provides the City an incomparable advantage for delivering a successful project with minimal impacts to City staff. Availability In addition to technical ability, our team members were also selected based on availability. Each team member has sufficient availability to commit the appropriate amount of time to your project. Dedication This team of individuals will be dedicated throughout the project, and no staffing changes will occur without prior approval from the City. This dedicated team approach will ensure project continuity and increased efficiency in project delivery, which will be critical to meeting your project goals. Resumes Following the organization chart, we briefly introduce our key personnel and the services they will provide. Full, detailed resumes can be found in the Appendix. GHD City of Ukiah Great Redwood Trail Phase 4 23 Page 700 of 800 GHD Client Name Proposal Title 24 Proposed Team Organization For Phase 4 of the Great Redwood Trail project, we propose the following team. The majority of this team worked together on Phases 1, 2 and 3. Additional staff may be called on if needed. Civil Design Lead Jeremy Schmal, PE Support Haytham Daas, EIT Alice Park, EIT Stormwater/LID Kat Harvey, PE, QSD/QSP Traffic/CPUC Coordination Frank Penry, PE, TE, PTOE Byung Lee, PE, TE Structural Steve Burns, PE, SE, ME, LEED AP Stephanie Gould, PE Planning & Landscape Design Alta Planning + Design, Inc. Lead Brian Burchfield, PLA Support Deven Young, PLA Ryan Booth Carmela Sambo Pat Tortora, PE, LEED AP Bill Silva, PE, QSP/QSDMatt Kennedy, PE, TE Survey Lead Richard Maddock, PLS Support Brian Howard, PLS Jackie Bohannon Aerial Drone Survey Harrison Hummel, Part 107 UAV Pilot Geotechnical Crawford & Associates, Inc. Lead Chris Trumball, PE, GE, D.GE Support Keiko Lewis Environmental Permitting* Lead Haley Cahill Support Kelsey McDonald Elizabeth Meisman Agency Permitting Lead Josh Wolf, PE, QSD/QSP Support Brandon Tenney, PE, QSD/QSP Principal-in-Charge QA/QC Review Project Manager Public Outreach Support* Alta Planning + Design, Inc. Lead Brian Burchfield, PLA Support Deven Young, PLA Ryan Booth Carmela Sambo Landscape Irrigation Lucas Piper, LLA, QSD/QSP Electrical Lead Rick Guggiana, EE, LEED AP Support Erick Osorno, EE** * Optional Tasks To be provided, as needed ** EE license pending approval Page 701 of 800 Matt Kennedy, PE, TE | Principal-in-Charge Matt is a principal engineer with 18 years of experience in delivering a wide variety of civil infrastructure projects. His project experience includes water and recycled water, sewer, drainage, traffic/transportation, buildings and sustainable site development. He is adept in the management and design of multi-discipline projects with medium to large teams and numerous stakeholders and including construction management. His projects involve planning, environmental compliance, design, permitting and construction. Project elements include water tanks, wells, water transmission/ distribution, sewer collection, pump stations, stormwater conveyance, Low Impact Development (LID), grading and drainage, civil site design, traffic signals, roadways, retaining walls, pedestrian and bicycle facilities, and traffic control. His experience also includes a broad range of planning, modeling and analysis capabilities, including utility master planning, hydrologic and hydraulic modeling, water and wastewater process design, traffic and parking studies, and circulation studies. Matt is also experienced in land surveying and construction management. Matt has been managing engineering projects with the City of Ukiah for the past 10 years. Experience in supervising similar work: −City of Ukiah Great Redwood Trail (Rail Trail) Phases 1-3, Ukiah, CA −City of Ukiah Perkins Street and Orchard Avenue Intersection Improvements −City of Ukiah Talmage Interchange Improvements −City of Ukiah Replacement Well #4 and New Well #9 −City of Ukiah Redwood Business Park Transportation Improvements Pat Tortora, PE, LEED AP | Project Manager For more than 25 years, Pat has served as a project engineer or project manager on multidisciplinary projects providing planning, design, and construction engineering solutions to communities and public agencies, both large and developing, throughout the Western US, with an emphasis on K-12 schools site design. For school districts, municipal entities, and governmental organizations throughout the Portland Metro Area, Southeast Washington, California, and Guam, Pat has overseen civil site infrastructure improvements that attend to stormwater quality concerns, utility infrastructure, pedestrian and vehicular safety measures, and sustainably minded, comprehensive sewer, water, and civil site work. Pat was the Design Engineer for Phase 1 and the Project Manager for Phases 2 and 3. Experience in supervising similar work: −City of Ukiah Great Redwood Trail (Rail Trail) Phases 1-3, Ukiah, CA −SMART Various Non-Motorized Pathway Segments, Sonoma County, CA −SMART Payran Street to Southpoint Boulevard Multi-Use Pathway, Petaluma, CA Bill Silva, PE, QSD/QSP | QA/QC Review With over 25 years of experience in public sector civil engineering, transportation, and pipeline design, Bill is highly skilled at CIP and Public Works project design, including: large-scale redevelopment, roadway and bridge design, railroad design, various water, sewer and storm drain projects, and a broad background in all phases of project planning and design through construction. Bill has been a County Public Works engineer, an Assistant City Engineer, and led development review services. In addition, he has managed multi-million dollar infrastructure improvement projects throughout Northern California. Experience in supervising similar work: −City of Ukiah Great Redwood Trail (Rail Trail) Phases 1-3, Ukiah, CA −SMART Various Non-Motorized Pathway Segments, Sonoma County, CA −SMART Payran Street to Southpoint Boulevard Multi-Use Pathway, Petaluma, CA −Eureka Waterfront Trail (A great Redwood Trail Segment), Eureka, CA Team Member Qualifications GHD provides the largest capacity and amount of resources available. GHD is fully staffed and capable of providing the right services to our clients in a timely fashion. The following qualifications are that of our lead staff. Full resumes for the entire project team are located in the Appendix. GHD City of Ukiah Great Redwood Trail Phase 4 25 Page 702 of 800 Rick Guggiana, EE, LEED AP | Electrical Lead Rick is a licensed electrical engineer with over 29 years of experience in the electrical, controls, and instrumentation fields, for federal, military, municipal, and private industrial clients. He has extensive experience with water treatment, storage, and pumping systems, wastewater collection and treatment systems, pumping controls, Supervisory Control and Data Acquisition (SCADA) systems, low and medium-voltage power generation, microgrids, and waterfront electrical distribution. Rick has led large-scale coordination and arc flash studies, desk-top radio path modeling, photometric analyses, forensic studies, feasibility studies, condition assessments, construction cost estimates, and engineering services during construction. He has also written design-build Requests for Proposal (RFP’s) and has served as the client’s representative, as well has served as the lead electrical engineer on contractor-led design-build teams. Richard Maddock, PLS | Survey Lead Richard is a California registered professional land surveyor. He has over 20 years of experience in all aspects of land surveying. He is an experienced party chief working on projects varying from winery construction staking to subdivisions. With the budget and time line in mind he delivers a superior product for the client. In the field he will be the Party Chief of the primary survey crew. Being the Party Chief will provide him with first-hand knowledge of the site, the condition of the existing monuments and other important information critical to producing an accurate survey performance areas. Frank Penry, PE, TE, PTOE | CPUC/Traffic Coordination A registered traffic engineer and civil engineer with certification as a professional traffic operations engineer, Frank Penry has 25-years of experience in transportation planning and traffic engineering design. He has managed numerous transportation studies and design projects over the years, from small development impact studies to major roadway improvements. Frank has served as the City Traffic Engineer for the Cities of Petaluma, Cotati, Sonoma, Windsor, and Fortuna, providing the administration and development of Municipal Traffic Engineering Programs. He is well-versed in a wide range of traffic engineering design standards and encroachment requirements, traffic signals, roundabouts, traffic calming and streetscapes, construction traffic handling, detour, and control plans for a variety of civil engineering projects. His experience includes traffic operations, traffic signal timing and design, Intelligent Transportation Systems (ITS), Transit Signal Priority (TSP), feasibility studies; environmental studies and documents; roadway and intersection design; signing and striping design; and traffic control plans. Josh Wolf, PE, QSD/QSP | Agency Permitting Lead Josh is a senior engineer with over 18 years of experience designing and managing a wide range of transportation infrastructure projects including both motorized and non- motorized improvements. He is an expert in leading the planning, environmental, design and construction oversight of federally-funded projects for local agencies in northern California. His project experience includes the design of public infrastructure projects that include roadway improvements, highway interchanges, intersection improvements, bicycle and pedestrian facilities, Class I trails, storm drainage improvements and stormwater treatment facilities. Jeremy Schmal, PE | Civil Design Lead Jeremy has over 15 years of experience in civil engineering working with the public sector. He has performed project management and project engineer duties on numerous multimillion dollar public works transportation improvement projects including roundabouts, trails, roadway widening, utility relocation, intersection improvements and traffic signals, and pedestrian improvement projects. Jeremy also has experience in construction management, where he has acted as Resident Engineer and Lead Inspector. Other experience includes traffic engineering, analysis and planning, federal aid funding, high-visibility pedestrian projects and construction and bid support. GHD City of Ukiah Great Redwood Trail Phase 4 26 Page 703 of 800 Brian Burchfield, PLA | Planning & Landscape Design Lead/Outreach Support (optional), Alta Planning + Design Brian is a registered landscape architect whose expertise includes management of complex construction documents, permit agency coordination, irrigation plans, planting and landscape plans, on-street bicycle and pedestrian facilities, and separated multi-use pathways. Brian’s been heavily involved with all three previous phases on the Ukiah Rail Trail, including managing phases two and three. He’s excited to have a part in the implementation the next phase. Seeing how the Ukiah community has embraced the trail has been one of the highlights of his 12-year career. Chris Trumball, PE, GE, D.GE | Geotechnical Lead, Crawford & Associates Chris has more than 32 years of experience with civil, geotechnical, and pavement engineering and project management services for a variety of clients throughout California and the western US. Chris also manages large and complex geotechnical projects, including pavements, transportation, public works, essential facilities, flood control, power, industrial, commercial, residential, and ports. His technical experience includes field exploration and testing, seismic analysis, liquefaction mitigation, geologic hazards, shallow and deep foundations, retaining walls, mass grading earthwork and testing, underground structures and utilities, tie backs, rock anchors, shoring, chemical treatment of soils, grouting, mitigation of expansive soils, surcharging compressible soils, rigid and flexible pavement design, slope evaluation and stabilization, and implementation of geosynthetics. Haley Cahill | Environmental Permitting Lead Haley Cahill has five years of environmental planning experience, focusing on preparing documents in compliance with the California Environmental Quality Act (CEQA), National Environmental Policy Act (NEPA), as well as preparing permits for various regulatory agencies including: the Bay Conservation and Development Commission (BCDC), California Department of Fish and Wildlife (CDFW), the Regional Water Quality Control Board (RWQCB), and the US Army Corps of Engineers (USACE). Haley has prepared environmental documentation and technical analysis on various project types including infrastructure, parks and trails, and residential developments. Lucas Piper, LLA, QSD/QSP | Landscape Irrigation Lucas is a registered landscape architect with over 14 years of private development, roadway / intersection related design, and habitat restoration experience. He is a certified Qualified SWPPP Developer/Practitioner (QSD/P) and has worked on a number of stormwater pollution management, stabilization, and Low-Impact Development (LID) projects. Lucas supports and provides landscape architectural services for a multitude of GHD consulting projects by providing an array of services including site analysis; site planning; geospatial analysis; conceptual design development; 3D renderings; construction document Plans, Specifications, and Estimates (PS&E); and SWPPP’s. GHD City of Ukiah Great Redwood Trail Phase 4 27 Page 704 of 800 Man-Hours The estimated man-hours below are an approximation for developing the total fee and could change as the design progresses. Name Role Man-Hours Budgeted Matt Kennedy, PE, TE Principal-in-Charge 22 Pat Tortora, PE, LEED AP Project Manager 176 Bill Silva, PE, QSD/QSP QA/QC Review 22 Josh Wolf, PE, QSD/QSP Agency Permitting Lead 4 Brandon Tenney, PE, QSD/QSP Agency Permitting Support 12 Jeremy Schmal, PE Civil Design Lead 136 Haytham Daas, EIT Civil Design Support 208 Kat Harvey, PE, QSD/QSP Stormwater/LID 40 Frank Penry, PE, TE, PTOE Traffic/CPUC Coordination 32 Byung Lee, PE, TE Traffic/CPUC Coordination 62 Steve Burns, PE, SE, ME, LEED AP Structural 50 Stephanie Gould, PE Structural 60 Richard Maddock, PLS Survey Lead 30 Brian Howard, PLS Survey Support 14 Jackie Bohannon Survey Support 48 Harrison Hummel, Part 107 UAV Pilot Aerial Drone Survey 60 Rick Guggiana, EE, LEED AP Electrical Lead 46 Erick Osorno, EE**Electrical Support 56 Lucas Piper, LLA, QSD/QSP Landscape Irrigation 82 Haley Cahill Environmental Permitting Lead optional Kelsey McDonald Environmental Permitting Support optional GHD City of Ukiah Great Redwood Trail Phase 4 28 Page 705 of 800 Name Role Man-Hours Budgeted Elizabeth Meisman Environmental Permitting Support optional Chris Trumball, PE, GE, D.GE, Crawford & Associates Geotechnical Lead 40 Keiko Lewis, Crawford & Associates Geotechnical Support 62 Deven Young, PLA, Alta Planning + Design Planning & Landscape Design 12 Brian Burchfield, PLA, Alta Planning + Design Planning & Landscape Design Lead 80 Ryan Booth, Alta Planning + Design Planning & Landscape Design Support 78 Carmela Sambo, Alta Planning + Design Planning & Landscape Design Support 204 GHD City of Ukiah Great Redwood Trail Phase 4 29 Page 706 of 800 Page 707 of 800 → The Power of Commitment → 4. Example Work Product 31 Page 708 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 32 0 10'20' SCALE: 1" = 10' 21 6/ 2 6 / 2 0 1 9 9 : 4 3 A M L101 PROPOSED PATH LIGHT LEGEND 1 EC : 1 ID : 1 LB SEE PLANT LIST FOR QUANTITIES MA T C H L I N E - S E E A B O V E MA T C H L I N E - S E E B E L O W MA T C H L I N E - S E E L 1 0 2 This document shall not be used forconstruction unless signed and sealed for construction.Sheet No. Original Size Title Project ClientDesignerDrawn Scale Plot Date:Filename:26 June 2019 - 9:43 AM \\EgnyteDrive\altaplanning\Shared\PROJECTS\2018\00-2018-297 Ukiah, CA NW Pacific Rail Trail Phase 3\cad\18_297_L101.dwg ANSI D Date Plotted By: Brian Burchfield Project No. Sheet of Reuse of Documents This document and the ideas and designs incorporated herein, as an instrument of professional service, is the property of GHD and shall not be reused in whole or in partfor any other project without GHD's written authorization. © 2019 GHD Drafting Check01" Bar is one inch on original size sheet Design Check IssueNo.Drawn Approved Date Project Manager CITY OF UKIAHNORTHWESTERN PACIFIC RAIL TRAIL PROJECT - PH 3 11183508 35 PRT 3/5/2019 2235 Mercury Way Suite 150 Santa Rosa California 95407 USA T 1 707 523 1010 F 1 707 527 8679 W www.ghd.com GHD Inc. BHADSA SUBMITTAL0 PRT 04/02/19 BHAISSUE FOR BID/DSA BACKCHECK1 PRT 06/28/19 www.altaplanning.com 100 Webster Street 510.540.5008 Oakland, CA 94607 PLANNING + DESIGN RENEWAL DATE LIC. #6173 BRIAN D BURCHFIELD 11-19-20 PLANTING PLAN 1 OF 3 P. TORTORA 04/02/2019 RB/BB MS/BB RB/BB MS/BB APPROVED DIV. OF THE STATE ARCHITECT APP.INC: REVIEWED FOR SS FLS ACS DATE: 01-118147 07/08/2019 → 4. E x a m p l e W o r k P r o d u c t As r e q u e s t e d i n t h e C i t y o f U k i a h ’ s R e q u e s t f o r P r o p o s a l S p e c i f i c a t i o n N o . 2 1 - 0 2 , p l e a s e s e e t h e f o l l o w i n g e x a m p l e w o r k p r o d u c t s : ex a m p l e L a n d s c a p e P l a n , e x a m p l e P l a n a n d P r o f i l e , a n d a n e x a m p l e P o n d D r a i n a g e P l a n Example Landscape Plan Page 709 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 33 0+00 1+00 2+00 3+00 4+00 5+00 0+00 1+00 2+00 3+00 4+00 5+00 0+ 0 0 1+00 1+ 9 8 9' 89' BRIDGE R1 0 0 ' R1 0 0 ' R1 0 0 ' R5 0 ' 10 . 0 0 ' 5. 0 0 ' 16 . 0 0 ' STA 0+18.53 N: 2184846.8879 E: 6219870.4085 EL E V A T I O N 603 610 620 630 603 610 620 630 0+00 0+50 1+00 1+50 2+00 2+50 3+00 3+50 4+00 4+50 5+00 ST A = 0 + 0 9 . 8 7 EL = 6 1 9 . 4 7 FA C E O F C U R B ( F L O W L I N E ) ST A = 0 + 1 8 . 5 3 EL = 6 1 9 . 2 7 ST A = 0 + 3 4 . 0 0 EL = 6 1 9 . 4 9 PVI STA = 2+60.00 PVI EL = 621.75 K = 8.00 L = 30.00' BV C S = 2 + 4 5 . 0 0 BV C E = 6 2 1 . 0 4 EV C S = 2 + 7 5 . 0 0 EV C E = 6 2 1 . 9 0 PVI STA = 4+00.00 PVI EL = 621.76 K = 6.66 L = 25.00' BV C S = 3 + 8 7 . 5 0 BV C E = 6 2 1 . 8 8 EV C S = 4 + 1 2 . 5 0 EV C E = 6 2 1 . 1 6 PVI STA = 2+30.00 PVI EL = 620.32 K = 7.78 L = 30.00' BV C S = 2 + 1 5 . 0 0 BV C E = 6 2 0 . 1 9 EV C S = 2 + 4 5 . 0 0 EV C E = 6 2 1 . 0 4 PVI STA = 4+72.00 PVI EL = 618.34 K = 7.22 L = 40.00' BV C S = 4 + 5 2 . 0 0 BV C E = 6 1 9 . 2 9 EV C S = 4 + 9 2 . 0 0 EV C E = 6 1 8 . 4 9 PVI STA = 0+90.00 PVI EL = 619.07 K = 15.21 L = 25.00' BV C S = 0 + 7 7 . 5 0 BV C E = 6 1 9 . 1 7 EV C S = 1 + 0 2 . 5 0 EV C E = 6 1 9 . 1 9 BE G I N B R I D G E ST A = 2 + 8 5 . 0 0 EL = 6 2 2 . 0 0 EN D B R I D G E ST A = 3 + 7 5 . 8 3 EL = 6 2 2 . 0 0 89' BRIDGE POTENTIAL LIMITS OF CREEK SCOUR 100 YEAR FLOOD PLAIN ELEV=618.0 ORDINARY HIGH WATER ELEV=610.0 -2.50% 1.00% -4.75% 1.42%-0.75%0.89% 0.00%-1.00% 4.75% 1 TRAIL PLAN STA 0+00 TO STA 5+00 2 TRAIL PROFILE STA 0+00 TO STA 5+00 0 40'20' VERTICAL HORIZONTAL 0 8'4' M A T C H L I N E S T A 5 + 0 0 S E E S H E E T C 1 0 2 N SHEET GENERAL NOTES 1. LOCATION OF EXISTING UTILITIES AND STRUCTURES ARE FROM INFORMATION AVAILABLE AT THE TIME OF DESIGN. EXACT LOCATION AND COMPLETENESS ARE NOT GUARANTEED. CONTRACTOR SHALL NOTIFY THE OWNER AND UNDERGROUND SERVICES ALERT (U.S.A.) (800) 277-2600 A MINIMUM OF 48 HOURS PRIOR TO ANY EXCAVATION. CONTRACTOR TO VERIFY ACTUAL SITE CONDITIONS PRIOR TO PERFORMING WORK. 2. SEE SHEET C202 FOR MASON STREET CURB PLAN AND PROFILE IMPROVEMENTS. 3. SEE SHEET C401 FOR CLARA AVENUE INTERSECTION IMPROVEMENT PLAN. EXISTING BUILDING EXISTING BUILDING EXISTING BUILDING (E) NCRA RAILROAD CENTER LINE 9' MINIMUM SETBACK LINE 10' WIDE ASPHALT TRAIL WITH 2' GRAVEL SHOULDERS (E) PROPERTY LINE (E) PROPERTY LINE EXISTING ASPHALT PARKING LOTEXISTING BUILDING BIORETENTION FACILITY POND 1 (E) GRADE AT CL FINISHED GRADE AT CL (E) GRADE AT 7' LT (E) GRADE AT 7' RT CONSTRUCT (N) RETAINING WALL BEGIN AT STA 2+45 CONSTRUCT (N) RETAINING WALL END AT STA 4+55 TRAIL PLAN AND PROFILE STA 0+00 TO STA 5+00 C101 8 B. ARTITA P. TORTORA M. KENNEDY M. KENNEDY AS SHOWN BIORETENTION FACILITY POND 2 BIORETENTION FACILITY SOUTH POND TOP OF SLOPE TOE OF SLOPE TOE OF SLOPE TOP OF SLOPE ORDINARY HIGH WATER EL=610.00 ORDINARY HIGH WATER EL=612.00 (N) 8" PVC STORM DRAIN PIPE (N) 8" PVC STORM DRAIN PIPE (N) 6" PVC STORM DRAIN PIPE ORRS CREEK TRAIL CONNECTION (N) 6" PVC STORM DRAIN PIPE SAVE AND PROTECT (E) FENCE SAVE AND PROTECT (E) FENCE 1 C501 1 C301 1 C302 1 C302TRAIL LIGHTING, TYP.1 E101 1 S103 1 S1021 S102 M A S O N S T R E E T C L A R A A V E N U E O R R S C R E E K (E) EDGE OF PAVEMENT TO BE DEMOLISHED SAVE AND PROTECT (E) SANITARY SEWER MANHOLE SAVE AND PROTECT (E) SANITARY SEWER LINE DEMOLISH AND REMOVE EXISTING RR CONTROL CABINET. CUT EXPOSED CONDUIT AND CONDUCTORS BELOW GRADE.CABINET MAY CONTAIN HAZARDOUS MATERIAL THAT NEEDS TO BE DISPOSED OF IN A PROPER FASHION AT AN APPROVED DISPOSAL SITE. EXISTING BUILDING REMOVE (E) TREE REMOVE (E) PINE TREE SAVE AND PROTECT (E) OAK TREE FLOOD PLAIN/HAZARD INFORMATION: FLOOD ZONE DESIGNATION: FLOODWAY, ZONE AE, ZONE X FLOOD INSURANCE RATE MAP PANEL: 1512 AND 1514 EFFECTIVE DATE OF FIRM: 6/2/2011 BASE FLOOD ELEVATION: 618 APPLICABLE COMMUNITY ORDINANCE SECTION: CITY OF UKIAH CODE CHAPTER 6 FLOODPLAIN MANAGEMENT (N) 42" CHAINLINK FENCE REMOVE (E) TREES (N) "ROAD XING" MARKINGS PER CA-MUTCD, LETTERS 4" TALL WORDS SPACED 5' APART (N) "ROAD XING" MARKINGS PER CA-MUTCD, LETTERS 4" TALL WORDS SPACED 5' APART (N) BOLLARD LIGHT, TYP. (N) "STOP AHEAD" SIGN TYPE W3-1 STA 1+87.75, 7.5' RT (N) "STOP AHEAD" SIGN TYPE W3-1 STA 4+59.23, 7.5' RT 1 E101 12 " This document shall not be used for construction unless signed and sealed for construction.Sheet No. Original Size Title Project ClientDesignerDrawn Scale Plot Date:Filename:2 July 2019 - 4:28 PM N:\US\Portland\Projects\111\11183508 Ukiah NWP Rail Trail Phase 3\06-CAD\Sheets\11183508_C101_PLAN AND PROFILES.dwg ANSI D Date Plotted By:Briana Artita Project No. Sheet of Reuse of Documents This document and the ideas and designs incorporated herein, as an instrument of professional service, is the property of GHD and shall not be reused in whole or in part for any other project without GHD's written authorization.© 2019 GHD Drafting Check01" Bar is one inch on original size sheet Design Check IssueNo.Drawn Approved Date Project Manager CITY OF UKIAHNORTHWESTERN PACIFIC RAIL TRAIL PROJECT - PH 3 11183508 35 P. TORTORA 04/02/2019 2235 Mercury Way Suite 150 Santa Rosa California 95407 USA T 1 707 523 1010 F 1 707 527 8679 W www.ghd.com GHD Inc. BHADSA SUBMITTAL0 PRT 04/02/19 BHAISSUE FOR BID / DSA BACKCHECK1 PRT 06/28/19 1 C502 APPROVED DIV. OF THE STATE ARCHITECT APP.INC: REVIEWED FOR SS FLS ACS DATE: 01-118147 07/08/2019 Example Plan and Profile page 1 of 3 Page 710 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 34 FO R D S T R E E T 5+00 6+00 7+00 8+00 9+00 10+00 FO R D S T R E E T R 1 0 0 ' 9' 2' 10 ' 2' R 5 0 ' R40 ' R7 5 ' R 9 0 ' R 9 0 ' EL E V A T I O N EL E V A T I O N 610 620 630 610 620 630 5+00 5+50 6+00 6+50 7+00 7+50 8+00 8+50 9+00 9+50 10+00 3.58%-4.02%-1.90%0.79%-1.00%1.90%1.00% PVI STA = 5+36.00 PVI EL = 618.84 K = 13.97 L = 25.00' BV C S = 5 + 2 3 . 5 0 BV C E = 6 1 8 . 7 4 EV C S = 5 + 4 8 . 5 0 EV C E = 6 1 8 . 7 2 PVI STA = 6+20.00 PVI EL = 618.93 K = 4.35 L = 25.00' BV C S = 6 + 0 7 . 5 0 BV C E = 6 1 8 . 8 1 EV C S = 6 + 3 2 . 5 0 EV C E = 6 1 8 . 3 4 PVI STA = 6+45.00 PVI EL = 617.74 K = 5.76 L = 25.00' BV C S = 6 + 3 2 . 5 0 BV C E = 6 1 8 . 3 4 EV C S = 6 + 5 7 . 5 0 EV C E = 6 1 7 . 6 9 FA C E O F C U R B ( F L O W L I N E ) ST A = 5 + 5 9 . 3 4 EL = 6 1 8 . 5 7 FA C E O F C U R B ( F L O W L I N E ) ST A = 5 + 9 3 . 6 5 EL = 6 1 8 . 6 3 BA C K O F S I D E W A L K ST A = 5 + 9 7 . 9 5 EL = 6 1 9 . 0 9 BA C K O F S I D E W A L K ST A = 5 + 5 5 . 1 1 EL = 6 1 8 . 6 5 -4.75% -0.41% 1 TRAIL PLAN STA 5+00 TO STA 10+00 2 TRAIL PROFILE STA 5+00 TO STA 10+00 M A T C H L I N E S T A 5 + 0 0 S E E S H E E T C 1 0 1 MA T C H L I N E S T A 1 0 + 0 0 S E E S H E E T C 1 0 3 N SHEET GENERAL NOTES 1. LOCATION OF EXISTING UTILITIES AND STRUCTURES ARE FROM INFORMATION AVAILABLE AT THE TIME OF DESIGN. EXACT LOCATION AND COMPLETENESS ARE NOT GUARANTEED. CONTRACTOR SHALL NOTIFY THE OWNER AND UNDERGROUND SERVICES ALERT (U.S.A.) (800) 277-2600 A MINIMUM OF 48 HOURS PRIOR TO ANY EXCAVATION. CONTRACTOR TO VERIFY ACTUAL SITE CONDITIONS PRIOR TO PERFORMING WORK. 2. SEE SHEET C402 FOR FORD STREET INTERSECTION IMPROVEMENT PLAN. 3. SEE SHEET C303 FOR STORM DRAINAGE PLAN AND PIPE PROFILE DETAILS. (E) NCRA RAILROAD CENTER LINE 9' MINIMUM SETBACK LINE 10' WIDE ASPHALT TRAIL WITH 2' GRAVEL SHOULDERS 10' WIDE ASPHALT TRAIL WITH 2' GRAVEL SHOULDERS (E) PROPERTY LINE (E) PROPERTY LINE(E) FENCE TO REMAIN BIORETENTION FACILITY POND 3 FORD STREET INTERSECTION FINISH GRADE AT CL(E) GRADE AT CL (E) GRADE AT 7' LT(E) GRADE AT 7' RT 0 40'20' VERTICAL HORIZONTAL 0 8'4' TRAIL PLAN AND PROFILE STA 5+00 TO STA 10+00 C102 9 B. ARTITA P. TORTORA M. KENNEDY M. KENNEDY AS SHOWN 1 C302 1 C501 1 C501 TRAIL LIGHTING, TYP.1 E101 (N) 6" PVC STORM DRAIN PIPE (N) PRE-CAST DROP INLET (N) PRE-CAST DROP INLET F O R D S T R E E T (N) 6" PVC STORM DRAIN PIPE (E) SANITARY SEWER LINE (N) PRE-CAST CURB INLET (N) 8" STORM DRAIN PIPE (N) 12" STORM DRAIN PIPE (N) 12" STORM DRAIN PIPE (E) STORM DRAIN OUTFALL TO ORRS CREEK IE=609.08 SAVE AND PROTECT (E) STORM DRAIN LINE SAVE AND PROTECT (E) SANITARY SEWER LINE REMOVE (E) TREE (N) 8" PVC STORM DRAIN PIPE (N) 12" PVC STORM DRAIN PIPE (E) STORM DRAIN PIPE(E) WATER LINE (N) PRE-CAST CURB INLET (N) "ROAD XING" MARKINGS PER CA-MUTCD, LETTERS 4" TALL WORDS SPACED 5' APART (N) "STOP AHEAD" SIGN TYPE W3-1 REMOVE AND REPLACE (E) FENCE ALONG (E) PROPERTY LINE FLOW SPREADER4 C501 This document shall not be used for construction unless signed and sealed for construction.Sheet No. Original Size Title Project ClientDesignerDrawn Scale Plot Date:Filename:2 July 2019 - 4:28 PM N:\US\Portland\Projects\111\11183508 Ukiah NWP Rail Trail Phase 3\06-CAD\Sheets\11183508_C101_PLAN AND PROFILES.dwg ANSI D Date Plotted By:Briana Artita Project No. Sheet of Reuse of Documents This document and the ideas and designs incorporated herein, as an instrument of professional service, is the property of GHD and shall not be reused in whole or in part for any other project without GHD's written authorization.© 2019 GHD Drafting Check01" Bar is one inch on original size sheet Design Check IssueNo.Drawn Approved Date Project Manager CITY OF UKIAHNORTHWESTERN PACIFIC RAIL TRAIL PROJECT - PH 3 11183508 35 P. TORTORA 04/02/2019 2235 Mercury Way Suite 150 Santa Rosa California 95407 USA T 1 707 523 1010 F 1 707 527 8679 W www.ghd.com GHD Inc. BHADSA SUBMITTAL0 PRT 04/02/19 BHAISSUE FOR BID / DSA BACKCHECK1 PRT 06/28/19 (N) 42" CHAINLINK FENCE1 C502 APPROVED DIV. OF THE STATE ARCHITECT APP.INC: REVIEWED FOR SS FLS ACS DATE: 01-118147 07/08/2019 Example Plan and Profile page 2 of 3 Page 711 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 35 10+00 11+00 12+00 13+00 14+00 14+88 10+00 11+00 12+00 13+00 14+00 R 5 0 ' R 5 0 ' END TRAIL STA 14+48.61 N: 2186255.1996 E: 6219777.9883 2' 10 ' 2' 9' EL E V A T I O N EL E V A T I O N 610 620 630 610 620 630 10+00 10+50 11+00 11+50 12+00 12+50 13+00 13+50 14+00 14+50 14+89 -1.90% -0.41% EL = 6 1 4 . 3 0 FA C E O F C U R B ( F L O W L I N E ) ST A = 1 4 + 4 8 . 6 2 EL = 6 1 4 . 4 6 ST A = 1 4 + 4 0 . 1 2 -1.90% -0.41% 1 TRAIL PLAN STA 5+00 TO STA 15+00 2 TRAIL PROFILE STA 10+00 TO STA 15+00 MA T C H L I N E S T A 1 0 + 0 0 S E E S H E E T C 1 0 2 N SHEET GENERAL NOTES 1. LOCATION OF EXISTING UTILITIES AND STRUCTURES ARE FROM INFORMATION AVAILABLE AT THE TIME OF DESIGN. EXACT LOCATION AND COMPLETENESS ARE NOT GUARANTEED. CONTRACTOR SHALL NOTIFY THE OWNER AND UNDERGROUND SERVICES ALERT (U.S.A.) (800) 277-2600 A MINIMUM OF 48 HOURS PRIOR TO ANY EXCAVATION. CONTRACTOR TO VERIFY ACTUAL SITE CONDITIONS PRIOR TO PERFORMING WORK. 2. SEE SHEET C403 FOR BRUSH STREET INTERSECTION IMPROVEMENT PLAN. (E) NCRA RAILROAD CENTER LINE 9' MINIMUM SETBACK LINE 10' WIDE ASPHALT TRAIL WITH 2' GRAVEL SHOULDERS (E) FENCE TO BE REMOVED NEIGHBORING PROPERTY OWNER SHALL REMOVE ALL BELONGINGS FROM NCRA RIGHT OF WAY (E) PROPERTY LINE (E) PROPERTY LINE (E) FENCE TO BE REMOVED NEIGHBORING PROPERTY OWNER SHALL REMOVE ALL BELONGINGS FROM NCRA RIGHT OF WAY (E) FENCE TO BE REMOVED NEIGHBORING PROPERTY OWNER SHALL REMOVE ALL BELONGINGS FROM NCRA RIGHT OF WAY (E) GRADE AT CL FINISHED GRADE AT CL (E) GRADE AT 7' RT (E) GRADE AT 7' LT 0 40'20' VERTICAL HORIZONTAL 0 8'4' TRAIL PLAN AND PROFILE STA 10+00 TO END C103 10 B. ARTITA P. TORTORA M. KENNEDY M. KENNEDY AS SHOWN 1 C50110' WIDE ASPHALT TRAIL WITH 2' GRAVEL SHOULDERS 1 C501 SAVE AND PROTECT (E) CABINET AND ELECTRICAL PANELTRAIL LIGHTING, TYP.1 E102 B R U S H S T R E E T SAVE AND PROTECT (E) UTILITY POLE SAVE AND PROTECT (E) FENCE SAVE AND PROTECT (E) FENCE SAVE AND PROTECT (E) FENCE (N) "ROAD XING" MARKINGS PER CA-MUTCD, LETTERS 4" TALL WORDS SPACED 5' APART (N) "STOP AHEAD" SIGN TYPE W3-1 STA 12+89.21, 7.5' RT This document shall not be used for construction unless signed and sealed for construction.Sheet No. Original Size Title Project ClientDesignerDrawn Scale Plot Date:Filename:2 July 2019 - 4:28 PM N:\US\Portland\Projects\111\11183508 Ukiah NWP Rail Trail Phase 3\06-CAD\Sheets\11183508_C101_PLAN AND PROFILES.dwg ANSI D Date Plotted By:Briana Artita Project No. Sheet of Reuse of Documents This document and the ideas and designs incorporated herein, as an instrument of professional service, is the property of GHD and shall not be reused in whole or in part for any other project without GHD's written authorization.© 2019 GHD Drafting Check01" Bar is one inch on original size sheet Design Check IssueNo.Drawn Approved Date Project Manager CITY OF UKIAHNORTHWESTERN PACIFIC RAIL TRAIL PROJECT - PH 3 11183508 35 P. TORTORA 04/02/2019 2235 Mercury Way Suite 150 Santa Rosa California 95407 USA T 1 707 523 1010 F 1 707 527 8679 W www.ghd.com GHD Inc. BHADSA SUBMITTAL0 PRT 04/02/19 BHAISSUE FOR BID / DSA BACKCHECK1 PRT 06/28/19 (N) 42" CHAINLINK FENCE1 C502 APPROVED DIV. OF THE STATE ARCHITECT APP.INC: REVIEWED FOR SS FLS ACS DATE: 01-118147 07/08/2019 Example Plan and Profile page 3 of 3 Page 712 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 36 EL E V A T I O N EL E V A T I O N 600 610 620 630 600 610 620 630 0+15 0+50 1+00 1+50 2+00 2+50 3+00 3+20 4+00 5+00 6+00 0+00 1+00 2+00 3+ 0 0 3+ 1 9 NORTH PONDS DRAINAGE PLAN C303 15 B. ARTITA P. TORTORA M. KENNEDY M. KENNEDY AS SHOWN SHEET GENERAL NOTES 1. LOCATION OF EXISTING UTILITIES AND STRUCTURES ARE FROM INFORMATION AVAILABLE AT THE TIME OF DESIGN. EXACT LOCATION AND COMPLETENESS ARE NOT GUARANTEED. CONTRACTOR SHALL NOTIFY THE OWNER AND UNDERGROUND SERVICES ALERT (U.S.A.) (800) 277-2600 A MINIMUM OF 48 HOURS PRIOR TO ANY EXCAVATION. CONTRACTOR TO VERIFY ACTUAL SITE CONDITIONS PRIOR TO PERFORMING WORK. 2. SEE SHEET C302 FOR BIORETENTION POND GRADING INFORMATION NOT SHOWN. 0 20'10' VERTICAL HORIZONTAL 0 10'5' 1 STORM DRAIN PIPE PLAN SCALE 1" = 10'-0" 1 STORM DRAIN PIPE PROFILE SCALE 1" = 10'-0" (N) 8" PVC STORM DRAIN PIPE, S=0.00 (N) 8" PVC STORM DRAIN PIPE, S=0.00 (N) 8" PVC STORM DRAIN PIPE, S=0.005 (N) 12" PVC STORM DRAIN PIPE, S=0.01 (N) 12" PVC STORM DRAIN PIPE, S=0.01 (E) 12" PVC STORM D R A I N P I P E (E) 12" OUTFALL TO CREEK IE=609.82 3:1 MAX SLOPE TO (E) GRADE FORD STREET INTERSECTION PRE-CAST CONCRETE DROP INLET WITH BEEHIVE GRATE RIM EL=617.50 8" IE (OUT)=614.50 PRE-CAST CONCRETE DROP INLET WITH BEEHIVE GRATE RIM EL=617.50 8" IE (IN/OUT)=614.50 PRE-CAST CONCRETE DROP INLET WITH BEEHIVE GRATE RIM EL=617.50 8" IE (OUT)=614.50 (N) PRE-CAST CURB INLET TG=618.67 8" IE (IN)=614.37 12" IE (OUT)=613.48 (N) PRE-CAST CURB INLET TG=618.74 12" IE (IN)=613.18 12" IE (OUT)=613.06 INSTALL 24"x24" PRE-CAST DRAIN INLET MANUFACTURED BY JENSEN PRECAST (OR APPROVED EQUAL) TG=618.02 6" IE (IN)=614.82 12" IE (IN)=612.93 12" IE (OUT)=±612.93 (E) (N) TRAIL FINISH GRADE (N) TRAIL FINISH GRADE (N) 8" P V C , L = 5 8 ' (N) 8" PVC, L=65' (N) 8" P V C , L = 2 5 ' (N) 12" PVC, L=32'(N) 12" P V C , L = 1 6 ' (N) 6 " P V C , L = 2 4 ' , s = 0 . 0 2 (E ) 1 2 " P V C SHEET KEYNOTES 1. (N) PRE-CAST CURB INLET PER CITY OF UKIAH STANDARD DETAIL DWG 404. 2. (N) PRE-CAST DROP INLET WITH BEEHIVE GRATE. SEE DETAIL B ON SHEET C301. 1 122 (E) WATER LINE. POTHOLE FOR ACTUAL DEPTH AND LOCATION PRIOR TO EXCAVATION. (E) GRADE (N) BIORETENTION POND 1 WATER EL=617.50 (N) BIORETENTION POND 2 WATER EL=617.50 (N) BIORETENTION POND 3 WATER EL=617.50 N (E) 12" OUTFALL PRE-CAST CONCRETE DROP INLET WITH BEEHIVE GRATE RIM EL=618.00 8" IE (OUT)=614.50 2 2 This document shall not be used for construction unless signed and sealed for construction.Sheet No. Original Size Title Project ClientDesignerDrawn Scale Plot Date:Filename:2 July 2019 - 5:24 PM N:\US\Portland\Projects\111\11183508 Ukiah NWP Rail Trail Phase 3\06-CAD\Sheets\11183508_C301_POND GRADING PLAN.dwg ANSI D Date Plotted By:Briana Artita Project No. Sheet of Reuse of Documents This document and the ideas and designs incorporated herein, as an instrument of professional service, is the property of GHD and shall not be reused in whole or in part for any other project without GHD's written authorization.© 2019 GHD Drafting Check01" Bar is one inch on original size sheet Design Check IssueNo.Drawn Approved Date Project Manager CITY OF UKIAHNORTHWESTERN PACIFIC RAIL TRAIL PROJECT - PH 3 11183508 35 P. TORTORA 04/02/2019 2235 Mercury Way Suite 150 Santa Rosa California 95407 USA T 1 707 523 1010 F 1 707 527 8679 W www.ghd.com GHD Inc. BHADSA SUBMITTAL0 PRT 04/02/19 BHAISSUE FOR BID / DSA BACKCHECK1 PRT 06/28/19 INSTALL 24"x24" PRE-CAST DRAIN INLET MANUFACTURED BY JENSEN PRECAST (OR APPROVED EQUAL) RIM = 617.50 IE = 615.30 INSTALL 24"x24" PRE-CAST DRAIN INLET MANUFACTURED BY JENSEN PRECAST (OR APPROVED EQUAL) APPROVED DIV. OF THE STATE ARCHITECT APP.INC: REVIEWED FOR SS FLS ACS DATE: 01-118147 07/08/2019 Example Pond Drainage Plan Page 713 of 800 → The Power of Commitment → 5. Fee Proposal 37 Page 714 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 38 →5. Fee Proposal As requested in the City of Ukiah’s Request for Proposal Specification No. 21-02, the Fee Proposal has been provided in a separate email submission. Page 715 of 800 → The Power of Commitment → 6. References 39 Page 716 of 800 The challenge The first southerly segment of the future Great Redwood Trail, this was also the first Rail-with-Trail (RWT) project to be designed and constructed in NCRA right of way in Mendocino County. GHD served as the Prime Consultant with Alta as a subconsultant on phases 2 and 3, providing a full suite of environmental, engineering, and permitting services (as well as SWPPP preparation), for a Class 1, ADA-accessible, non-motorized pathway along one (1) mile of the NCRA Railroad Corridor between Gobbi Street and Clara Avenue in the City of Ukiah. Our response While most the right of way is owned by the NCRA, NWP serves as the contract operator. Together, the two entities share responsibility for the safety, operation, and maintenance of the railroad segment. Since the NCRA, NWP, and the City of Ukiah have a vested interest in this project, it was critical for GHD to understand the needs of each stakeholder. Regarding the SWPPP, GHD prepared a site-specific assessment to determine risk level, which is a function of the erosive potential of the soil and receiving water body risk during periods of soil exposure. Risk Level 2 will require sampling of stormwater for pH and sediment, and significantly more effort than a Risk Level 1 site. Risk level 3 sites may require Bioassessment studies of the receiving water Client City of Ukiah, Public Works Department Tim Eriksen, Director/City Engineer 1 707 463 6280 teriksen@cityofukiah.com Relevant Scope Elements Rail with Trail, environmental and engineering services, stakeholder coordination, at-grade crossings Date Phase 1: 2012-2013; Phase 2: 2017-2019; Phase 3: 2018-2019 Fees Phase 1: $186,784; Phase 2: $232,960; Phase 3: $325,180 Team Members Bill Silva, Pat Tortora, Subconsultant Alta Great Redwood Trail (Ukiah Rail with Trail), Phases 1 - 3 Ukiah, CA The Power of Commitment→ The Power of Commitment Page 717 of 800 This project provides pedestrians and cyclists with safe access to amenities such as parks, a museum, restaurants, and a hospital. body, and active stormwater treatment systems. GHD determined Phase 1 to be Risk Level 2. GHD then prepared the SWPPP document as required for the calculated risk level, which featured site maps and water pollution control drawings, a construction site visual monitoring program, a sampling and analysis plan for non-visible pollutants, a sampling and analysis plan for pH and sediment, a construction site non-visible pollutant sampling program, selection of appropriate best management practices (BMPs) for erosion and sediment control and for construction site management, and a partial water pollution control schedule. GHD provided Notice of Intent (NOI) information suitable to initiate the waste discharge permit process using the State’s Stormwater Multiple Application and Report Tracking System (SMARTS). Construction began in 2013 with about 4,300 feet of new paved trail along the west side of the railroad tracks, encompassing three street crossings and several connections to other adjacent streets along the alignment. Because of GHD’s familiarity with the design and challenges during construction, the City felt that GHD was best suited to perform construction management services. Applicable Permits: NCRA Encroachment Permit; CPUC GO-88 Modification of Existing Rail Crossing; SWPPP; CDFW Lake or Streambed Alteration Permit; DSA Access Compliance Approval; Caltrans ATP Construction Allocation Request (which requires the listed permits.) The outcome This first Rail-with-Trail (RWT) project to be designed and constructed in NCRA right of way in Mendocino County garnered overwhelming community support; in addition to its inherent recreational value, it provides pedestrians and cyclists with safe access to amenities such as parks, a museum, restaurants, and a hospital. This project received ACEC's 2021 Engineering Excellence Merit Award. GHD City of Ukiah Great Redwood Trail Phase 4 41 Page 718 of 800 The Power of Commitment→ The Power of Commitment The challenge This project presented several project site and schedule challenges. For instance, the erection of the long-span bridge over sensitive habitat required two large cranes to lift it into place. In addition, the team assisted SMART to update the boilerplate specifications from 2006 Caltrans Standards to 2015. To find the optimal locations for the crane placements, GHD performed a siting analysis during the design stage and the additional areas were permitted for the required access. Our response As a subconsultant to Biggs Cardosa, GHD is an integral part of the team providing design and construction support for a 1.2-mile non-motorized pathway (NMP) segment from Payran Street to Southpoint Boulevard in Petaluma, California. This trail will provide an important pedestrian connection between East and West Petaluma and be part of SMART’s larger pathway system connecting its stations to the surrounding communities. The project team is collaborated to provide civil engineering design and construction support services for this NMP within SMART’s Right of Way. The project was funded with an ATP grant and was administered through Caltrans Payran St. to Southpoint Blvd. Non-Motorized Pathway Client/Reference Information Sonoma-Marin Area Rail Transit (SMART) John Riley, PE, Principal Engineer 5401 Old Redwood Hwy, Suite 200, Petaluma CA 95954 D: 707.794.3070 | C: 707.478.7531 JRiley@sonomamarintrain.org Date July 2017-October 2019 Value Contract: $127,000 Page 719 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 43 This trail will provide an important pedestrian connection between East and West Petaluma and be part of SMART’s larger pathway system connecting its stations to the surrounding communities. District 4 Local Assistance. The scope of work includes topographical survey, geotechnical studies, utility coordination, design development and full PS&E, permitting coordination, and Local Agency Funding coordination. The Impact The team assisted SMART in overcoming the project challenges to deliver this NMP segment, which opened to the public in October 2019. Page 720 of 800 The Power of Commitment→ The Power of Commitment The challenge GHD has been involved with the Humboldt Bay Trail South (a segment of the Great Redwood Trail) project since 2013, selected by the Humboldt County Public Works Department to conduct a series of feasibility studies between Eureka Slough and Bracut Industrial Park on US 101 to determine the feasibility, costs and constraints of developing a multi-use trail. The project study area encompassed Caltrans facilities—entailing the south-bound shoulder, clear recovery zone, and edge of right of way along US 101—as well as the NCRA right of way, within which is a railroad prism and small levee that serves as the only barrier between US 101 and Humboldt Bay. Our response In order to conduct a thorough data collection process within the study area to determine all physical constraints, GHD coordinated closely with Caltrans staff to acquire all Caltrans assets within the study area and process the agency’s survey data. GHD also conducted reconnaissance-level wetland and habitat surveys to determine environmental constraints and likely permitting requirements. Next, GHD collaborated with the project’s Technical Advisory Committee (TAC) to identify a range of segments, alignments and design options throughout the study area. From there, GHD analyzed these options, considering environmental impacts, cost implications and design constraints, ultimately presenting the studies’ methodology and findings to the TAC and stakeholders. Client Humboldt County Department of Public Works Hank Seemann, Deputy Director - Environmental Services 1 707 268 2680 hseemann@co.humboldt.ca.us Relevant Scope Elements Class I multi-use trail design, biological assessment, CEQA, environmental permits, NCRA and Caltrans coordination Date 2013 – Ongoing Fees $1.59 Million Team Members Misha Schwarz, Andrea Hilton, Josh Wolf, Matt Tolley and Bill Silva, Subconsultant Alta Humboldt Bay Trail South (A Great Redwood Trail Segment) Arcata to Eureka, CA Page 721 of 800 This project will reduce the potential for conflicts between bicyclists, pedestrians, and vehicles within the Highway 101 Corridor and increase mobility options. With a thorough understanding of the constraints in developing future trail segments, in addition to climate change adaptation strategies in this area, GHD was contracted in 2016 by Humboldt County to move into design, providing the following services: –Wetland and ESHA delineations –NES/PES –Biological Assessment –CEQA –NEPA –Environmental permits –Geotechnical investigations –Topographic and boundary surveys –NCRA coordination –Caltrans coordination –Coastal Development Permit –GIS mapping –Drainage study –SWPPP –Right-of-way evaluation –Final Design (PS&E) When completed, the Humboldt Bay Trail South Project will provide non-motorized (primarily pedestrian and bike) transportation and recreational access connecting the City of Eureka’s Waterfront Trail (designed by GHD) to the City of Arcata’s Humboldt Bay Trail North (also designed by GHD) and Arcata City Trail via a Class I multi-use trail. The project will connect to the existing Eureka Waterfront Trail, starting in Eureka along the NCRA railroad transportation corridor and will continue north towards Brainard Slough. In addition to the proposed trail improvements between Eureka and Brainard Slough, the project extents involve cable railing installed between the existing Humboldt Bay Trail North Project and U.S. Highway 101. The project will reduce the potential for conflicts between bicyclists, pedestrians, and vehicles within the Highway 101 Corridor and increase mobility options in the communities of Arcata and Eureka. The Outcome Completion of the Humboldt Bay Trail South will close a critical gap in pedestrian and bicycle transportation along the California Coastal Trail between Eureka and Arcata. GHD City of Ukiah Great Redwood Trail Phase 4 45 Page 722 of 800 The Power of Commitment→ The Power of Commitment The challenge In addition to having great historical significance, the Eureka Waterfront is a rich ecological area with a substantial amount of natural beauty and economic potential. Since the late 1990s, the residents of Eureka have been researching opportunities to enhance this area through the development of a waterfront trail and promenade. To encourage an appreciation of the environment and history of the area, the City instituted the Eureka Waterfront Trail Project. Our response The Redwood Community Action Agency teamed with GHD to complete environmental compliance documents and engineering design for a Class 1, ADA Accessible, non-motorized 1-mile bicycle trail along Waterfront Drive in Eureka. Entirely in the Coastal Zone, this project aimed to enhance non- motorized/pedestrian connectivity and to increase public access to and along Eureka’s Waterfront adjacent to scenic Humboldt Bay. GHD led the design and environmental teams, completing the following tasks: Eureka Waterfront Trail, Phases A, B & C Client/Reference Information City of Eureka Miles Slattery, Parks and Recreation Director 1011 Waterfront Drive Eureka, CA 95501 707.268.1858 mslattery@ci.eureka.ca.gov Date 2012-2018 Value Contract: $1M Page 723 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 47 This project was recognized by the American Society of Civil Engineers with the 2018 ASCE San Francisco Section Outstanding Bikeways and Trails Project of the Year Award. –Topographic survey –Intersection, trail, and park design –Engineering construction documents and cost estimate –Natural features inventory –Analysis of environmental impacts –Re-alignment analyses –Corridor Phase I environmental site assessment –CEQA Initial Study, NEPA Environmental Assessment –California Coastal Commission CDP –Agency coordination –GIS mapping GHD designed the final alignment to keep native habitat values wherever possible, avoid impacts to wetlands, and avoid impacts to special-status species. The team also identified restoration activities to enhance the project. The Impact GHD successfully completed the project on an accelerated schedule; all phases were completed within four months of project initiation. This project was recognized by the American Society of Civil Engineers with the 2018 ASCE San Francisco Section Outstanding Bikeways and Trails Project of the Year Award. Page 724 of 800 The Power of Commitment→ The Power of Commitment The challenge The City of San José has a goal of constructing 100 miles of trails by 2022. The Guadalupe River Trail – Coleman Road Undercrossing connects two segments of City trails at the intersection of Coleman Road and Almaden Expressway. Due to constraints of the existing undercrossing, footings and jurisdictional boundaries, the trail layout required the involvement of several local, state and federal agencies. GHD provided design, environmental compliance and permitting and construction support for this segment of the Guadalupe River Trail. Our response Since 2013, GHD has provided professional engineering services to support this goal, working on several trail segments including Thompson Creek Trail (Tully Road to Quimby Road), Thompson Creek Trail (Quimby Road to Aborn Court), Fisher Creek Trail Alignment Study, and currently the Coyote Creek Trail (Phelan Avenue to Tully Road) and Coyote Creek Trail (Brokaw Road to Union Pacific Railroad). Under the City’s current on-call contract for trails, GHD moves towards the completion of the remaining 40 miles of trail design, construction and ribbon cutting. One successfully completed trail segment, completed under the previous on-call contract, which proved challenging, was the Guadalupe River Trail/ Coleman Road Undercrossing. Guadalupe River Trail/ Coleman Road Undercrossing Client/Reference Information City of San Jose Yves Zsutty, Division Manager 408.793.5561 Date 2013 - 2017 Value Contract: $155,000 Page 725 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 49 GHD’s environmental planners coordinated early with the permitting agencies to understand concerns and work with engineering staff to develop ways to mitigate impacts. Steps taken to mitigate by design resulted in no impacts below ordinary high water and minimal impacts at and below top of bank. As a result, a Section 404 US Army Corps of Engineers permit was not required. Key Points –Design of 600 feet of trail under Coleman Road with multiple retaining walls –GHD’s early and proactive coordination with the permitting agencies ultimately reduced the permitting time lines. –The winning bid came within 3% of engineering cost estimates with no change orders during construction due to the quality of the design documents. Applicable Permits: CDFW Streambed Alteration Agreement; SF Bay RWQCB Notice of Applicability; USACE Preliminary Jurisdictional Map and Determination of no fill to jurisdictional waters The Impact GHD’s inclusion of BMPs minimized the impacts to the “riparian” corridor to such an extent that the California Department of Fish & Wildlife Streambed Alteration Agreement was issued in near record time with no requirements to mitigate the riparian impacts. Page 726 of 800 → The Power of Commitment → 7. Exceptions 50 Page 727 of 800 GHD City of Ukiah Great Redwood Trail Phase 4 51 →7. Exceptions GHD takes no exceptions to the City's insurance requirements nor the City's draft Professional Services Agreement in Attachment C. Page 728 of 800 → The Power of Commitment → Appendix: Resumes 52 Page 729 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 53 Ukiah Rail-Trail Phases 1, 2, and 3 Role: Assistant Construction Manager and Construction Engineer (Phase 1), QA/QC (Phases 2 and 3) Client: City of Ukiah Location: Ukiah, CA GHD is the design engineer for three phases of a Class I trail along North Coast Railroad Authority (NCRA) Railroad Corridor in the City of Ukiah. The trail provides pedestrians and cyclists with safe access to amenities such as parks, a museum, and a hospital. The first phase was the first Rail-with-Trail project to be designed and constructed in NCRA right of way in Mendocino County. GHD provided a full suite of environmental, engineering, and permitting services, as well as Stormwater Pollution Prevention Plan (SWPPP) preparation. Perkins Street and Orchard Avenue Intersection Improvements Role: Traffic and Civil Engineer Client: City of Ukiah Location: Ukiah, CA This project involved the design of traffic signal modifications and geometric improvements to add an additional right turn lane with a right turn overlap phase at this heavily utilized intersection near the on and off ramps for the U.S. 101 East Perkins Street interchange in Ukiah, CA. Other improvements included minor grading and storm drainage improvements, paving, striping for the new turn lane, curb, gutter, and sidewalk, and relocating signs from the demolished signal poles to the new signal poles. This project was completed in September 2009, modified in January 2012 to include federal Economic Development Administration funding requirements, and completed by 2012. Matt Kennedy is a principal engineer with 18 years of experience in delivering a wide variety of civil infrastructure projects. Project types include water and recycled water, sewer, drainage, traffic/transportation, buildings and sustainable site development. He is adept in the management and design of multi-discipline projects with medium to large teams and numerous stakeholders and including construction management. Projects involve planning, environmental compliance, design, permitting and construction. Project elements include water tanks, wells, water transmission/distribution, sewer collection, pump stations, stormwater conveyance, Low Impact Development (LID), grading and drainage, civil site design, traffic signals, roadways, retaining walls, pedestrian and bicycle facilities, and traffic control. His experience also includes a broad range of planning, modeling and analysis capabilities, including utility master planning, hydrologic and hydraulic modeling, water and wastewater process design, traffic and parking studies, and circulation studies. He is also experienced in land surveying and construction management. Relevance to the project Memberships – American Society of Civil Engineers (ASCE); American Water Works Association (AWWA); Society of American Military Engineers Qualifications/Accreditations – MS, Environmental Engineering, University of Massachusetts, Amherst, MA 2003 – BS, Environmental Resources Engineering, Humboldt State University, Arcata, CA 2001 – Civil Engineer, CA #68304, OR #83450, NV #24172, NM #23032, HI #18171, GU #1337, CNMI #528 – Traffic Engineer, CA #2385 – Envision Sustainability Professional (ENV SP) Experience 18 years Location Santa Rosa, California GHD Principal Matt Kennedy, PE, TE Principal-in-Charge – United States Army Corps of Engineers (USACE)/Naval Facilities Engineering Systems Command (NAVFAC) Certified Design and Construction Quality Control Manager – California Department of Transportation Resident Engineer Certification – Construction Specifications Institute (CSI); Construction Documents Technologist (CDT) Page 730 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 54 Matt Kennedy, PE, TE | Principal-in-Charge Talmage Interchange Improvements Role: Project Manager Client: City of Ukiah Location: Ukiah, CA The project involves the design of geometric modifications to the existing Caltrans-owned freeway interchange in Ukiah. The improvements are related to ongoing development of the Redwood Business Park and regional growth, specifically required to accommodate increased traffic. GHD prepared a detailed traffic impact study, biological assessment, hazardous materials assessment, and a noise study for the project in support of a CEQA EIR. East Washington Pedestrian Crossing Role: Traffic and Civil Engineer Client: City of Petaluma Location: Petaluma, CA The purpose of the project is to enhance pedestrian visibility, crossing safety and ADA accessibility at East Washington Street on the Petaluma Ring Trail. The project includes a high-visibility overhead warning system (flashing yellow beacons and LED blankout sign), a pedestrian corral at the mid-point of the crossing, new sidewalks along East Washington Street, utility trenching, a new PG&E service, ADA curb ramps with truncated dome detectable warning panels, and striping and singing. GHD designed the new overhead warning system using standard details and equipment from Caltrans, including foundations, poles, mast arms, and one luminaire for safety lighting. New sidewalks provide connectivity for bicyclists and pedestrians between the Ring Trail on Skyranch Road and East Washington Street. The project was completed on-schedule and under budget. In additional to full design services, GHD provided construction support services during construction and worked with City staff and the contractor. Replacement Well #4 and New Well #9 Role: Project Manager Client: City of Ukiah Location: Ukiah, CA This project replaces existing and failing Well #4 with a new well, and a chlorination and control building. GHD provided related site improvements, and then constructed new Well #9. Well #4 is located on a parcel in a residential neighborhood. Downtown Streetscape and Road Diet Project Role: Project Manager Client: City of Ukiah Location: Ukiah, CA This project includes the design of new streetscape and utility improvements along State Street from Mill Street to Henry Street, approximately 9 city blocks. The project also includes improvements on Perkins Street and Standley Street from School Street to Main Street. Specific components of the project include the following: sidewalk-widening, construction of curb ramps and bulb outs, relocation of drain inlets and pipes, construction of Low Impact Development (LID) storm water enhancement features, installation of new streetlights, and installation of street furniture. Sidewalks range in width from 8 feet to 15 feet, meet ADA accessible standards and include bulb-outs with RRFB flashing beacon at a mid-block crossing at Seminary Avenue, as well as stamped asphalt at each street intersection, intended to enhance pedestrian safety. New traffic control signal is installed at Mill Street, Perkins Street and Standley Street. Redwood Business Park Transportation Improvements Role: Project Manager and Construction Manager Client: City of Ukiah Location: Ukiah, CA The project involves the design of improvements to an existing roadway system in a developing business park and retail area to repair a large section of under-designed and failed pavement, widen and improve roadways to accommodate increases in traffic and heavy trucks associated with planned future commercial and retail developments, and other associated improvements. Elements of the project include pavement design and roadway reconstruction, new and modified traffic signals, the addition of lanes and changes in roadway geometry, extensions of roadways and utilities, and pedestrian and bicycle improvements consistent with the City’s Bicycle and Pedestrian Plan and development plan. Roadway widening improvements require coordination with PG&E for the relocation of a primary distribution power pole, and wetland delineation. Other project services include traffic analyses and planning assistance for future interchange improvements, and coordination with Caltrans. This project is currently in construction. Transit Operations and Maintenance Facility Role: Civil Engineer of Record Client: Mendocino Transit Authority (MTA) Location: Ukiah, CA GHD provided civil, mechanical, electrical, and structural engineering design services for a new operation and maintenance building, fueling facility, bus clean detail, and related improvements, replacing MTA’s existing outdated and undersized facilities. Site designs include new utility services, excavation, grading and paving, and stormwater improvements. The project required reconstruction of existing utilities to locate them within existing utility easements, removal and replacement of undocumented and unstable fill materials, and coordination with local agencies for approvals. Page 731 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 55 Ukiah Rail-Trail Phases 1, 2, and 3 Role: Project Manager Client: City of Ukiah Location: Ukiah, CA GHD is the design engineer for three phases of a Class I trail along North Coast Railroad Authority (NCRA) Railroad Corridor in the City of Ukiah. The trail provides pedestrians and cyclists with safe access to amenities such as parks, a museum, and a hospital. The first phase was the first Rail-with-Trail project to be designed and constructed in NCRA right of way in Mendocino County. GHD provided a full suite of environmental, engineering, and permitting services, as well as Stormwater Pollution Prevention Plan (SWPPP) preparation. Eureka Waterfront Trail, Phases A, B and C Role: Quality Assurance/Quality Control (QA/QC) Reviewer Client: City of Eureka Location: Eureka, CA Provided QA/QC oversight support for this multi-phase, multi- year planning and design project. In addition to developing construction ready Plans, Specifications, and Estimate (PS&E), GHD assisted with the Caltrans Project Approval/Environmental Documentation (PA/ED) phase, provided trail alignment analysis, and environmental compliance documents for a Class 1 segment of the non-motorized California Coastal Trail along the majority of the City of Eureka’s water front. The project is primarily in the right of way of a city street and a railroad and is entirely within the California Coastal Zone. The project included wayfinding signage and interpretive signage. Payran Street to Southpoint Boulevard Multi-Use Pathway Role: Quality Assurance/Quality Control (QA/QC) Client: Sonoma Marin Area Rail Transit (SMART) Location: Petaluma, CA Pat provided QA/QC oversight support for a 1.2-mile segment of pathway from Payran Street to Southpoint Boulevard in Petaluma, California, which will provide an important pedestrian connection between East and West Petaluma and be part of SMART’s larger pathway system connecting its stations to the surrounding communities. The project’s scope of work includes topographical survey, geotechnical studies, utility coordination, design development and full PS&E, permitting coordination, and Caltrans Local Agency Funding coordination. North San Jose Trail Access and Ramp Study Role: Civil Engineer and Construction Support Client: City of San Jose Location: San Jose, CA Pat assisted in the preparation of the North San Jose Trail Access and Ramp Study to provide optimum connectivity to the Guadalupe River Trail and the Coyote Creek Trail by formalizing the location and design approach for additional access ramps. Public access ramps will be ADA accessible and bicycle friendly. The study is also intended to support a long-term relationship with the Santa Clara Valley Water District and U.S. Army Corps of Engineers for recreational trails by ensuring that public access does not unnecessarily impact the important flood control levees. For more than 25 years, Pat Tortora has served as a project engineer or project manager on multidisciplinary projects providing planning, design, and construction engineering solutions to communities and public agencies, both large and developing, throughout the Western US, with an emphasis on K-12 schools site design. For school districts, municipal entities, and governmental organizations throughout the Portland Metro Area, Southeast Washington, California, and Guam, Pat has overseen civil site infrastructure improvements that attend to stormwater quality concerns, utility infrastructure, pedestrian and vehicular safety measures, and sustainably minded, comprehensive sewer, water, and civil site work. Relevance to the project Membership – American Society of Civil Engineers (ASCE) Qualifications/Accreditations – BS, Civil Engineering, Oregon State University, Portland, OR 1993 – Civil Engineer, CA #80067, WA #42517, OR #50400, ID #17342, GU #1873 Experience 25+ years Location Portland, Oregon Pat Tortora, PE, LEED AP Project Manager – LEED Accredited Professional Page 732 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 56 Pat Tortora, PE, LEED AP | Project Manager Downtown Pedestrian Connectivity Improvements Role: Project Engineer Client: City of Trinidad Location: Trinidad, CA Served as Design Engineer for the City of Trinidad’s pedestrian connectivity project, which is intended to remove accessibility barriers and extend new safe and accessible pedestrian routes through the downtown area. Improvements included new accessible new sidewalks, curb ramps, driveway, and off-street parking improvements. The project is in the final design phase with constructed anticipated to begin in Spring 2021. Main Street/SR1 Realignment Role: Lead Civil Engineer Client: City of Fort Bragg Location: Fort Bragg, CA Pat served as Project Engineer and worked on the design for the Main Street Realignment Project (between Oak Street and Pine Street). Improvements included the relocation of the existing merge/drop lanes; the addition of a bike lane; the addition of medians; the replacement of the existing cobra-head style street lights with new decorative street lights; the addition of right and left hand turn lanes at various intersections; decorative bulbouts, curb ramps, and crosswalks; and accessibility improvements to driveways and sidewalks. Ukiah Downtown Streetscape and Road Diet, Phase 1 Role: Civil Engineer Client: City of Ukiah Location: Ukiah, CA Served as Civil Engineer for this project, currently under construction, which included the design of new streetscape and utility improvements along State Street from Mill Street to Henry Street, approximately 9 city blocks. The project also includes improvements on Perkins Street and Standley Street from School Street to Main Street. Specific components of the project include the following: sidewalk-widening, construction of curb ramps and bulb outs, relocation of drain inlets and pipes, construction of Low Impact Development (LID) stormwater enhancement features, installation of new streetlights, enhanced pedestrian crossings with Rectangular Rapid Flashing Beacons (RRFB’s) and stamped asphalt crosswalks, and installation of street furniture. A new traffic control signal will be installed at Mill Street, Perkins Street and Standley Street. Transportation Improvements for Redwood Business Park Role: Civil Engineer Client: City of Ukiah Location: Ukiah, CA Pat assisted in construction submittal reviews. Riley Creek Access Road Bridge Replacement Role: Project Manager/Engineer Client: US Fish & Wildlife Service Location: Hagerman National Fish Hatchery, ID Prepared alternatives analysis, concept design, and construction documents for the design and construction of the replacement bridge. The improvements included new access road approaching a 50-span voided concrete slab and pile supported foundation spanning over Riley Creek in at the Hagerman National Fish Hatchery. Wapato Lake Bridge Replacement Role: Project Manager/Engineer Client: US Fish & Wildlife Service Location: Wapato Lake Wildlife Refuge, OR Prepared the alternatives analysis and concept design for four alternate locations to provide vehicular and pedestrian access to the Wapato Lake Levee. The vehicular bridge is a 91-foot- span steel girder bridge and access roads. The pedestrian bride consists of an 85-foot-span prefabricated aluminum truss bridge. Design includes new bridge designs, foundation, and levee improvements to support the new access roads. Mendocino County Courthouse Infrastructure Project Phases 1, 2, and 3 Role: Civil Engineer Client: County of Mendocino Location: Ukiah, CA Pat is currently preparing the SWPPP and process application on the State of California Water Resources Control Board Stormwater Multiple Application and Report Tracking System (SMARTS) online permitting. Cotati-Rohnert Park Unified School District Measure C Various Projects Role: Project Manager and Civil Engineer Client: Cotati-Rohnert Park Unified School Location: City of Cotati and City of Rohnert Park, CA Served as the Civil Engineer for various campus upgrades, building additions and Modernizations. Campus upgrades involved the design of new concrete hardscape, parking areas, play areas and verifying path of travel were compliant with the California Building Code. Stormwater was install as needed for the project to be compliant with City and State regulations, new domestic water and fire lines were installed for the various additions and aging systems. The following schools were part the overall Measure C: Evergreen Elementary School, John Reed Elementary School, Lawrence Jones Middle School, Marguerite Hahn Elementary School, Monte Vista Elementary School, Rancho Cotate High School, Richard Crane Elementary School, Technology High School, Technology Middle School, Thomas Page Academy, University Elementary at La Fiesta. Page 733 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 57 The Great Redwood Trail (Ukiah Rail-Trail Phases 1 & 2) Role: Principal-in-Charge Client: City of Ukiah Location: Ukiah, CA GHD was the design engineer for a Class I trail along over two miles of the NCRA Railroad Corridor between Gobbi Street/ Clara Avenue and Commerce Drive/Talmage Road. The trail provides pedestrians and cyclists with safe access to amenities such as parks, a museum, and a hospital. This was the first Rail- with-Trail (RWT) project to be designed and constructed in NCRA right of way in Mendocino County. GHD provided a full suite of environmental, engineering and permitting services, as well as SWPPP preparation. SMART Various Non-Motorized Pathways Role: Principal-in-Charge Client: SMART Location: Sonoma County, CA Provided oversight for the design of over 5-miles of Non- motorized pathway adjacent to active SMART rail beginning in Petaluma and ending in Santa Rosa, CA. Project included 3 bridges, numerous roadway crossings, and rail crossings. Work included collaboration with adjacent/stakeholder agencies. Humboldt Bay Trail North (A Great Redwood Trail Segment) Role: Principal-in-Charge Client: City of Arcata Location: Humboldt County, CA As Principal-in-Charge, provided oversight for the final engineering design of a three-mile Class I trail through City, Caltrans, and railroad right of way. Improvements involving six non-motorized bridges and an at-grade trail-rail crossing. GHD’s team prepared the engineering PS&E package, and coordinated design improvements to minimize environmental impacts and mitigation costs. The trail segment is part of the California Coastal Trail with much of the alignment located entirely within the California Coastal Zone. Payran Street to Southpoint Boulevard Multi-Use Pathway Role: Principal-in-Charge Client: SMART Location: Petaluma, CA Managed design and construction support for a 1.2-mile segment of pathway from Payran Street to Southpoint Boulevard in Petaluma, California, which provided an important pedestrian connection between East and West Petaluma and be part of SMART’s larger pathway system connecting its stations to the surrounding communities. The project’s scope of work included topographical survey, geotechnical studies, utility coordination, design development and full PS&E, permitting coordination, and Caltrans Local Agency funding coordination. With over 23 years of experience in public sector civil engineering, transportation, and pipeline design, Bill is highly skilled at CIP and Public Works project design, including: large-scale redevelopment, roadway and bridge design, railroad design, various water, sewer and storm drain projects, and a broad background in all phases of project planning and design through construction. Bill has been a County Public Works engineer, an Assistant City Engineer, and led development review services. In addition, he has managed multi-million dollar infrastructure improvement projects throughout Northern California. Relevance to the project Memberships – Member, Construction Specification Institute; Member, American Society of Civil Engineers; Member, American Public Works Association; Member, National Society of Professional Engineers; Member, South & West Area Business Association; Member, LSR XXV, Leadership Santa Rosa Qualifications/Accreditations – BS, Civil Engineering, California State Polytechnic University, San Luis Obispo, CA 1993 – Licensed Civil Engineer, CA #C58235 – Construction Documents Technology (CDT) Certification – Certified QSP/QSD, CA #22223 Experience 28+ years Location Santa Rosa, California Bill Silva, PE, QSP/QSD QA/QC Review GHD Principal Page 734 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 58 Bill Silva, PE, QSP/QSD | QA/QC Review Devlin Road Segment H and Vine Trail Extension Role: Principal-in-Charge Client: City of American Canyon Location: American Canyon, CA Responsible for overseeing all aspects of design of this roadway project through a Greenfield in the City of American Canyon. The nearly one mile-long new roadway included design of the extension of the Vine Trail, which is a multi use master- planned trail through Napa County. It also included right of way acquisition, design of a new box culvert, utility design and coordination, and LID storm water solutions, such as bio retention. The roadway cuts through areas of wetlands which required mitigations and coordination with multiple government agencies. Eureka Waterfront Trail (A Great Redwood Trail Segment), Phase B Role: Principal-in-Charge and QA/QC Client: City of Eureka Location: Eureka, CA Oversaw the second phase of design, including construction- ready PS&Es and environmental compliance documents for a Class I segment of the non-motorized California Coastal Trail along one mile of Waterfront Drive in Eureka. The project is primarily in the right of way of a city street and a railroad and is entirely within the California Coastal Zone. Project tasks involved: topographic survey, wayfinding signage, interpretive signage, trailheads, intersection and trail design, engineering construction documents, cost estimates, natural features inventory, analysis of environmental impacts, re-alignment analyses, corridor Phase I environmental site assessment, CEQA Initial Study, stakeholder coordination, and Geographic Information System (GIS) mapping. Coyote Creek Trail – Phelan Avenue to Tully Road Role: Principal-in-Charge Client: City of San Jose Location: San Jose, CA The 6,200-Linear-Foot (LF) trail provides critical gap closure and connectivity between two existing Coyote Creek Trail segments. The GHD team delivered plans, specifications and cost estimate and the design of retaining walls, formal trailheads, grading, utility relocation and erosion control design. The project included coordination and permitting with Santa Clara Valley Water District, Regional Water Quality Control Board, California Department of Fish and Wildlife, and USACE. Due to the site conditions, the trail extended below the 100- year flood elevations, which required an extensive hydraulic analysis to achieve a no-rise certificate. With an estimated construction completion date of 2021, the team will provide bid assistance and construction management services. Doolittle Drive Bay Trail Segment Role: Principal-in-Charge Client: East Bay Regional Parks District (EBRPD) Location: Oakland, CA Bill provided project oversight for the design and environmental permitting for this 3,500-LF trail segment . The site has challenges as it is within the 100 year flood, a condition that will worsen with sea level rise. Numerous resource agencies are involved, including USACE, San Francisco Regional Water Quality Control Board, National Marine Fisheries Service, and Bay Conservation and Development Commission. Numerous technical reports in support of the Caltrans funding process were prepared. Berryessa Creek Pedestrian Bridge and Bicycle Trail Role: Project Engineer Client: City of Milpitas/Santa Clara Valley Water District (SCVWD) Location: Milpitas, CA Project Engineer for the design for a pedestrian bridge and 4-mile bicycle trail, which was constructed under a cooperative agreement between SCVWD and the City of Milpitas. The trail integrates with the natural environment and provides recreation and alternative transportation benefits to businesses, schools, and neighborhoods. The trail and creek improvements feature over one mile of Caltrans Class I bicycle route through restored habitat. Page 735 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 59 Little River Trail PA/ED Role: Project Manager Client: Redwood Community Action Agency Location: Westhaven, CA Responsible for the development of the Little River Trail project. The project is a collaborative effort between the Redwood Community Action Agency (RCAA) and Caltrans District 1, intended to provide a one-mile-long Class I bike path along the west side of US Highway 101 in Humboldt County. Responsible for overseeing the environmental and preliminary design phases of work, including environmental and National Environmental Policy Act (NEPA) studies (wetland, EHSA and rare plant mapping, visual impact analysis, initial site assessment, natural environment study), California Environmental Quality Act (CEQA) documentation, topographic and right of way surveys, route selection, cost estimating, and coordination with and Caltrans oversight engineer. The Project Approval & Environmental Documentation (PA/ED) phase is funded by a California Coastal Conservancy grant. Humboldt Bay Trail North Role: Project Manager Client: City of Arcata Location: Arcata, CA Responsible for final engineering design of a three-mile Class I trail through City, Caltrans, and railroad right of way. Improvements include six non-motorized bridges and an at- grade trail-rail crossing. Responsibilities included the preparation of the engineering PS&E package, and coordinating design improvements to minimize environmental impacts and mitigation costs. The trail segment is part of the California Coastal Trail with much of the alignment located entirely within the California Coastal Zone. Design was completed in 2016, and construction was completed in 2017. In 2018, the ASCE San Francisco Section selected the Humboldt Bay Trail North/Eureka Waterfront Trail as “Outstanding Bikeways and Trails Project”. Humboldt Bay Trail South Role: Project Manager Client: County of Humboldt Location: Humboldt County, CA The Humboldt Bay Trail South project is the final 4.2-mile-long segment of trail needed to complete the overall Humboldt Bay Trail system, linking northern Arcata to Southern Eureka. As project manager, Mr. Wolf is responsible for overseeing the environmental and design phases of work, which has included environmental and NEPA studies (wetland, EHSA and rare plant mapping, visual impact assessment, initial site assessment, sea level rise vulnerability and adaptation, natural environment study), CEQA IS/MND, topographic and right-of- way surveys, geotechnical investigations, route selection and preliminary design, cost estimating, SWPPP, drainage analysis, and Josh Wolf is a senior engineer with over 17 years of experience designing and managing a wide range of transportation infrastructure projects including both motorized and non- motorized improvements. He is an expert in leading the planning, environmental, design and construction oversight of federally-funded projects for local agencies in northern California. His project experience includes the design of public infrastructure projects that include roadway improvements, highway interchanges, intersection improvements, bicycle and pedestrian facilities, Class I trails, storm drainage improvements and stormwater treatment facilities. Relevance to the project Memberships – Humboldt County Association of Governments (HCAOG), Technical Advisory Committee; City of Arcata, Transportation Safety Committee; City of Arcata, Transaction and Use Tax Committee Member; American Society of Civil Engineers (ASCE); California Stormwater Quality Association (CASQA); Caltrans’ California Walk & Bike Technical Advisory Committee (CWBTAC) Qualifications/Accreditations – BS, Environmental Resources Engineering, Humboldt State University, Arcata, CA 2003 – Civil Engineer, CA #70358, OR #80613 – Local Assistance Resident Engineers Academy, March 2009 & January 2016 – Qualified SWPPP Developer/Qualified SWPPP Practitioner #00299 Experience 17 years Location Eureka, California Josh Wolf, PE, QSD/QSP Agency Permitting Lead Page 736 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 60 Josh Wolf, PE, QSD/QSP | Agency Permitting Lead coordination with the County of Humboldt, Caltrans, and North Coast Railroad Authority (NCRA). Construction is anticipated to commence in 2022. Eureka Waterfront Trail Role: Project Director Client: City of Eureka Location: Eureka, CA Served as Project Director for this multi-phase, multi-year planning and design project, including assisting with the Caltrans PA/ED phase, trail alignment analysis, developing construction-ready Plans, Specifications, and Estimate (PS&E), and environmental compliance documents for a Class 1 segment of the non-motorized California Coastal Trail along the majority of the City of Eureka’s waterfront. The project is primarily in the right of way of a city street and a railroad and is entirely within the California Coastal Zone. Project tasks involved topographic survey, wayfinding signage, and interpretive signage. Manila SR 255 Bike Path Role: Project Manager Client: County of Humboldt Location: Humboldt County, CA Project Manager for the development of the Manila Highway 255 Bike Path project. The project is a collaborative effort between the Humboldt County Department of Public Works and Caltrans District 1, intended to provide a one-mile-long Class I bike path along the west side of State Route (SR) 255 through the unincorporated community of Manila. The federally funded project is located entirely within the California Coastal Zone and required NEPA and CEQA clearance and numerous environmental permits. Responsible for overseeing the environmental and design phases of work, including environmental and NEPA studies (wetland, Environmental Health Site Assessment (EHSA) and rare plant mapping, visual impact analysis, initial site assessment, natural environment study), topographic and right of way surveys, route selection, engineering design, cost estimating, and coordination with the County of Humboldt and Caltrans oversight engineer. Foster Avenue Extension and Trail Role: Project Manager Client: City of Arcata Location: Arcata, CA Provided project management for the design of this high-priority project, which significantly improved traffic circulation and non-motorized connectivity in the City. Project components included a road extension, a roundabout, LID landscaping features, and pedestrian/bicyclist safety improvements, including the extension of the Arcata Rail with Trail project from Eastern Avenue to Sunset Avenue. The project was selected as “2016 Bikeways and Trails Project of the Year” awarded by the San Francisco Section of ASCE. US 101 Riverwalk Connectivity Study Role: Project Manager Client: City of Fortuna Location: Fortuna, CA Project Manager for the development of a planning study for bicycle, pedestrian, and traffic operational improvements to the Kenmar Road and 12th Street interchanges with US 101 in the City of Fortuna. The project identified ways to improve access to the Riverwalk area and improve safety for all users (motorized and non-motorized), improve operations, apply complete streets concepts and create an entry statement/gateway, and ready the project for next steps in project development. The study was primarily funded by a 2015 - 2016 Sustainable Communities Planning Grant awarded to the Humboldt County Association of Governments (HCAOG) and the City of Fortuna as a sub-recipient. Work also included the preparation of a Project Study Report (PSR) for the Kenmar Interchange improvements. Safe Routes to Schools: South Fortuna Elementary Role: Project Manager Client: City of Fortuna Location: Fortuna, CA Responsible for the City of Fortuna’s Safe Routes to Schools (SRTS) project that was focused on providing bicycle and pedestrian connectivity to South Fortuna Elementary School. The project includes bicycle and pedestrian improvements focused on providing a safe and continuous non-motorized route from adjacent neighborhoods to the school. The project will also improve the parking lot circulation and drop-off/ pick-up areas at the school which are currently confusing and inefficient, and has led to congestion on Newburg Road and potentially unsafe conditions for students. Managing the delivery of environmental, design, and construction management services for the project. The project was constructed in summer of 2020. Trinidad Downtown Pedestrian Connectivity Improvements Role: Project Manager Client: City of Trinidad Location: Trinidad, CA Responsible for the City of Trinidad’s pedestrian connectivity project which is intended to remove accessibility barriers and extend new safe and accessible pedestrian routes through the downtown area. Improvements included new accessible new sidewalks, curb ramps, driveway and off-street parking improvements. Managing the delivery of environmental, design, and construction management services for the project, which is funded through the STIP. The Constructed is anticipated to begin in spring of 2021. Page 737 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 61 Sutter County Bike Path Widening Role: Project Engineer Client: Sutter County Location: Sutter County, CA Lead designer in preparing the Plans, Specifications, and Estimates (PS&E) to widen an existing bike path to provide for additional safety of both bicyclists and pedestrians using the facility. The project included grading, base, and paving for widening on one or both sides of the existing path, including some drainage modifications, American with Disabilities Act (ADA) compliance at roadway crossings, and head wall modifications. 2013 Bikeway Improvements Role: Design Engineer Client: City of Shasta Lake Location: Shasta Lake, CA Assisted with preparation of the plans, estimates, and exhibits for the City of Shasta Lake’s bikeway improvement project, which included installation of Class 2 Bikeway (bike lane) and Class 3 Bikeway (bike route) facilities along various roadway segments within the City. The work included the installation of new bikeway signing and striping on more than ten miles of major arterial roadways within the City of Shasta Lake. The project was constructed in 2013 at a construction cost of approximately $130,000. 1st Avenue Safe Routes to School Improvements Role: Design Engineer Client: City of Avenal Location: Avenal, CA Assisted with preparation of the PS&E for spot location upgrades of sidewalk and curb ramps along 1st Avenue in Avenal. Work included curb ramp construction, sidewalk conforms, and signing and striping installation adjacent to Avenal Elementary School. In addition, school zone sign upgrades were completed for a five-block area adjacent to the elementary school. The project was constructed in 2013 at a construction cost of approximately $130,000. Cabello Avenue Safe Routes to School Improvements Role: Design Engineer Client: City of Shasta Lake Location: Shasta Lake, CA Brandon Tenney has over 14 years of experience designing and managing the delivery of engineering projects. He has led nearly every aspect of engineering project delivery, from the planning phase, to surveying; design; Plans, Specifications, and Estimates (PS&E); construction management; and inspection services. Additionally, Brandon is experienced with all types of projects, both privately funded and local, state, and federally funded projects. His experience includes PS&E preparation, drainage and utility plans, complex traffic management and stage construction plans, profiles and super elevations, guard rail design and upgrades, and turnkey construction management and inspection services. He is also experienced with managing agency approvals, environmental requirements, and Caltrans and local assistance policies and procedures for state and federally funded projects. Relevance to the project Qualifications/Accreditations – BS, Civil Engineering, California State University, Chico, CA 2007 – Civil Engineer, CA #83928 – Qualified SWPPP Developer/Practitioner, CA #83928 Experience 14 years Location Redding, California Brandon Tenney, PE, QSD/QSP Agency Permitting Support Certifications/Trainings – Caltrans Resident Engineer Academy 2013 – National Pollutant Discharge Elimination System Qualified Stormwater Pollution Prevention Plan (SWPPP) Developer/ Practitioner Training 2013 – Shasta College Erosion Control Best Management Practice (BMP) Summit 2015 – State and Federal Prevailing Wage Training 2010, 2016 Page 738 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 62 Brandon Tenney, PE, QSD/QSP | Agency Permitting Support Assisted with preparation of the PS&E for half-mile of new sidewalk along Cabello Avenue in Shasta Lake. The design included roadway widening, driveway modifications, drainage improvements, utility relocations, and ADA facilities. Assisted with right of way acquisition coordination and environmental approvals. Successfully constructed in July 2012 at a construction cost of approximately $470,000. SR 273 Bikeway Role: Design Engineer Client: City of Anderson Location: Anderson, CA Assisted with preparation of the PS&E for one+-mile-long mixed-use pedestrian and bicycle facility, along SR 273 in the City of Anderson. The project included some widening of the state highway roadways, segments with separated mixed-use path facilities, an arch culvert over an existing drainage facility, traffic signal modifications, retaining walls, and ADA compliance within the new and modified facilities. The project was successfully completed in May 2011 with a construction cost of approximately $550,000. Montana Street Safe Routes to School Improvements Role: Design Engineer Client: City of Shasta Lake Location: Shasta Lake, CA Assisted with preparation of the PS&E for half-mile of new sidewalk along Montana Avenue in Shasta Lake. The work included roadway widening, driveway modifications, drainage improvements, utility relocations, and ADA facilities. Assisted with right of way acquisition coordination and environmental approvals. Successfully constructed in 2011 at a construction cost of approximately $540,000. Bruce Street/Emily Drive Safe Routes to School Improvements Role: Design Engineer Client: City of Anderson Location: Anderson, CA Assisted with preparation of the grant application and project PS&E. Assisted with construction management and inspection. The project included some roadway widening, drainage modifications, driveway modifications, and ADA compliance at curb ramps and crosswalk locations. Successfully constructed in 2010 at a construction cost of approximately $430,000. Mill Street Safe Routes to School Improvements Role: Design Engineer Client: City of Anderson Location: Anderson, CA Assisted with preparation of the grant application and project PS&E. Also assisted with construction inspection. The project included some roadway widening, drainage modifications, driveway modifications, and ADA compliance at curb ramps and crosswalk locations. Successfully constructed in 2009 at a construction cost of approximately $300,000. Sutter County Bicycle and Pedestrian Master Plan Role: Design Engineer Client: Sutter County Location: Sutter County, CA Assisted with delivery of a countywide Bicycle Transportation Plan. Reviewed and assisted with preparation of the plan, including preparation of various exhibits and drawings. Bicycle Transportation Master Plan Role: Design Engineer Client: City of Shasta Lake Location: Shasta Lake, CA Assisted with analysis and preparation of exhibits and data for the 2009 Bicycle Transportation Plan for citywide bicycle planning. Page 739 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 63 Devlin Road Segment H and Vine Trail Extension Role: Project Manager Client: City of American Canyon Location: American Canyon, CA Responsible for managing all aspects of design of this roadway and trail project through a greenfield in the City of American Canyon. The nearly one-mile-long new roadway included design of the extension of the Vine Trail, which is a multi-use master planned trail through Napa County. It also included right of way acquisition, design of a new box culvert, utility design and coordination, and Low Impact Development (LID) stormwater solutions, such as bio-retention. The roadway cuts through areas of wetlands which required mitigations and coordination with multiple government agencies. Ukiah Streetscape, Road Diet and Utilities Role: Assistant Project Manager Client: City of Ukiah Location: Ukiah, CA Served as Project Manager of this federally, state and locally funded project. The project includes a road diet through downtown Ukiah reducing the travel lanes, improving parking and pedestrian improvements, adding landscaping and rebuilding the roadway, for a half mile of State Street. The project also includes modification of three traffic signals and sewer and water main replacements. Roadway Repair at Old Cazadero Road Role: Project Manager Client: County of Sonoma Location: Guerneville, CA Served as Project Manager on this slide repair project in Guerneville, CA. The project is federally funded by FEMA and consisted of repairing a roadway embankment failure in rural Sonoma County. The project included storm drainage design, roadway design and 3D modeling, as well as quantity takeoffs and construction cost estimate for the proposed civil improvements. It also included the design of a solider pile wall with tieback anchor piles under the roadway. Lucas Valley Road Realignment Role: Project Manager Client: County of Marin Location: Marin County, CA Leading the design effort for this federally funded project in rural Marin County. Project components include constructing a CIDH soldier pile retaining wall with tie backs to correct a known slide around a tight radius curve and increasing the radius to improve safety and allow for larger vehicles to traverse this portion of the county. Other project components include drainage improvements and right of way acquisition. Design of the project is almost complete and construction went underway in 2018. Jeremy Schmal has over 15 years of experience in civil engineering working with the public sector. He has performed project management and project engineer duties on numerous multimillion dollar public works transportation improvement projects including roundabouts, trails, roadway widening, utility relocation, intersection improvements and traffic signals, and pedestrian improvement projects. Jeremy also has experience in construction management, where he has acted as Resident Engineer and Lead Inspector. Other experience includes traffic engineering, analysis and planning, federal aid funding, high-visibility pedestrian projects and construction and bid support. Relevance to the project Memberships – American Society of Civil Engineers (ASCE); Association of Environmental Professionals (AEP), Central California Section, Member and Past Vice-President; Institute of Traffic Engineers (ITE) Qualifications/Accreditations – BS, Civil Engineering, California State University Fresno, Fresno, CA 2012 – Civil Engineer, CA #87192 Experience 15 years Location Santa Rosa, California Jeremy Schmal, PE Civil Design Lead Page 740 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 64 Jeremy Schmal, PE | Civil Design Lead Grant Avenue Bridge Rehabilitation Role: Project Manager Client: City of Novato Location: Novato, CA Responsible for managing all aspects of this bridge rehabilitation and bridge widening project. The bridge, constructed in 1939, was listed by Caltrans as Functionally Obsolete due to scour and due to the width of the bridge did not contain pedestrian or bike facilities and was adjacent to an intersection with non-standard geometry. The project team evaluated four alternatives through the Type Selection Report and recommended modifying and armoring the existing structure, constructing a new span next to the existing bridge and reconfiguring the intersection with a more standard geometry. The final design implemented recommendations of the TSR and allowed for construction of pedestrian and bike improvements, rock slope protection to correct the scour problems with the existing structure and coordinated utility upgrades and improvements. As well as managing several subcontractors, served as lead designer and acted as the point person through the environmental permitting process. This project also includes environmental mitigation which was achieved through revegetation with native species both in Novato Creek and on its banks. Airport Boulevard Rehabilitation Role: Design Manager Client: County of Napa Location: American Canyon, CA Responsible for oversight of the design and engineering of this roadway rehabilitation project, including the design memo and PS&E submittals. The project includes approximately 0.5 miles of full depth reclamation (FDR-C) for this four-lane roadway. The project also includes ADA compliance upgrades to multiple curb ramps and sidewalks, enhanced pedestrian markings and the addition of bike lanes. The project is adjacent to Caltrans right of way and includes detailed stage construction and traffic handling plans, as well as a Caltrans encroachment permit. Farmersville Roundabouts Project (Federal Project No. HSIPL 5368 (0096) and CML 5368 (010) Role: Project Engineer Client: City of Farmersville Location: Farmersville, CA Responsible for the design and preparation of construction documents for this federally-funded roundabouts project, which provided for the construction of two roundabouts within state right of way, including the first roundabout at a ramp terminus in Caltrans District 6. Involved in the project from initial traffic analysis and feasibility through engineering support during construction. The design included roadway widening and realignment, retaining walls, box culvert modifications, new drainage facilities, street lighting, and landscaping. The project also included extensive staged construction and traffic management planning, right of way acquisition, utility coordination and relocation, and a Caltrans Encroachment Permit. It required coordination between the City of Farmersville, Caltrans project oversight, and the County of Tulare with the majority of the funding being supplied by the CMAQ and HSIP programs. Provided federal aid services including Caltrans Local Assistance coordination, certifications, and preparation of the E-76 award package. The project was constructed with a cost of $5.1 million. Also provided construction support throughout construction. Healdsburg Five-Way Intersection Role: Project Engineer Client: City of Healdsburg Location: Healdsburg, CA The project included constructing a five-way roundabout, as well as extensive utility improvements. The project replaced the existing five-legged signalized intersection with a single-lane modern roundabout with an at-grade heavy rail crossing traversing through the center of the intersection. The project also replaced the sanitary sewer trunk main, water mains, storm drain and reconstructed a box culvert through the intersection. Responsible for finalizing the plans and specifications and assisting through the bid process through to contract award. Once in construction he assisted the construction manager handling design changes and clarifications, RFI’s and submittals. City Hall Campus Sidewalk Reconstruction Role: Project Manager Client: City of Santa Rosa Location: Santa Rosa, CA Responsible for this pedestrian facility improvement and reconstruction project located within a built out portion of downtown Santa Rosa. All ramps and driveways within the project area were non-ADA compliant, as well as most of the sidewalks. There were an extensive number of utility boxes and structures within the improvement areas, many of which required nonstandard designs and coordination with the utility owners. The project also included reconstruction of a portion of a parking garage to allow for compliant pedestrian facilities into the garage and across the driveway. Fulton Road Widening PA/ED (Guerneville Road to Piner Road) Role: Project Engineer Client: City of Santa Rosa Location: Santa Rosa, CA Responsible for utilities engineering, including coordination, identification, location and relocation planning for the design phase of the widening of this major arterial roadway. Page 741 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 65 Trails San Francisco Trail Extension on Doolittle Drive Role: Project Engineer Client: East Bay Regional Park District Location: Oakland, CA Wrote construction specifications for trail improvements plans that incorporated East Bay Regional Park District standards, Caltrans standards, and non-standard technical provisions. Performed technical review of project plans for the trail extension and improvement plan for the Doolittle Trail along the Airport Channel. Electric Greenway Project Role: Project Engineer Client: City of Citrus Heights Location: Citrus Heights, CA Assisted with public outreach visual media such as informational videos and high-resolution 3D conceptual drawings for the proposed 2.9-mile-long bike trail that would connect residences, retail centers, city parks, and public schools in the City of Citrus Heights and Sacramento County. The project involves coordination between various subconsultants, City, County, two park districts, and Sacramento Municipal Utility District (SMUD). SMART Trail Project Role: Project Engineer Client: Sonoma-Marin Area Regional Transport (SMART) Location: Sonoma County, CA Designed trail, retaining walls, drainage systems, and at-grade crossings for the proposed six-mile-long bike trail adjacent to the SMART mainline in the City of Petaluma, City of Penngrove, and Sonoma County. Roundabouts First Street and Second Street Roundabouts along California Boulevard ICE and PS&E Role: Project Engineer Client: City of Napa Location: Napa, CA Assisted with the 60%, 90%, 100%, and final PS&E preparation and engineer review for three roundabouts. Performed hydraulic analysis of proposed storm drain system. Design support for the project report, design drawings, estimates, utility relocations, and right of way acquisition. S) 116/SR 121 Roundabout Intersection Improvements Role: Project Engineer Client: Parsons Transportation Group Location: Sonoma County, CA Modeled the improvements in 3D as basis for design. Set American with Disabilities Act (ADA) grades and ensured proper over-land drainage. Coordinated with multiple subconsultants to provide quality product to client. Haytham Daas is our Regional Building Information Modeling (BIM) Manager and a project engineer who has been a part of designs for roadways, interchanges, complex intersections, rail crossings, and site development projects since he joined GHD in January of 2016. He works collaboratively with our staff in providing civil engineering design and traffic engineering support including feasibility studies, traffic reports, project reports, drainage reports, safety analyses, peer reviews, plan preparation, specifications, estimates, and construction support. He is an expert in assembling computer plans/exhibits using AutoCAD/Microstation software and BIM management. Haytham is well-versed in utility coordination, construction plan reviews, quantity, and cost calculations, and is knowledgeable of design codes such as the Caltrans Highway Design Manual (HDM), Americans with Disabilities Act (ADA)/Public Rights of Way Accessibility Guidelines (PROWAG), American Association of State Highway and Transportation Officials (AASHTO) Roadside Design Guide, and California Manual on Uniform Traffic Control Devices (MUTCD). Relevance to the project Qualifications/Accreditations – BS, Civil Engineering, California State University, Sacramento, CA 2015 Experience 5 years Location Roseville, California Haytham Daas, EIT Civil Design Support – Engineer-in-Training, CA #154447 Page 742 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 66 Haytham Daas, EIT | Civil Design Support SR 99/Eaton Road Roundabout Highway Safety Improvement Program (HSIP), Roundabout PS&E Role: Project Engineer Client: City of Chico Location: Chico, CA Modeled proposed improvements in 3D, which is used as basis of design. Graded SR 99 on-ramps and off-ramps to Caltrans Highway Design Manual criteria, including super elevation rates and grade breaks. Windsor River Road/Windsor Road Roundabout Role: Project Engineer Client: Town of Windsor Location: Windsor, CA Provided roundabout concepts for at-grade road and rail intersection. Considered single-track alternative and double track alternative. Balanced design requirements of rail authority with Town’s design parameters while maintaining safe roundabout design principles. Soscol Ferry Road and Highway 12 Roundabouts Role: Design Engineer Client: Napa Valley Transportation Agency Location: Napa, CA Assisted with plan production, stage construction, traffic handling, and quantities for a dual-roundabout interchange off Highway 12. Roadway/Corridor East Joiner Parkway and Twelve Bridges Drive Pavement Rehabilitation Role: Project Engineer Client: City of Lincoln Location: Lincoln, CA Prepared PS&E package with project bidding support for the rehabilitation of East Joiner/Joiner Parkway between the south city limits and Jorgenson Drive/Twelve Bridges Drive, from Industrial Avenue to Stoneridge Boulevard. Costco Wholesale on Bonnyview Road Role: Project Engineer Client: Costco Wholesale Location: Redding, CA Set horizontal geometry for 2020 improvements and future 2040 improvements. Provided signal and roundabout alternatives for design years. Generated cost estimates on intersection-by-intersection basis and divided costs to direct developer costs versus fair share cost. New Fire Station 1 and Big Gun Quarry Entrance Intersection Design and Site Plan Role: Project Engineer Client: City of Rocklin Location: Rocklin, CA Assisting with the preliminary engineering, studies and reports, and roadway sections of earthwork for a new entrance for a fire station and the Big Gun Quarry entrance. Designed access road to new Quarry Adventure Park, including the park’s parking lots and site work for a new fire station adjacent to the park. Complete Streets/Multimodal Main Street/Shenandoah Road Safe Routes to School Active Transportation Program Grant Application Assistance and PS&E Role: Project Engineer Client: City of Plymouth Location: Plymouth, CA Designed the sidewalk improvements and assisted with the probable cost and 65% PS&E preparation for a Safe Routes to School plan that involves an elementary and charter school. La Quinta Village Complete Street, a Road Diet Project Role: Project Engineer Client: City of La Quinta Location: La Quinta, CA Assisted with preliminary estimates and design for three complete street corridors that will have five roundabouts and several road diet improvements consisting of five roundabouts, water quality infrastructure, pedestrian and bicycle facilities and landscape/beautification elements. Grant Applications Complete Street/Road Diet ATP Application Role: Design Engineer Client: City of La Quinta Location: La Quinta, CA Assisted with preliminary estimates, design for inclusion in the successful Active Transportation Plan (ATP) grant application, and project PS&E. The grant application covers three complete street corridors includes five roundabouts, a road diet, and various pedestrian crossing improvements. The preliminary analysis and design assisted the City to acquire ATP grant funding. Safety SR 49 Multimodal Corridor Study Role: Project Engineer Client: Nevada County Transportation Commission Location: Nevada City, CA [Analyzed SR 49 corridor in Nevada City for pedestrian and bicycle safety concerns. Designed viable alternatives for interim improvements and ultimate improvements including multi-use pathways, roundabouts, and advance warning features. Page 743 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 67 Fulton Road Widening Role: Assistant Project Manager, Lead Civil Engineer Client: City of Santa Rosa Location: Santa Rosa, CA Responsible for managing all aspects of this road widening project of this major arterial, including leading team members through design and coordinating deliverables with City staff. Also responsible for the production of construction documents, including Plans, Specifications, and Estimating (PS&E) and the design of the Low Impact Development (LID) improvements. This project incorporated road widening for approximately one mile of Fulton Road through partially built-out areas, utilizing as much existing infrastructure as possible, and the addition of ADA compliant sidewalks and pedestrian ramps. The project also included the extension of a box culvert, several retaining walls and right of way acquisition. Fulton Rd Rule 20A Improvements Role: Project Manager Client: City of Santa Rosa Location: Santa Rosa, CA Responsible for coordination with the City of Santa Rosa, PG&E, and the on-site contractor during the undergrounding of PG&E’s existing facilities. Coordinated with the contractor to locate the proposed PG&E improvements to verify no conflict with the future improvements for the City of Santa Rosa widening project. Sonoma County ADA Signalized Intersections Phase II Project Role: Project Manager Client: County of Sonoma Location: Santa Rosa, CA Responsible for developing construction documents to bring existing non-compliant ADA ramps throughout the County into compliance. The project included ramps at nine intersections that all had unique challenges. Along with the design of the hardscape of the ramps, the traffic signals were modified to meet Accessible Pedestrian Signal (APS) and California Building Code requirements. Hot Cherry Mill Slide Repair Role: Project Manager Client: County of Sonoma Location: Cloverdale, CA Responsible for these roadway repair projects and was responsible for the preparation of type selection reports and multiple design alternatives for roadway repairs. The reports included hydraulic analysis and drainage feature design and sizing to ensure these areas would not be susceptible to future slides. Due to right of way constraints all alternatives include proposed retaining walls. Kat Harvey’s attention to detail and organizational skills give clients confidence that their project will stay on track for schedule and budget. She has nine years of experience in transportation design, land development, stormwater permitting and design, and Stormwater Pollution Prevention Plan (SWPPP) development. Kat has acted as a project manager and project engineer on numerous large public works improvement and private sector projects. She enjoys finding innovative solutions, utilizing the latest technological advances for clients to keep up with ever changing regulations. Relevance to the project Qualifications/Accreditations – BS, Civil Engineering, California Polytechnic State University, San Luis Obispo, CA 2010 – Civil Engineer, CA #84798 – Qualified SWPPP Practitioner, SWPPP Developer, and Industrial SWPPP Practitioner #25793 Experience 9 years Location Santa Rosa, California Kat Harvey, PE, QSD/QSP Stormwater/LID Page 744 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 68 Kat Harvey, PE, QSD/QSP | Stormwater/LID Sutter Street Extension Role: Assistant Project Manager Client: City of Jackson Location: Jackson, CA Responsible for assisting in managing the design team and coordinating with the environmental, structural, and survey team to analyze multiple roadway alternatives and produce a recommendation memorandum. The design site contained widespread contamination from previous mining activity, as well as protected wetlands that had to be avoided with the proposed designs. Ukiah Streetscape and Road Diet, Phase 1 Role: Project Engineer Client: City of Ukiah Location: Ukiah, CA Responsible for design support of this roadway project, design of the LID and drainage features. As part of the LID design, responsible for ensuring compliance with the State MS4 Phase I permit. The project included a road diet through Downtown Ukiah, reducing the travel lanes, improving parking and pedestrian improvements, adding landscaping, and rebuilding the roadway, which includes sections of old concrete Highway 101 for a half mile of State Street. The project also included modification of three traffic signals and sewer and water main replacements. Devlin Road Segment H and Vine Trail Extension Role: Project Engineer, Lead Designer Client: City of American Canyon Location: American Canyon, CA Responsible for design of the roadway project through a greenfield in the City of American Canyon. The nearly one- mile-long new roadway included design of the extension of the Vine Trail, which is a multi-use, master-planned trail through Napa County. It also included right of way acquisition, design of a new box culvert, utility design and coordination, and LID stormwater solutions, such as bioretention. The roadway cuts through areas of wetlands which required mitigations and coordination with multiple government agencies. Stockrest Springs Roundabout Role: Project Engineer Client: Town of Truckee Location: Truckee, CA Responsible for the design of the storm drain and LID features and preparation of the associated calculations for the PS&E, which includes modifying the intersection into a roundabout with pedestrian and bicycle facilities, water quality features, underground drainage facilities, and utility coordination. Windsor River Road/Windsor Road Intersection Improvements and Multi-Use Path Connector | Role: Project Engineer Client: Town of Windsor Location: Windsor, CA Responsible for design of the LID improvements and coordination with the Regional Water Quality Control Board to establish criteria for design exceptions and offset measures for stormwater compliance. The project involves redesign of an existing signalized intersection into a four-leg roundabout, as well as improvements to wet and dry utilities. The project will be required to comply with current stormwater regulations under the State’s MS4 Phase I permit. Grant Avenue Bridge Rehabilitation Role: Project Engineer Client: City of Novato Location: Novato, CA Responsible for preparation of Construction documents, specifications, and cost estimating (PS&E) for this bridge rehabilitation and bridge widening project. The project team evaluated four alternatives through the Type Selection Report and recommended modifying and armoring the existing structure, constructing a new span next to the existing bridge and reconfiguring the intersection with a more standard geometry. The final design implemented recommendations of the TSR and allowed for construction of pedestrian and bike improvements, rock slope protection to correct the scour problems with the existing structure, and coordinated utility upgrades and improvements. This project also includes environmental mitigation which was achieved through revegetation with native species both in Novato Creek and on its banks. Development Review Role: Project Manager Client: Town of Windsor Location: Windsor, CA Responsible for coordination with the Town of Windsor to complete review of submitted improvement plans, stormwater (LID) reports, and WELO plans. Review of plans included confirming compliance with local and state regulations and standards. 2019 Street Rehabilitation Role: Project Manager Client: City of Sonoma Location: Sonoma, CA Responsible for coordination with the City of Sonoma and management of staff to develop Construction Documents for pavement rehabilitation of two street segments within the City limits. The project included an initial site visit, during which data was collected and then used to evaluate pavement condition and provide rehabilitation method recommendations. Page 745 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 69 Ukiah Streetscape and Road Diet, Phase 1 Role: Traffic Engineering Lead Client: City of Ukiah Location: Ukiah, CA Responsible for traffic engineering for this federally, state and locally funded project includes a road diet through downtown. The project reduced travel lanes, improving parking and pedestrian improvements, added landscaping and rebuilding the roadway. Mendocino Council of Governments Rail with Trail Corridor Plan Role: Senior Traffic Engineer Client: Mendocino Council of Governments Location: Ukiah, CA Responsible for coordination and preliminary engineering design of trail crossings adjacent to railroad grade crossings. Developments of planned future improvements were coordinated with engineering design standards and probable future grade crossing improvements. Town of Windsor Conde Lane/Johnson Street Pedestrian Enhancements Role: Project Manager Client: Town of Windsor Location: Windsor, CA Responsible for leading design of signing, striping, lighting, and an enhanced pedestrian crosswalk using RRFB at the realigned intersection of Johnson Street and Conde Lane in the Town of Windsor. The project will realign Conde Lane and remove all-way stop control to reduce delay and increase traffic flow between two adjacent traffic signals. The all-way stop control is currently a "T" intersection with traffic signals on two adjacent legs; morning and afternoon peak traffic from a nearby elementary school backs up from the stop controls to either signal. The project requires coordinating among the Town, the design team, and neighborhood stakeholders to build consensus for the final design. City of Ukiah Clay Street At-Grade Crossing CPUC Application Role: Traffic Engineer Client: City of Ukiah Location: Ukiah, CA Responsible for coordination and preliminary engineering design of vehicle and pedestrian/bicycle at-grade railroad crossing and application to CPUC under Rule 3.7 “Public Road across Railroad.” Application resulted in decision authorizing the City to construct a new at-grade crossing. A registered traffic engineer and civil engineer with certification as a professional traffic operations engineer, Frank Penry has 25-years of experience in transportation planning and traffic engineering design. He has managed numerous transportation studies and design projects over the years, from small development impact studies to major roadway improvements. Frank has served as the City Traffic Engineer for the Cities of Petaluma, Cotati, Sonoma, Windsor, and Fortuna, providing the administration and development of Municipal Traffic Engineering Programs. He is well-versed in a wide range of traffic engineering design standards and encroachment requirements, traffic signals, roundabouts, traffic calming and streetscapes, construction traffic handling, detour, and control plans for a variety of civil engineering projects. His experience includes traffic operations, traffic signal timing and design, Intelligent Transportation Systems (ITS), Transit Signal Priority (TSP), feasibility studies; environmental studies and documents; roadway and intersection design; signing and striping design; and traffic control plans. Relevance to the project Memberships – Past President SF Bay Section, Institute of Transportation Engineers (ITE); Past President Redwood Empire Branch, American Society of Civil Engineers (ASCE); Registered Traffic Engineers of America (RTEA) Qualifications/Accreditations – BS, Civil Engineering 1996 Experience 25 years Location Santa Rosa, California Frank Penry, PE, TE, PTOE Traffic/CPUC Coordination Page 746 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 70 Frank Penry, PE, TE, PTOE | Traffic/CPUC Coordination Eureka Waterfront Trail Role: Project Traffic Engineer Client: City of Eureka, Redwood Coast Action Agency Location: Eureka, CA Responsible for traffic engineering of the project alternatives analysis, public outreach, and development of environmental compliance documents and engineering design for a Class 1, ADA accessible, non-motorized one-mile bicycle trail along Waterfront Drive in Eureka to serve as a portion of the California Coastal Trail network. The project included topographic survey, natural features inventory, analysis of environmental impacts, re-alignment analyses, and intersection and trail alternative development and final design. East Washington Pedestrian Crossing Role: Project Manager Client: City of Petaluma Location: Petaluma, CA Responsible for transportation planning and traffic engineering of roadway and warning signal improvements to facilitate pedestrian safety at East Washington Street and the Urban Ring Trail. Included in the project was a new pedestrian- activated enhanced flashing crosswalk, pedestrian refuge area, pedestrian corral, ADA curb ramps, and vehicle channelization improvements. Served on staff at the City when the project was originally identified by the City as a high priority location for an enhanced crossing to alert drivers of pedestrian and bicycle cross traffic. |Jennings Avenue Bicycle and Pedestrian Crossing EIR Role: Traffic Engineer Client: City of Santa Rosa Location: Santa Rosa, CA Served as Traffic Engineer responsible for the development of the TIA and the associated Transportation Section of the EIR. The project was a result of a closure of an informal at- grade crossing per California Public Utilities Commission (CPUC) requirements under SMART operations. The analysis reviewed operational impacts associated with closing one of three potential at-grade crossings to retain the Jennings Ave pedestrian and bicycle at-grade crossing or provide a new overcrossing. Railroad At-Grade Crossing Design and Implementation Services Role: Senior Project Engineer Client: North Coast Rail Authority (NCRA) Location: Petaluma, CA Responsible for the design of railroad at-grade crossing improvements across the SMART right of way at both East Washington Street and D Street for operation of freight trains by the North Western Pacific Railroad (NWPR) for NCRA. Project included analysis, engineering design, construction observation, pre-emption equipment development and implementation, and close coordination of operation with follow-up visits. City of Arcata Rail-with-Trail Connectivity Role: Project Traffic Engineer Client: City of Arcata Location: Arcata, CA Responsible for coordination and preliminary engineering design of trail crossings adjacent to railroad at-grade railroad crossings. Developments of planned future improvements were coordinated with engineering design standards and probable future grade crossing improvements. Evaluated vehicle and pedestrian/bicycle interactions at trailheads, road crossings, and bike lanes along City streets for a siting study and public involvement process, environmental analysis, and engineering design for a Class 1, ADA-accessible, non-motorized five-mile bicycle trail. Initial Operating Segment (IOS) At-Grade Crossing Improvements Role: Senior Traffic Engineer Client: SMART Location: CA Currently provides on-call traffic engineering service to SMART, which includes analysis, engineering design, construction observation, pre-emption equipment development & implementation, for the Initial Operating Segments (IOS). Work included jurisdictional coordination and railroad at-grade crossing diagnostic reviews from Guerneville Station to Marin County Civic Center. SMART Windsor Rail Extension Role: Project Manager Client: Sonoma County, Town of Windsor Location: Sonoma County, CA Served as Project Manager providing civil and traffic engineering services to SMART for a three-mile railroad extension and parallel bicycle-pedestrian path along the publicly owned Northwestern Pacific Railroad right-of-way. Work included analysis, engineering design, diagnostic, supplemental safety measures, and pre-emption equipment development, for the extension project. Provided jurisdictional coordination and railroad at-grade crossing diagnostic reviews for all at-grade crossing within the extension. Page 747 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 71 California High-Speed Rail Initial Construction Segment 1 Role: Project Engineer Client: TPZP Joint Venture Location: Fresno, CA Responsible for traffic signal modifications, temporary signals, and new signalized intersection improvements for this project, which includes 70 locations in the City of Fresno, and 19 miles of street lighting for 40 corridors within the project limits. The project also requires planning level signal warrant analysis for another 15 intersections and additional streetlight and signal designs, as required. Byung will also design interim and permanent ITS improvements to fiber optic facilities, wireless broadband radio, Changeable Message Signs (CMS), flashing beacons, intersection safety lighting, and vehicle priority systems within the City of Fresno and Caltrans right of way. Mission Bay Project Role: Traffic Engineer Client: San Francisco Municipal Transportation Agency Location: San Francisco, CA Responsible for designing or modifying a total of 24 signals and preparing signing and pavement delineation for 34 city blocks, as well as a roundabout at Mission Bay Drive and Berry Street. Also designed or modified three traffic signals and provided signing and pavement delineation including a two-way cycle track in Blocks 29-32, the location of the new Golden State Warriors Arena. The 24 traffic signals include those along The Light Rail Transit (LRT) line on 3rd and 4th Streets, which require a signal priority system for the light rail trains. There are also at-grade Caltrain rail transit crossings at two intersections and three I-280 Caltrans signals. Byung coordinated the design of signals, intersection geometries, and the LRT signal priority system with several city, state, and regional agencies. Dublin Kaiser Traffic Signal Modification Role: Traffic Engineer Client: Kaiser Permanente Location: Dublin, CA Responsible for modifying traffic signals for a new Kaiser hospital in Dublin. The traffic signal design includes preparing the required signal modification plans, signing/striping plans, specifications, and engineer’s construction costs. East Bay Bus Rapid Transit (BRT) Role: Project Engineer Client: Alameda-Contra Costa Transit District Transit Location: Oakland, CA; San Leandro, CA Served as Project Engineer to construct 33 raised-platform stations and dedicated bus lanes along the 9.5-mile International Boulevard corridor between downtown Oakland and the San Leandro Bay Area Rapid Transit (BART) station. Prepared PS&E for signing and striping and provided Maintenance-of-Traffic design schematics and schedule for project construction. Refined BRT station locations, pedestrian access to the stations, temporary relocation of bus stops, and traffic detours during the construction period. Byung Lee is registered as both traffic engineer and civil engineer in the state of California. He has over 15 years of experience providing traffic operations, traffic engineering design, and Intelligent Transportation System (ITS) engineering design for projects throughout the State. His experience covers a wide range of project types including signal design, lighting design, signing and striping plans, traffic operations, and safety analyses. Byung has extensive hands-on experience in traffic operations/micro simulation models, including Synchro, SimTraffic, and VISSIM. Relevance to the project Membership – Institute of Transportation Engineers, Bay Area Section Qualifications/Accreditations – MS, Civil & Environmental Engineering, University of California, Berkeley, CA 1999 – Civil Engineer, CA, #90221 – Traffic Engineer, CA #2908 Experience 15 years Location Santa Rosa, California Byung Lee, PE, TE Traffic/CPUC Coordination Page 748 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 72 Byung Lee, PE, TE | Traffic/CPUC Coordination Shattuck Avenue Improvements and Pedestrian Safety Role: Traffic Engineer Client: City of Berkeley Location: Berkeley, CA Served as Traffic Engineer for the Shattuck Avenue Reconfiguration project. The project consists of modifying traffic signals at four intersections: Center/Shattuck, University/Shattuck, Addison/Shattuck, and Allston/Shattuck. The project will convert the three-block segment of western/ southbound Shattuck Avenue into a two-way street, and the eastern/northbound segment into a minor street for local traffic. The final design plans have been submitted and CHS Consulting Group will participate in the upcoming construction phase. Oakland-Alameda Freeway Access Project Approval/ Environmental Document (PA/ED) Role: Project Engineer Client: Alameda County Transportation Commission Location: Oakland, CA; Alameda, CA Responsible for technical analyses for surface roadways that required extensive SYNCHRO and SimTraffic simulation model validation and calibration. Numerous detailed operations analyses were performed to test viability of changes in circulation patterns and connections for alternatives in the project vicinity to reduce impacts in Oakland’s Chinatown. The traffic analysis included nine on- and off-ramps, 15 intersections, and five mainline segments. Clement Avenue Complete Street Role: Project Manager Client: City of Alameda Location: Alameda, CA Responsible for preparing traffic signal modification to include bike signals; rectangular rapid flashing beacons; and Plans, Specifications, and Estimates (PS&E). King & Southbound I-680 Off-Ramp Traffic Signal Design Rehabilitation Role: Project Manager Client: City of San Jose Location: San Jose, CA Responsible for preparing a safety analysis and signal design PS&E with the goal of reducing frequent damage and crash potential at the intersection. The plans are being prepared in accordance with City of San Jose and Caltrans standards. BART North Berkeley Station Bicycle and Pedestrian Improvement Project Role: Project Engineer Client: City of Berkeley Location: Berkeley, CA Responsible for the design of traffic circulation around the North Berkeley BART Station, including vehicular, pedestrian, and bicycle circulation surrounding the station as well as within the parking lot. This also included a bicycle trail and cycle track connection into the BART parking lot. Page 749 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 73 Coyote Creek Trail – Brokaw Road to Union Pacific Railroad Role: Senior Structural Engineer Client: City of San Jose Location: San Jose, CA As Senior Structural Engineer, provided design of the structural features of this approximately one-quarter-mile-long multipurpose trail, which included retaining walls, guard rails and trail canopy structures. The trail is 12 feet wide and composed of asphalt concrete pavement with two-foot-wide compacted virgin base rock shoulders. The majority of the trail is on top of the existing levee or creek bank. A unique feature of the trail is that it passes beneath an existing railroad trestle. This necessitated the design of a canopy to protect trail users from falling debris that may be caused by a passing train. The canopy design was composed of steel incorporating a metal deck and tube steel structure, which included access hatches so that the train trestle could be inspected from below on top of the canopy. Additionally, the canopy was supported from one side of the trail only so it would not interfere with the view. Steve also designed conventional cast-in-place concrete retaining walls to support earth cut sections along the trail way. Jennings Avenue Pedestrian Crossing Role: Senior Structural Engineer Client: City of Santa Rosa Location: Santa Rosa, CA As Senior Structural Engineer designed a pedestrian bridge to span 40 feet over the Smart Train rail crossing. To meet Americans with Disabilities Act (ADA) requirements the bridge contained multiple spans to achieve the required height for the crossing. The bridge consisted of prestressed concrete planks spanning between cast-in-place concrete bent columns supported on a cast-in-place concrete pile foundation system. Repair of Nathanson Creek Retaining Wall Role: Senior Structural Engineer Client: City of Sonoma Location: Sonoma, CA As Senior Structural Engineer, investigated cause and designed repairs for a failing unmortared stacked rock retaining wall for the City of Sonoma, California. Retaining wall retained approximately 10 feet of earth, as well as the south side of Napa Street. Wall extended for over 60 feet along Napa Street adjacent to downtown Sonoma and was observed to be sliding into the creek. The concern was that it would eventually fail destroying a section of Napa Street. 241 Plant Road Role: Senior Structural Engineer Client: Mendocino Transit Authority Location: Ukiah, CA As Senior Structural Engineer, designed a maintenance facility, fuel storage pad with canopy and detail canopy for TLCD Architecture. The single-story maintenance facility with a mezzanine measured 76 feet by 170 feet. Its superstructure was Steve Burns is a professional engineer with over 30 years of experience in the design and analysis of building, civil, and bridge structures. Steve has extensive experience with structural design, both new construction and repair/retrofit. In the building industry, he has performed new building design, as well as seismic retrofit for concrete, steel, masonry, and wood structures. Relevance to the project Membership – Structural Engineers Association of Northern California Qualifications/Accreditations – MS, Structural Engineering, University of California, Berkeley, CA, 1991 – BS, Engineering, San Francisco State University, San Francisco, CA, 1980 – Civil Engineer, CA #51369 – Structural Engineer, CA #4229 – Mechanical Engineer, CA #26600 Experience 30 years Location Santa Rosa, California Steve Burns, PE, SE, ME, LEED AP Structural Qualifications/Accreditations – Leadership in Energy and Environmental Design Accredited Professional (LEED AP), US Green Building Council – Construction Documents Technologist (CSI) Page 750 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 74 Steve Burns, PE, SE, ME, LEED AP | Structural composed of steel moment frames supporting a metal roof deck utilizing a tension tie rod braced diaphragm. The roof was composed of metal decking supported by open web steel joists. Surrounding the perimeter of the building was a 10-foot- tall cantilever masonry wall. The fuel storage pad with canopy measured 44 feet by 52 feet. The canopy was composed of ordinary steel moment frames. The clean detail canopy measured 16 feet by 30 feet and was tie rod braced. Hill Road Bridge Role: Senior Structural Engineer Client: County of Mendocino Location: Mendocino County, CA As Senior Structural Engineer designed foundations for a steel truss type bridge to replace an existing aging steel truss bridge built circa 1925. The project was funded from a grant from the Federal Highway Administration’s Highway Bridge Program. The existing bridge met the eligibility requirements for replacement since it was rated “Structurally Deficient,” having a sufficiency rating less than 50. The project was unique in that on one end of the bridge the abutment had to be designed using the Caltrans guidelines for liquefaction induced lateral spreading. The design lateral spread soil movement was 60 inches and the crust layer thickness were 17 feet thick over a 12-foot liquefiable layer. Stony Point Road Widening Role: [Role] Client: City of Santa Rosa Location: Santa Rosa, CA As Senior Structural Engineer, modified an existing box culvert on Stony Point Road at Roseland Creek, Santa Rosa, California. Modifications included the inclusion of a new box culvert running parallel and adjacent to the existing, extension of the existing culvert to assist in road widening, wing wall design and miscellaneous retaining wall design. Modifications were made in accordance with the AASHTO LRFD bridge design specifications, sixth edition, with California amendments and Caltrans standard details. Healdsburg Roundabout Role: Senior Structural Engineer Client: City of Santa Rosa Location: Santa Rosa, CA As Senior Structural Engineer, designed retaining walls and culvert replacements for the City of Healdsburg, CA. The culvert measured 104-feet in length by 10-feet in width by 14- feet in depth and extended under a roundabout. The retaining walls measured 56-feet in length and retained up to 12.5-feet of retained earth on both sides of a creek after exiting from the afore mentioned culvert. All structures were cast-in-place concrete designed in accordance with the 2013 California Building Code. Connections of the culvert to an existing culvert and various light pole foundation were also designed. Fulton Road Widening Guerneville Road to Piner Road Role: Senior Structural Engineer Client: City of Santa Rosa Location: Santa Rosa, CA As Senior Structural Engineer, designed four retaining walls for the City of Santa Rosa. Three of the designs were unique in that in order to eliminate the need for excavating large quantities of soil and disrupting the existing roadway behind the wall during construction these walls were designed supported on cast-in-place concrete piles and functioned somewhat like a soldier pile wall. One 98-foot segment was designed as a conventional concrete retaining wall. The total length of walls was approximately 530 feet. The maximum retained earth height was 18 feet. A box culvert with transition segments one through the wall and the other to an existing junction box was also designed. Stony Point Road Widening Role: Senior Structural Engineer Client: City of Santa Rosa Location: Santa Rosa, CA As Senior Structural Engineer, designed a culvert extension and various retaining walls for the Stony Point Road Widening project. Culvert extensions were designed for both a new precast concrete culvert and for extending an existing cast- in-place concrete culvert. Retaining walls were conventional cast-in-place retaining walls supporting up to nine feet of retained earth with vehicle and earthquake surcharges. Culvert headwalls were also designed. Pine Flat Road Role: Lead Structural Engineer Client: City of Santa Rosa Location: Santa Rosa, CA As Lead Structural Engineer, supervised the design of an emergency repair for a portion of bear canyon road that had sloughed away during a winter storm. Repair consisted of the design of a solder pile retaining wall. Soldier piles were made from W14x61 wide flange elements cantilevering from cast-in-drilled hole concrete piers. Lagging was composed of precast reinforced beam elements. Design was performed in accordance with the 2013 California Building Code. Windsor River Road Pavement Repair Role: Senior Structural Engineer Client: City of Windsor Location: Windsor, CA As Senior Structural Engineer, designed a retaining wall to support a portion of Windsor River Road that was sloughing away, Windsor, California. Repair consisted of the design of a solder pile retaining wall. Soldier piles were made from HP12x53 wide flange elements cantilevering from cast-in-drilled hole concrete piers. Lagging was composed of precast reinforced beam elements. Design was performed in accordance with the 2013 California Building Code. Page 751 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 75 Eureka Waterfront Trail Project, Phases A and C Role: Project Engineer Client: City of Eureka Location: Eureka, CA Structural design of bridge abutments and wingwalls for pedestrian bridges as well as boardwalk helical piles. Storm Damage Repairs Briceland Thorne Road at PM 3.08 Role: Project Engineer Client: County of Humboldt Department of Public Works Location: Eureka, CA Structural design of 22’ tall soldier pile retaining wall with ground anchors. Performed structural calculations using Shoring Suite and Enercalc software, drafted plans using AutoCAD/Civil 3D, and wrote specifications. Storm Damage Repairs Mattole Road at PM 13.67 Role: Project Engineer Client: County of Humboldt Department of Public Works Location: Eureka, CA Structural design of soldier pile retaining wall with anchor piles and precast concrete lagging. Performed structural calculations using Shoring Suite and Enercalc software, drafted plans using AutoCAD/Civil 3D, and wrote specifications. Storm Damage Repairs Mattole Road at PM 42.76 Role: Project Engineer Client: County of Humboldt Department of Public Works Location: Eureka, CA Structure design of 20’ tall welded wire mechanically stabilized earth (MSE) retaining wall. The wall was used as a permanent traffic-supported wall for a county road. Duties include performing local external stability and internal pullout and rupture stability calculations utilizing MSEW software, drafted plans using AutoCAD/Civil 3D, and specifications. Lower Alameda Creek Fish Passage Improvement Role: Project Engineer Client: Alameda County Water District Location: Fremont, CA Structural design, as part of a structural team, complex, large- scale fish ladder/water intake structure. Performed structural calculations for reinforced concrete earth retaining structures, sheet pile retaining walls, structural steel appurtenances, catwalk beam sizing, and soil anchor tiebacks. Jameson Creek Fish Passage Improvement Role: Project Engineer Client: City of Fortuna Location: Fortuna, CA Structural design and observation of reinforced concrete head/ wing wall structures for the replacement of an existing CMP culvert with a precast box culvert to improve fish passage and aquatic habitat. Performed structural calculations, drafted plans using AutoCAD/Civil 3D, and wrote specifications. Stephanie is a civil engineer with eleven years of experience on structural and transportation projects involving retaining wall design, bridge/culvert design, fish passage structure design, building renovation structural design, hydraulic design and roadway design. Her professional area of focus is structural, retaining wall and bridge engineering, having designed several retaining walls and vehicular and pedestrian bridge sub- and super structures, concrete fish passage structures, and seismic and shear wall analyses of building rehabilitations. Mrs. Gould also has experience in civil site design including grading and earthwork/geotechnical design and she has experience in the design of water quality storm water systems, including the development of SWPPP and SWFP documents for various transportation projects. She is fluent in AutoCAD/Civil 3D, MSEW, Shoring Suite, and Enercalc. Relevance to the project Qualifications/Accreditations – BS, Civil Engineering, California State University, Chico, CA 2009 Experience 10 years Location Eureka, California Stephanie Gould, PE Structural Page 752 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 76 Stephanie Gould, PE | Structural Hillside & Rohner Creeks Minor Flood Control Improvements Role: Project Engineer Client: City of Fortuna Location: Fortuna, CA Structural design of several head/wing wall structures for the replacement of three (3) large steel arch culverts with aluminum structural plate pipe arch culvert to reduce wide- spread flooding and improve fish passage and aquatic habitat. The soils at the site were deemed corrosive so we had to work concurrently with corrosion engineers to incorporate measures to prolong the life of the concrete and culvert material. Hillside Stabilization Role: Project Engineer Client: Big Rock Community Services Location: Hiouchi, CA Project engineer for the replacement and relocation of the town of Hiouchi’s water storage tank. Designed foundations for structures, and soil nail retaining wall. Duties included structural design for the soil nail wall and foundations, developed the project technical specifications for the civil and structural project elements, and drafted the civil and structural plans. Dominie & Rowdy Creek Fish Passage Improvement Role: Project Engineer Client: Tolowa Dee-Ni’ Nation Location: Smith River, CA Worked on the design of a fish passage/creek improvement project. The project included several retaining wall structures, drilled piers, soil anchors, concrete fish ladder structures, and bridge stabilization of a demolished apron. Bear Gulch Upper Division Fish Passage Role: Project Engineer Client: CalWater Location: Woodside, CA Structural design of a fish ladder/water intake structure that includes running structural calculations for earth retaining structures, drilled piers, calculating soil bearing pressures and interpreting geotechnical report to design a fully stable structure to resist strong seismic events given the location of the project is just one-half mile from the San Andreas Fault. Kernen Construction Bridge Projects Role: Project Engineer Client: Kernen Construction Location: Humboldt County, CA Structural design and observation of numerous single lane, steel wide-flange girder precast concrete deck bridges fabricated by Kernen Construction. Several project have involved stream crossing work performed in conjunction with the USDA’s Natural Resources Conservation Service. Wastewater Treatment and Disposal System – Utility Infrastructure Replacement Seismic Strengthening Role: Project Engineer Client: College of the Redwoods Location: Eureka, CA Structural design of concrete structures for new wastewater system at a local community college that included a septic tank, recirculation tank, recirculating gravel filter, and a CMU maintenance building. Design included cast-in-place reinforced concrete underground walls for various structures. Martin Slough Habitat Enhancement Role: Project Engineer Client: RCAA Location: Eureka, CA Structural design for a slough crossing that included sheet pile retaining walls and a precast, prestressed slab bridge. Page 753 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 77 OBAG Project: 5039 (023) Safe Routes to School, Phase 2 Role: Land Surveyor Client: City of Cloverdale Location: Cloverdale, CA This is a federally funded project that includes pedestrian pathway and sidewalk gap closures, ADA curb ramps, restriping for Class II bike lanes, including green markings. The project included preparation of legal plats and descriptions for new sidewalk easements for the project, coordinating with the City’s right-of-way agent for acquisition of real property rights and assistance with the right of way certification for the project. In addition, GHD prepared the NEPA technical studies for the project for the project NEPA document and prepared the request for authorization and PS&E submittal for construction spending authorization. Petaluma Complete Streets Project (STPL 5022(055) Role: Land Surveyor Client: City of Petaluma Location: Petaluma, CA This is a federally funded project, which limits include approximately 4,500 linear feet of Lakeville Street and East D Street, two heavily traveled arterials within the City. The project will rehabilitate the existing pavement section, reconstructed pedestrian curb ramps for ADA compliance, provide high visibility cross walks and/or rectangular rapid flashing beacons at pedestrian crossings, and incorporate Class II bike lines or shared lanes throughout the project limits. Napa Road Rehabilitation Project (STPL-5114(017) Role: Land Surveyor Client: City of Sonoma Location: Sonoma, CA This is a federally funded project with limits include approximately 2,700 linear feet of Napa Road, an arterial roadway within the City. The project will rehabilitate the existing pavement section, reconstruct pedestrian curb ramps for ADA compliance and reconfigure the roadway for Class II bike lanes or shared lanes throughout the project limits. GHD provided full Federal Aid services to the project, including Caltrans Local Assistance coordination, field review, PES, NEPA technical studies, utility work, right-of-way certification and preparation of federal authorization for construction. Stony Point Road Reconstruction and Widening (Phase 2) Role: Land Surveyor Client: City of Santa Rosa Location: Santa Rosa, CA The project included the design of traffic signal modifications and new traffic signal system designs at six locations for preparation of construction plans, specifications and estimate. The project included one new complete traffic signal system, two new RRFB installations mid-block pedestrian crossings, and modification of three existing traffic signal systems due to roadway widening and upgrades for ADA compliance. The Stony Point corridor utilize 2070 traffic controllers with SCATS traffic system programming. Mid-block pedestrian crossings were designed with pedestrian refuge islands for compliance with the Richard Maddock is a California registered professional land surveyor. He has over 20 years of experience in all aspects of land surveying. He is an experienced party chief working on projects varying from winery construction staking to subdivisions. With the budget and time line in mind he delivers a superior product for the client. In the field he will be the Party Chief of the primary survey crew. Being the Party Chief will provide him with first-hand knowledge of the site, the condition of the existing monuments and other important information critical to producing an accurate survey performance areas. Relevance to the project Qualifications/Accreditations – Professional Land Surveyor, CA #8131 – Solano Community College Experience 20 years Location Santa Rosa, California Richard Maddock, PLS Survey Lead Page 754 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 78 Richard Maddock, PLS | Survey Lead California Manual on Uniform Traffic Control Devices. Other design items include use of City standard video detection for limit line and intermediate detection and other provisions designed to meet the City Traffic Standards. On-Call Engineering and Development Review Services Role: Land Surveyor Client: City of Sonoma Location: Sonoma, CA Richard provided map checking and survey services as needed for various assignments. GHD provided City engineering and development services for the City Public Works Department. Services included development plan review and final map review. Developments were residential and commercial. On-Call Engineering and Development Review Services Role: Land Surveyor Client: City of Rio Dell Location: Rio Dell, CA GHD has served as Rio Dell’s Contract City Engineer and engineering support staff for over 15 years. Richard has provided map checking and land survey services for review of proposed developments including subdivisions, lot line adjustments, and annexations, for compliance with the subdivision map act, and the City’s subdivision and grading ordinances. Eastside Trunk Sewer Phase 2 Role: Land Surveyor Client: City of Rohnert Park Location: Rohnert Park, CA Land Surveyor for the completion of the design documents for $10 million 10,000-linear foot, 18- and 24-inch diameter PVC sanitary sewer main project. Recycled Water Expansion Project Role: Land Surveyor Client: North Marin Water District Location: Marin County, CA Land Surveyor and Project Manager for surveying, right-of-way mapping, and field survey of the alignment to expand the North Service Area of their Recycled Water Project. Sewer Interceptor/Outfall Role: Land Surveyor Client: City of Rohnert Park Location: Rohnert Park, CA Land Surveyor for the predesign and design for this 3.5- mile, 27-inch diameter, HDPE sewer force main. The pipeline is aligned through habitat areas for the California Tiger Salamander and vernal pool areas. This $8.5 million pipeline was constructed on a fast-track schedule and was just operational when the City experienced a 100-year storm event, avoiding potentially significant SSOs. Napa River Park Role: Land Surveyor Client: City of Napa Location: Napa, CA Provided survey for this project using Lieca GPS and Lieca 1203 Total Station to map the upland and river bottom for design and pre–dredge earthwork calculations. Produced all in compassing map of the uplands and waterways including utilities and structures along top of bank for slope analysis. San Francisco Marina Yacht Harbor Role: Land Surveyor Client: San Francisco Recreation and Parks Location: San Francisco, CA Provided survey for this project using Lieca GPS and Lieca 1203 Total Station to map the marina and harbor bottom for design and pre–dredge earthwork calculations. Felix Creek Fish Passage and Dam Repair/Removal Project Role: Land Surveyor Client: City of Hopland Location: Hopland, CA Provided survey for this project using Leica GPS and Leica 1203 Total Station to provide topographical mapping for design of Fish Passage channel improvements. Detail topographic map verifying culvert design for hydraulic analysis. Nathensen Creek Drainage Study Role: Land Surveyor Client: City of Sonoma Location: Sonoma, CA Provided survey for this project using Lieca GPS and Lieca 1203 Total Station to map the creek cross sections and uplands for the drainage study for the City of Sonoma. Redwood Creek Drainage Study Role: Land Surveyor Client: Napa County Location: Napa, CA Provided survey for this project using Lieca GPS and Lieca 1203 Total Station to map the creek cross sections and uplands for the drainage study for the County of Napa. San Anselmo Culvert Fish Passage Project Role: Land Surveyor Client: County of Marin, Location: Marin, CA Provided survey for this project using Leica GPS and Leica 1203 Total Station to provide topographical mapping for design of Fish Passage channel improvements. Detail topographic map verifying culvert design for hydraulic analysis. Page 755 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 79 El Dorado Trail Project, Segments 1 & 2 Role: Surveyor Client: City of Placerville Location: Placerville, CA Provided the topographic survey of proposed bicycle and pedestrian trail route along an old railroad grade. Resolved and mapped the right of way to avoid the need to acquire additional real property rights. The completed project added two missing segments of the El Dorado Trail system to provide key connections of the trail to historic downtown Placerville. The multi-use trail provides the community with public health, economic, and transportation benefits, as well as an increase of community pride and identity. The first segment was from Ray Lawyer Drive to Main Street and was constructed along an existing railroad right of way. The second segment was in the downtown area from Clay Street to Bedford Avenue adjacent to Hangtown Creek/US 50 interchange and required coordination with adjacent projects to ensure the designs conformed to each other. E. Ninth Street Public Infrastructure Replacement Role: Surveyor Client: City of Lincoln Location: Lincoln, CA Prepared the topographic and right of way survey base for the design and PS&E of complete streets that include water/ sewer improvements, street improvements, and sidewalks. Provided the boundary resolution, drafting/mapping, field surveying, topographic and right of way surveys, project control, utility investigation and evaluation, utility mapping, and utility coordination. County Road 55 (Pencil Road) Topographic Survey Role: Surveyor Client: Modoc County Location: Modoc County, CA Prepared a topographic survey map of Pencil Road from SR 299 to Modoc National Forest boundary (four miles) using GPS to establish geodetic control and Real-Time Kinematic (RTK) field surveying. The map included all natural and man-made features within the right of way and a Digital Terrain Model (DTM). Lassen National Park Road Reconstruction Road Widening and Slide Repair Role: Surveyor Client: Shasta, Tehama and Lassen Counties Location: Shasta, Tehama and Lassen Counties, CA Establish control, construction staking and topographic mapping at several park road locations. Roadway reconstruction at Sulpher Works, a stacked wall at a turn out, and slide repair all along Highway 89 through the park. Performed work in environmentally sensitive areas and provided slope staking in rugged terrain. Brian manages the firm’s Northern California surveying projects and supervises surveyors, scheduling field and office personnel. Throughout his over 35-year career, he has performed surveying and right of way engineering on a full range of surveying projects, serving as project manager and party chief. Brian has extensive experience with topographic, boundary, and construction surveying, as well as expertise with geodetic and photogrammetric control, hydrographic surveying, optical tooling and monitoring surveys. He has surveyed in all types of environments from the highly industrial settings of chemical plants, steel mills, and oil refineries to remote areas staking slide repairs and establishing boundary lines; including work in the vast majority of California’s counties. Brian also has additional surveying experience in Nevada, Oregon, and Hawaii. Relevance to the project Membership – California Land Surveyor Association Qualifications/Accreditations – BS, Survey and Photogrammetry, California State University, Fresno, CA 1986 – AS, Engineering, College of the Siskiyous, Weed, CA 1982 – Professional Land Surveyor, CA #7250 Experience 35 years Location Redding, California Brian Howard, PLS Survey Support Page 756 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 80 Brian Howard, PLS | Survey Support Beckwith and Westside Road Reconstruction Role: Surveyor Client: AEC Incorporated Location: Calaveras County, CA Performed the topographic survey, right of way resolution, and construction staking for two miles of this six-mile county road. Determined the locations of deeded and prescriptive rights of way. Bear Creek at Pinnacles National Park Role: Surveyor Client: TL Peterson Construction Location: San Benito County, CA Provided the topographic mapping and layout of rock wall. Located existing features and prepared constructability drawings for a wire basket rock wall along Bear Creek at the park headquarters. Set grade stakes for the construction of the wall. Wawona Road Tunnel Preservation at Yosemite National Park Role: Surveyor Client: T.L. Peterson Construction Location: Mariposa County, CA Responsible for tunnel construction exhibits to include cross- sections and drainage details. Data acquisition included topographic surveying and roadway deflections. Provided construction staking following field engineering determinations. Electric Greenway Design and Environmental Services Role: Surveyor Client: City of Citrus Heights Location: Citrus Heights, CA Performed all surveys and base mapping required for the engineering, detailed design, conform requirements to existing topography, and infrastructure design of the three-mile trail project. Surveying and mapping included establishing a datum; setting vertical and horizontal control; drone based aerial photography and LiDAR mapping; detailed topographic and boundary surveys, and right of way determination. The mapping product was a digital base map with surface, digital rectified orthophotograph, and boundary lines. Project control and mapping met the Caltrans Orders of Survey Accuracy at a mapping scale of 1” = 20’ and a one-foot contour interval. Aerial photography and mapping were accomplished with the use of a drone. Information gathered was used to map the route of the proposed trail and provide a scaled photograph as an overlay. Recorded map and deed data was compiled, and sufficient monuments were located to create a land net base map. Land Park Water Meter Retrofit Survey Role: Surveyor Client: City of Sacramento Location: Sacramento, CA Prepared project control and the topographic survey. Performed the topographic surveying of 72,000 lineal feet of residential streets to support the City's design of a water meter retrofit project. Survey limits included all natural and man-made features to a line five feet beyond the back of the sidewalks on both sides of every street. Trinity Knolls Water System Improvements Role: Surveyor Client: Water Works Engineers Location: Trinity Center, CA Performed the field and office work to complete the design- level topographic survey and mapping of the existing storage tanks site, set and survey project control sufficient for ground surveys and design level mapping along existing/proposed water pipeline, set semi-permanent survey control points suitable for future construction, well inspection and design, locate all of the existing improvements within the mapping limits, and prepare a topographic base mapping at a scale of 1”=20’ with one-foot contours. The project included the boundary of the reservoir parcel and access road from Placer Drive. Water Treatment Plant and Storage Tank Topographic Survey for Design Role: Surveyor Client: Lewiston Valley Water Company Location: Lewiston, CA Topographic surveying and right of way engineering for Lewiston Valley Water Company and involved in the preparation of boundary and topographic surveys, prepared legal descriptions and exhibits for easements, and right of way field checking for topographic mapping. Shasta Lake Wastewater Treatment Plant Improvements Projects Role: Surveyor Client: City of Shasta Lake Location: Shasta Lake, CA Provided the topographic surveying of entire wastewater treatment facility to assist with the design of expansion facilities and numerous upgrades. Survey included determining the hydraulic profile of the plant system. Page 757 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 81 Complete Street/Multimodal Lowden Park Trail Right of Way and Surveying Role: Survey Technician Client: Trinity County Location: Trinity County, CA Assisted with the right of way engineering services and boundary surveys for the stand-alone bicycle and pedestrian trail in and adjacent to the park. The right of way engineering included boundary surveying, preparation of legal descriptions and plats, monumentation, and filing a Record of Survey. 2012 El Dorado Trail Project, Segments 1 & 2 Role: Survey Technician Client: City of Placerville Location: Placerville, CA Assisted with the topographic survey of proposed bicycle and pedestrian trail route along an old railroad grade. Resolved and mapped the right of way to avoid the need to acquire additional real property rights. Other Projects –Survey Technician | Coyote Creek Trail (Phelan to Tully) Design and Construction | City of San Jose | San Jose, CA –Survey Technician | Modoc Trail | T. L. Peterson | Modoc County, CA –Survey Technician | Buenaventura Ten Bridges Trail Bridge Replacement | City of Redding | Redding, CA Roadway E. Ninth Street Public Infrastructure Replacement Role: Survey Technician Client: City of Lincoln Location: Lincoln, CA Prepared the topographic and right of way survey base for the design and PS&E of complete streets that include water/sewer improvements, street improvements, and sidewalks. Assisted with the boundary resolution, drafting/mapping, topographic and right of way surveys, project control, utility investigation and evaluation, utility mapping, and utility coordination. Lance Gulch Road Right of Way Engineering & Construction Staking Role: Survey Technician Client: City of Weaverville Location: Weaverville/Trinity County, CA Assisted with the right of way engineering for the acquisition of property for the project. Services included boundary surveying, preparation of legal descriptions and plats, monumentation, and filing a Record of Survey. Subsequently awarded the contract to provide construction staking services for the County and completed Phases 1 and 2 for a new road alignment to join SR 3 and SR 299 (1.5 miles). Jacqueline Bohannon is a lead survey technician and drafter. She has over 20 years of experience in legal descriptions, topographic mapping, monumentation, records of survey, right of way exhibits, public utility and temporary construction easements, and calculation of the points for construction staking for civil engineering, surveying, and engineering design on roadway, interchanges, roundabouts, residential, and commercial/office facilities projects for public agencies and private projects throughout Northern California. At the start of each project, she performs the project deed research, confirms property boundaries, prepares the necessary calculations, performs all field preparation duties, and confirms all aspects of the work to be provided. Relevance to the project Qualifications/Accreditations – AS, Mechanical Drafting, Pueblo Community College, Pueblo, CO 1991 – Surveying Certificate, Pueblo Community College, Pueblo, CO Experience 20 years Location Redding, CA Jackie Bohannon Survey Support Page 758 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 82 Jackie Bohannon | Survey Support Avenue 54 Widening Project Role: Survey Technician Client: AEC, Incorporated Location: Riverside County, CA Assisted with the topographic and right of way surveying for new median and widening of Avenue 54 bordering and accessing the Augustine Indian Reservation in Riverside County. Beckwith and Westside Road Reconstruction Role: Survey Technician Client: AEC, Incorporated Location: Sierra County, CA Assisted with the topographic survey, right of way resolution, and construction staking for two miles of this six-mile- long county road. Determined the locations of deeded and prescriptive rights of way. Bethel Church Collyer Drive Campus Role: Survey Technician Client: Bethel Church Location: Redding, CA Assisted the preparation and processing of the easement support, line plat and legal, and the easement plat and legal. Cascade Boulevard Realignment at Pine Grove Avenue Role: Survey Technician Client: City of Shasta Lake Location: Shasta Lake, CA Assisted with the topographic survey and right of way engineering services for a new roadway alignment that included designated bike paths in the road. O'Byrnes Ferry Road/Duchess Drive Left Turn-Lane Modification Role: Survey Technician Client: Calaveras County Location: Calaveras County, CA Conducted the topographic and boundary surveys for an intersection improvement project. Established project control using GPS, resolved right of way location, and prepared a legal description and plat for acquisition of additional right of way. South Street and Deschutes Road Paving Role: Survey Technician Client: City of Anderson Location: Anderson, CA Provided topographic survey and right of way engineering services. The project provided for improved intermodal transportation along a two-mile corridor. Interchange I-5/Balls Ferry Road State Transportation Improvement Program Role: Survey Technician Client: City of Anderson Location: Anderson, CA Assisted with the Caltrans oversight, right of way surveys and control, as-built surveys, construction staking, research of road records, field topographic survey, and prepared Topographic Map for this multi-task project providing consultant services from project inception to construction management. SR 132/Bird Road Interchange Construction Support Role: Survey Technician Client: San Joaquin County Location: San Joaquin County, CA Performed topographic mapping. Pertinent property lines, rights of way, and easements were resolved and incorporated into the base mapping along with the topographic mapping. In support of right of way acquisition and utility relocations, an appraisal map was prepared delineating existing properties and easements and proposed acquisitions in a Caltrans approved format. Prepared all the legal descriptions and plats for the proposed acquisitions and quit claims for existing easements of relocated facilities. SR 99/Cartmill Avenue Interchange PSR and PA/ED Role: Survey Technician Client: City of Tulare Location: Tulare, CA Performed the preparation of the base mapping and right of way acquisitions. Topographic mapping was prepared by integrating ground surveys into the aerial base mapping, resolved existing rights of way, and property lines/easements. Base mapping was prepared by integrating the topographic mapping with resolved property data. Prepared legal descriptions and plats for proposed right of way acquisitions, utility easements, other easements, and quit claims of existing easements of relocated utilities. Prepared appraisal maps and recorded right of way maps and a Record of Survey. SR 99/C Street/Central Galt Interchange Survey Services Role: Survey Technician Client: City of Galt Location: Galt, CA Boundary resolution and right of way engineering. Set centerline and right of way monuments, provided a right of way record map to Caltrans and prepared a Record of Survey. Performed as-built surveys, field topographic survey, research of road records, Caltrans oversight, topographic mapping preparation, right of way surveys and control, legal descriptions, right of way map, monumentation, and construction staking. Page 759 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 83 City of Willits Rail to Trail Aerial Survey Role: UAV Pilot, GIS Technician Client: City of Willits Location: Willits, CA Responsible for capturing video and still imagery along the rail corridor in the City of Willits. Data was used to evaluate the existing conditions of the rail and to help identify areas of concern. High resolution 3D models of main culverts and bridge crossing were generated to assist in the evaluation and design of the trail within the project area. Bradshaw Terminal Renewable by Rail Role: UAV Pilot, GIS Technician Client: Bradshaw Location: Sacramento, CA Responsible for creating and executing a UAV mission to capture high resolution aerial imagery of the rail terminal. Data was processed in Pix4D photogrammetric software where high resolution orthorectified georeferenced aerial mosaic and a 3D Digital Elevation Model (DEM) were created for the project site. Bakers Medowfoam Mapping Role: UAV Pilot, GIS Technician Client: Caltrans Location: Willits, CA Responsible for mapping the extent of Bakers Medowfoam within mitigation areas for the Caltrans Willits Bypass project. Tasked with flying 2,000 acres and mapping the extent and change of Bakers Medowfoam in a five-year period. Red, Green, and Blue (RGB) and multi-spectral sensors were used to acquire high-resolution aerial imagery of the project area. The imagery was then processed in Pix4D Photogrammetric software to create an ortho-mosaic. ArcGIS was then used to analyze the ortho-mosaic datasets to map out the extent of the Bakers Medowfoam. A combination of heads up digitizing and image classification tools using ArcMap is being used to map and calculate density within the Willits Valley. Gravel Bar Extraction Surveys & Monitoring Role: UAV Pilot, GIS Technician Client: Randall Sand and Gravey Location: Garberville, CA Responsible for mapping pre and post extraction conditions in the Mad River. A UAV was used to acquire high-resolution aerial images of the project and extraction areas. Ortho-mosaics and Digital Elevation Models (DEM’s) were generated from the aerial imagery in Pix4D. The DEM was imported into Virtual Surveyor where vegetation was removed, and a high-resolution Triangular Irregular Networks (TIN) was generated for export into AutoCAD. AutoCAD was used to grade a designed extraction surface and an estimated volume was calculated. After gravel extraction post extraction conditions were recorded using the UAV, as well as on the ground surveying. This data was once again brought into AutoCAD where a final volume was calculated by comparing the pre and post extraction surfaces. Traditionally this type of monitoring and calculation was accomplished with the use of traditional survey methods. The UAV decreased the amount of field effort necessary and resulted in a higher resolution dataset than traditional methods. Harrison Hummel has 11 years of experience following industry standards and best practices for collecting, managing, and analysis of GIS spatial data. He can create meaningful and accurate maps and reports that enable clients to visually interpret complex spatial questions for a wide variety of different projects. As a Part 107 UAV Pilot, he carries a primary focus on producing survey grade deliverables and botanical mapping products that can aid in mitigation planning and monitoring. Harrison strives to provide simple solutions for complex problems by utilizing advanced geospatial technologies. Relevance to the project Memberships – Humboldt County Unmanned Aircraft Systems Advisory Committee; Esri GIS Users, North Coast GIS Users Group Qualifications/Accreditations – GIS Certificate Program, Humboldt State University, Arcata, CA; Course, Part 107 Pilot Experience 11 years Location Eureka, California Harrison Hummel, Part 107 UAV Pilot Aerial Drone Survey Page 760 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 84 Harrison Hummel, Part 107 UAV Pilot | Aerial Drone Survey City of Blue Lake Asset Management System Role: UAV Pilot, GIS Technician Client: City of Blue Lake Location: Blue Lake, CA The City of Blue Lake lacks the financial assets and technical expertise to adopt and implement a turn-key asset management system. The customized asset management system was developed with ArcGIS, Google Earth, and free Android and iOS smartphone applications. The smartphone- based apps allow non-technical maintenance staff to collect spatially rich data about infrastructure while preforming installation and maintenance of critical municipal assets. Once the data is collected, it is then uploaded to a centralized server where it is processed using various ArcGIS models to create geo-databases, which are then imported into Google Earth as an easy-to-use low-cost GIS. This system was designed to cheaply and effectively give maintenance and city staff access to both historical and current infrastructure within the City of Blue Lake without having to make the financial investment of both software and hardware technologies. Spartina Image Classification Role: UAV Pilot, GIS Technician Client: Caltrans Location: Eureka, CA Responsible for developing a flight plan that would efficiently and safely map Indian Island in Humboldt Bay. Both high- resolution RGB imagery and Multispectral Imagery was collected during the UAV mission over Indian Island. The imagery was processed in Pix4D where ortho-mosaics and digital elevation models were generated. The aerial imagery was analyzed in ArcGIS using the Image Classification tools with a combination of isolating potential habitats based on elevation profiles on the ground. Eelgrass Image Analysis Role: UAV Pilot, GIS Technician Client: Coast Sea Foods Location: Humboldt Bay, CA Responsible for developing a UAV as a remote sensing platform to take high-resolution aerial images of the extent and distribution of sensitive Eelgrass Habitat in Humboldt Bay. These photos are critical to show the distribution of Eelgrass in relation to existing and proposed Oyster Farming operating in Humboldt Bay. A combination of heads up digitizing and image classification using ArcGIS is being used to map and calculate Eelgrass density in the Bay. Watershed Delineation Role: GIS Technician Client: Dark Gluch Location: Mendocino County, CA Responsible for taking field survey and aerial surveys to create a geodatabase of all the sensitive plant communities in the harbor area. This information was used by the construction crew to ensure that the habitat was not disturbed or destroyed. A geodatabase and map were produced from the data. Sensitive Habitat Communities Delineation Role: GIS Technician Client: Noyo Harbor Location: Mendocino County, CA Responsible for taking field survey and aerial surveys to create a geodatabase of all the sensitive plant communities in the harbor area. This information was used by the construction crew to ensure that the habitat was not disturbed or destroyed. A geodatabase and map were produced from the data. Geotechnical Evaluation of Landslide Role: GIS Technician Client: PG&E Location: Trinity County, CA Responsible for surface analysis from a LIDAR data set in which the total volume of earth was determined from a specific mass wasting event. A detailed hill shade was produced from the raw LIDAR data. Page 761 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 85 Ukiah Downtown Streetscape Project Role: Electrical Engineer Client: City of Ukiah Location: Ukiah, CA Designed electrical distribution and street lighting for project to improve a one-third-mile long section of roadway through the center of town. Scope included photometric analysis, selection of luminaires, and circuiting of pole-mounted receptacles for seasonal decorations. Coordinated with City’s electrical utility to select suitable service points for each block so that service disconnection points were very close to any poles that required maintenance. Redding Downtown Streets Circulation Project Role: Electrical Engineer Client: City of Redding Location: Redding, CA Designed electrical distribution for a downtown streetscape project. The project includes low-voltage tree well lighting integrated with the tree well gratings, tree well receptacles, receptacle pedestals, overhead catenary lighting, and monument sign lighting. Electrical service points were coordinated with the City’s electrical utility department. Finnie Flat Road Sidewalks and Landscaping Role: Electrical Engineer Client: Arizona Department of Transportation Location: Camp Verde, AZ Designed electrical distribution and street lighting for project to improve a half-mile-long section of roadway through the center of town. Scope included coordination of new electrical service from the utility, photometric analysis, selection of luminaires, and circuiting of pole-mounted receptacles for seasonal decorations. Pedestrian Mall Role: Electrical Engineer Client: US Naval Facilities Engineering Command Southwest Location: Naval Construction Battalion Center - Port Hueneme, CA Designed electrical distribution for outdoor plaza area incorporating street lighting, traffic signals, general area lighting, tree up-lighting, electrical receptacles for vendor use and pump vault for a central water feature. Richard (Rick) Guggiana is a licensed electrical engineer with over 30 years of experience in the electrical, controls, and instrumentation fields, for federal, military, municipal, and private industrial clients. He has extensive experience with water treatment, storage, and pumping systems, wastewater collection and treatment systems, pumping controls, Supervisory Control and Data Acquisition (SCADA) systems, low and medium-voltage power generation, microgrids, and waterfront electrical distribution. Rick has led large-scale coordination and arc flash studies, desk-top radio path modeling, photometric analyses, forensic studies, feasibility studies, condition assessments, construction cost estimates, and engineering services during construction. He has also written design-build Requests for Proposal (RFP’s) and has served as the client’s representative, as well has served as the lead electrical engineer on contractor-led design-build teams. Relevance to the project Membership – Institute of Electrical and Electronics Engineers Qualifications/Accreditations – BS, Electrical Engineering Technology, California State Polytechnic University, Pomona, CA, 1983 – Electrical Engineer, CA #15580, AZ, #34069, CO #34471, IL #062-053426, TX #86009, WA #36259 Experience 30 years Location Santa Rosa, California Rick Guggiana, EE, LEED AP Electrical Lead – Leadership in Energy and Environmental Design (LEED) Accredited Professional (AP), US Green Building Council – Construction Documents Technologist (CSI) Page 762 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 86 Rick Guggiana, EE, LEED AP | Electrical Lead Cloverdale Plaza Role: Electrical Engineer Client: City of Cloverdale Location: Cloverdale, CA Designed electrical distribution for plaza in the downtown redevelopment area. Site includes general area lighting, stage lighting, and electrical receptacles for vendor and entertainer use. Cloverdale Boulevard Redesign Role: Electrical Engineer Client: City of Cloverdale Location: Cloverdale, CA Coordinated electrical utility relocation for street reconstruction project. Designed street lighting, and electrical distribution for tree festoon lighting and receptacles for sidewalk vendor use. Coordinated relocation of electrical utility, telephone, and cable TV structures. San Leandro Downtown Role: Electrical Engineer Client: City of San Leandro Location: San Leandro, CA Designed electrical distribution for lighting and lighting pole- mounted receptacles for streets and parking lots to replace existing lighting within Downtown area. Coordinated upgrade of existing utility services to provide additional electrical system ampacity. Mission Creek Park P1 Role: Electrical Engineer Client: Catellus Development Corporation Location: San Francisco, CA Designed electrical distribution and lighting control for walkway, plaza, and landscape lighting for a park in the Mission Bay development. Coordinated work with multiple architects, engineers, and public agencies. Pacific Avenue Streetscape Role: Electrical Engineer Client: City of Santa Cruz Location: Santa Cruz, CA Designed underground distribution for tree lighting and street vendor electrical receptacles on side streets of post- earthquake redevelopment area in Downtown Santa Cruz. Prince Memorial Greenway Role: Electrical Engineer Client: City of Santa Rosa Public Works Location: Santa Rosa, CA Designed electrical distribution for lighting, receptacles and fountains for public space along both banks of a half-mile-long restored section of creek in Downtown Santa Rosa. Construct Parking Apron Lighting, Creech AFB Role: Electrical Engineer Client: Nellis Air Force Base Location: Indian Springs, NV Electrical engineer for expansion of airfield apron lighting system to provide security for aircraft parked on the tarmac. Evaluated LED and HID sources for construction cost and energy efficiency payback. Worked with the client to refine the lighting performance criteria, and modelled various layout options to demonstrate and compare system performance. Specified directional drilling of conduit to avoid digging through active operations areas and to minimize loose material on the aprons. Repair Ramp Lighting 300/400/500/600 Areas Role: Electrical Engineer Client: US Air Force Location: Travis AFB, CA Designed new maintenance and security lighting on new and existing poles in front of hangars, along taxiways, and around the fuel farm. Located poles to ensure proper clearance from C-5 taxiways and parking areas, and airspace surfaces. Designed controls to integrate into existing airfield lighting controls, including remote shutdown capability from the control tower. Designed a radio link to control lights in remote airfield areas. Sports Field Lighting Role: Electrical Engineer Client: El Molino High School Location: Forestville, CA Designed electrical distribution and lighting control for football field and soccer/ baseball field lighting. Designed additional security lighting for sports field perimeter. Coordinated work with structural engineer and Musco Lighting. Managed approval process with California Division of the State Architect (DSA). Page 763 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 87 Seminary Pump Station-Level Control Repair Role: Electrical Designer Client: Marin County Flood Control and Water Conservation District Location: Mill Valley, CA Served as Electrical Designer for the design of upgraded pump controls for a stormwater pumping system. Design included replacing and relocating backup level control floats, providing new ultrasonic transducer and Hydroranger 200, and overall modification of the pumping control scheme to avoid nuisance alarms and lockout of pumps. The function of remaining floats was redesigned to be used as a backup system. Developed site plan, wet well details, and modified existing control diagram to incorporate changes. New Domestic Water System and Well Improvements Role: Electrical Designer Client: San Pablo Bay National Wildlife Refuge Location: Sears Point, CA Served as Electrical Designer for the design of a new domestic water system and well improvements. Design included providing power to new well pump, general power to a new building that housed new filter system, addition of new panel, feeder sizing, breaker sizes and grounding requirements to meet local and state electrical codes. Drafted Auto CAD drawings of electrical plans and panel schedule. Chillers and Climate Control Upgrade Role: Electrical Designer Client: County of Sonoma Location: Santa Rosa, CA Served as Electrical designer for project to replace administration building boilers, chillers, and climate controls. Climate control upgrade consisted of replacing a Siemens energy management system with multiple Siemens S7-1500 PLC’s and remote Input/Output (I/O). Decoded existing Powers Process Control Language (PPCL) programming language to develop the control logic to be programmed into the PLC’s for control of the chiller and boiler systems. Peartree Site Lighting Role: Electrical Designer Client: Sares Regis Management Location: Sunnyvale, CA Served as Electrical Designer for the design of lighting for new outdoor signage at the Peartree Apartments. Design included site investigation, providing power to new lights, updating analog switching timers with digital astronomic timeclock control. Drafted design drawings using AutoCAD, which included site plans and a lighting fixture schedule. Old Orchard Site and Pathway Lighting Role: Electrical Designer Client: Sares Regis Management Location: Sunnyvale, CA Served as Electrical Designer for the design of lighting for new pathway and area lighting at the Old Orchard Apartments. Design included site planning, providing power to new lights, replacing existing lighting in-place, and updating analog switching timers with digital astronomic timeclock controls. Provided lighting modeling and analysis using AGI32 software, and drafted design drawings using AutoCAD, including site plans and schedules. Erick Osorno is an electrical engineer with experience in electrical system design, lighting design and photometric analysis, motor controls, pump controls, C programming and assembly programming. Erick is an excellent communicator with good team management skills. His background includes clients, from commercial to industrial to government. Relevance to the project Qualifications/Accreditations – BS, Electrical Engineering, California State University, Fresno, CA 2019 – * EE License number is pending Experience 11 years Location Santa Rosa, California Erick Osorno, EE* Electrical Support Page 764 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 88 Trails / Pedestrian Hanson Russian River Access and Trail Project Role: Project Manager / Landscape Architect Client: Sonoma County Regional Parks Location: Healdsburg, CA Programming and conceptual design for a boat access, campground, and trail project. Concept planning and design for the development of new regional park that will allow for various camping locations, loading and unloading drop-off, river portage access, a multi-use trail network, parking, and restroom facilities all surrounding a vast created riparian floodplain development along the Russian river. Fort Ord Recreational Trail and Greenway (FORTAG) – Segment 1 Role: Landscape Architect Client: Transportation Agency for Monterey County Location: Monterey County, CA The FORTAG project includes PS&E development of the 1.75-mile-long first segment of an approximately 28-mile-long regional multi-use trail system. Project includes landscape architectural services for trail alignment, entry nodes and rest areas, wayfinding, amenities, planting, and irrigation. Belmont Road Parkway Role: Landscape Architect Client: City of Exeter Location: Exeter, CA Assisted with the preparation of the landscape design for approximately 55,000 square feet of parkway along the west side of Belmont Road. The parkway also serves as a buffer between existing residential areas to the east and a future development area to the west. The parkway design includes a winding sidewalk through a naturalized planting area. Proposed plant materials were selected to provide year-round interest, relatively low maintenance needs, and low water use. Park / Plazas / Public Spaces Mendocino Unified School District Recycled Water Project Role: Landscape Architect Client: Mendocino Unified School District Location: Mendocino, CA Provided full construction documentation for the design of a recycled water irrigation plan for a public baseball field. Design took into account state and local requirements regarding recycled water use and irrigation system needs to ensure full head-to-head coverage of the playable turf areas. Lucas Piper is a registered landscape architect with over 14 years of private development, roadway / intersection related design, and habitat restoration experience. He is a certified Qualified SWPPP Developer/Practitioner (QSD/P) and has worked on a number of stormwater pollution management, stabilization, and Low-Impact Development (LID) projects. Lucas supports and provides landscape architectural services for a multitude of GHD consulting projects by providing an array of services including site analysis; site planning; geospatial analysis; conceptual design development; 3D renderings; construction document Plans, Specifications, and Estimates (PS&E); and SWPPP’s. Relevance to the project Qualifications/Accreditations – BS, Landscape Architecture, University of Oregon, Eugene, OR 2006 – Landscape Architect, CA #5873 Qualified Stormwater Pollution Prevention Plan (SWPPP) Developer/Practitioner, CA #25768 Experience 14 years Location Roseville, California Lucas Piper, LLA, QSD/QSP Landscape Irrigation Page 765 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 89 Lucas Piper, LLA, QSD/QSP | Landscape Irrigation Lower Peter’s Canyon Rest Area Role: Landscape Architect Client: Orange County Parks Location: Tustin, CA Provided landscape design and full construction documents for landscape related project elements for a trail head location at Lower Peter’s Canyon. Site elements included a restroom, shade structure, benches, kiosk, decorative paving, and planting. Construction detailing was provided for all site furnishing, fencing, and paving. The planting design utilized California natives and a temporary irrigation system. Perez Park Landscape Design Role: Landscape Architect Client: Orange County Public Works Location: Costa Mesa, CA Provided landscape design support and quality control / review for the development of a green infrastructure community park. The design integrated water quality treatment and storage into a small pocket park that also provided community park resources such as play equipment, seating walls, tables, shade structures, entry monuments, specialty paving, fencing, walls, and landscape planting and irrigation. Additional work included construction observation and amendments. Beach Boulevard Infrastructure Replacement Project Role: Landscape Architect Client: City of Pacifica Location: Pacifica, CA Served as Landscape Architect for the preparation of design alternatives for the development of an ocean front promenade. Developed alternatives for treatment of the public space between a proposed ocean protection structure (sea wall) and the existing road. Alternatives addressed parking needs, horizontal and vertical relationships, paving and landscape, accessibility and circulation, and site amenities. Alternative were used for multiple virtual public workshops to develop community consensus on a preferred alternative. Five Creek Neighborhood Park Role: Landscape Architect Client: USA Properties Fund, Inc. Location: Rohnert Park, CA Assisted with the preparation of landscape architecture PS&E documents for a neighborhood park in Rohnert Park, California. Park elements included the shrub and tree landscape planters, turf areas, bocce ball courts, a tot lot, barbeque area, and skateboard park elements. The park utilized reclaimed water and featured pervious pavers and low water plants. Ripon Downtown Circulation Study Streetscape Improvements Role: Landscape Architect Client: City of Ripon Location: Ripon, CA Responsible for preparing draft design guidelines for streetscape improvements. The design guideline document included recommendations and visualizations for converting the existing vehicle-centric street and intersections of downtown Ripon to a pedestrian friendly streetscape. Proposed design recommendations included narrowing of street corridors, intersection bulb- outs and crosswalk enhancements, sidewalk widening for pedestrian gathering and circulation, paving enhancements, sign monuments, bike routing, and street / sidewalk amenities. El Dorado Hills Apartments Park Role: Landscape Architect Client: The Spanos Companies Location: El Dorado Hills, CA As a part of an apartment entitlement condition of approval GHD prepare the PS&E for a small park. The design intent provides for passive and semi-active use for a mixed-use development Town Center. A walking trail, seating areas, native landscape and lawn areas provide opportunity for relaxing and enjoyment. Professional Skills –Site Analysis, Opportunity/Constraint Analysis, and Land Planning –PS&E Documents –Bank Stabilization, Stormwater Detention and Treatment, LID and Bioremediation Techniques, and Erosion/Sediment Control BMP’s –Grading and Drainage Analysis and Design –Irrigation System Design and Water Ordinance Compliance –Habitat Site Assessment, Evaluation, and Post-Construction Maintenance and Monitoring Page 766 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 90 Ukiah Northwestern Pacific Rail Trail Phases 2 &3 Role: Project Planner Client: City of Ukiah Location: Ukiah, CA Ms. Cahill served as the permitting lead for both Phase 2 and Phase 3 of the Ukiah Northwestern Pacific Rail Trail Project. The Project involved the constriuction of a multi-use pathway that would travel the length of the City of Ukiah, paralleling the northwestern pacific rail trail. The Project included the installation of two bridge crossings, one over Doolin and one over Orrs Creek. Permitting applications required a Section 401 Water Quality Certification, and several Section 1602 Streambed Alteration Agreements. She also is managing the monitoring of the mitigation plantings required by the agencies.] Ukiah Gibson Creek Box Culvert Maintenance Role: Project Planner Client: City of Ukiah Location: Ukiah, CA Ms. Cahill served as the Project Manager and client contact for the Gibson Creek Box Culvert Maintenance Project. The Project is seeking to maintain the existing Gibson Creek box culvert by removing sediment that has been deposited in the culvert and immediately upstream and downstream to improve capacity. The Project included a brief memorandum to identiy biological constraints, as well as contacting the relevant regulatory agencies to inquire on their opinion of the project prior to submitting permitting applications. Ukiah High School Athletic Field Improvement Role: Project Planner Client: Ukiah Unified School District Location: Ukiah, CA Ms. Cahill served as Project Planner for the Ukiah High School Athletic Field Improvement Project. The project would improve the recreational value of the north athletic fields at UHS for both students and the community. The project would also replace existing, aging inefficient lighting at the existing track and field stadium with newer, focused and energy efficient LED light arrays. Ms. Cahill was responsible for completing various section of the CEQA IS/MND. MLK Regional Shoreline Bay Trail Gap (Doolittle Drive South) and Improvements Role: CEQA Project Planner Client: East Bay Regional Park District Location: Oakland, CA Ms. Cahill served as Project Planner for the MLK Shoreline Bay Trail Gap and Improvements Project. The Project would improve the existing shoreline, including construction of a segment of Bay Trail and, removal and replacement of a boat launch, and parking lot improvements. Ms. Cahill assisted in drafting the Mitigated Negative Declaration, as well as permitting for the Project. Coyote Creek Trail from Phelan Avenue to Tully Road Role: Project Planner Client: City of San Jose Location: San Jose, CA Haley Cahill has five years of environmental planning experience, focusing on preparing documents in compliance with the California Environmental Quality Act (CEQA), National Environmental Policy Act (NEPA), as well as preparing permits for various regulatory agencies including: the Bay Conservation and Development Commission (BCDC), California Department of Fish and Wildlife (CDFW), the Regional Water Quality Control Board (RWQCB), and the US Army Corps of Engineers (USACE). Haley has prepared environmental documentation and technical analysis on various project types including infrastructure, parks and trails, and residential developments. Relevance to the project Memberships – Association of Environmental Professionals, San Francisco Bay Chapter, Membership Director, 2018 - 2019, President (2019 - Present) Qualifications/Accreditations – BA, Environmental Studies, University of San Diego, San Diego, CA 2016 Experience 5 years Location San Francisco, California Haley Cahill Environmental Permitting Lead Page 767 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 91 Haley Cahill | Environmental Permitting Lead Ms. Cahill served as the Project Planner responsible for the Coytote Creek Trail from Phelan Avenue to Tully Road Project. The Project would construct a portion of the Coyote Creek Trail to allow for further mobility in the City. Ms. Cahill assisted in the preparation of a Section 401 Water Quality Certification, Section 1602 Streambed Alteration Agreements, as well as an application for coverage under the Santa Clara Valley Habitat Plan and the USACE Regional General Permit 18. Electric Greenway Bike Trail Project Role: Project Planner Client: City of Citrus Heights Location: Citrus Heights, CA Ms.Cahill assisted in the preparation of an Initial Study/ Mitigated Negative Declatation for the Electric Greenway Bike Trail Project. The Project would install a 3-mile multi- use trail that will allow bicycle and pedestrian linkage in both Citrus Heights and unincorporated Orangevale. Issues of note included hydrology and biological impacts. Windsor Intersection Improvements Project Role: NEPA Project Planner Client: Town of Windsor Location: Windsor, CA Ms. Cahill assisted with the NEPA review of this federally funded intersection improvement project. The project includes either the installation of a new signalized intersection or the installation of traffic circle. Approximately 800 feet of pedestrian trail within the SMART right-of-way is also proposed. Ms. Cahill drafted the Preliminary Environmental Study and project-specific technical studies. Grant Avenue Bridge Rehabilitation Role: Project Planner Client: City of Novato Location: Novato, CA Ms. Cahill served as Project Planner responsible for preparing the required permits for this bridge rehabilitation project. The project includes rehabilitating and widening an existing vehicle and pedestrian bridge, as well as stabilizing the banks and channel on the upstream portion of Novato Creek. The project includes grant authorization from the Caltrans Highway Bridge Replacement and Rehabilitation program for partial federal funding. Permitting applications include a Section 404 Nationwide Permit, 401 Water Quality Certification, and Section 1602 Streambed Alteration Agreement. Lucas Valley Road Mile Post 5.08 Curve Realignment Role: Project Planner Client: Marin County Department of Public Works Location: Marin County, CA Ms. Cahill served as Project Planner for the Lucas Valley Road Realignment Project. The project is federally funded by the Highway Safety Improvement Program with federal-aid funds administered by Caltrans District 4 Local Assistance. Ms. Cahill supported the NEPA technical studies and prepared the Joint Aquatic Resources Permit Application to acquire permits from the US Army Corps of Engineers, Regional Water Quality Control Board, and California Department of Fish and Wildife. Hill Road Bridge Project Role: Project Manager Client: Caltrans Location: Mendocino County, CA Ms. Cahill is serving as the Project Manager for the Hill Road Bridge Project. The project includes grant authorization from the Caltrans Highway Bridge Replacement and Rehabilitation program for partial federal funding. Ms. Cahill is responsible for managing and preparing the NEPA review, CEQA IS/MND, and the permitting applications, which include a Section 404 Nationwide Permit, 401 Water Quality Certification, and Section 1602 Streambed Alteration Agreement. Fryer Creek Pedestrian and Bicycle Bridge Project Role: Project Planner Client: City of Sonoma, CA Location: Sonoma, CA Ms. Cahill served as the Project Planner for the Fryer Creek Pedestrian and Bicycle Bridge Project. The project would install a new pedestrian bridge across Fryer Creek as well as circulation and accessibility improvements. Ms. Cahill is responsible for preparing several of the NEPA technical studies and the permitting applications, which include a 401 Water Quality Certification and a Section 1602 Streambed Alteration Agreement. Fulton Road Widening Improvement Project Role: CEQA Project Planner Client: City of Santa Rosa Location: Santa Rosa, CA Ms. Cahill served as the Project Planner for the permitting phase of the project. The project includes roadway widening, new vehicle travel lanes, bicycle lanes, sidewalks, bioretention areas, bus stops, landscaping, utility relocations, stormwater facilities, and property acquisitions and easements. The Project would result in fill in Forestview Creek, Peterson Creek, several roadside wetland and non-weltand ditches, and a seasonal wetland. Ms. Cahill is assisting in the permitting services for the project, which will include obtainment of a Section 404 Nationwide Permit; 401 Water Quality Certification; and Section 2081 Incidental Take Permit. Eureka Bay to Zoo Trail Project Role: Project Planner Client: City of Eureka Location: Eureka, CA Ms. Cahill served as Project Planner for the Bay to Zoo Trail Project in the City of Eureka. The trail would connect the shores of Humboldt Bay to Sequoia Park Zoo via an alignment parallel to Second Slough/McFarlan Creek and residential city streets – nearly three miles inland. Ms. Cahill assisted in preparing the CEQA IS/MND and the Response to Comments document prepared in support of the Final IS/MND. Page 768 of 800 Bay to Zoo Trail Role: Botanist/Permitting Support Client: City of Eureka Location: Eureka, CA Kelsey conducted floristic surveys for special status plants, mapped vegetation communities, delineated estuarine and palustrine wetlands and other waters, documented invasive plants along the proposed public trail system, and recommended mitigation measures related to impacted rare salt marsh plant populations and management of invasive plants including dense flowered cordgrass. Highway 101 Safety Corridor Living Shoreline Role: Botanist/ Permitting Support Client: City of Eureka Location: Eureka, CA Kelsey conducted reconnaissance-level surveys and identified three species of rare salt marsh plants within the project area. Forthcoming research. Rohner Creek Improvement Project Role: Botanist/ Permitting Support Client: City of Fortuna Location: Fortuna, CA Kelsey monitored percent cover of native, non-native, and invasive species at this riparian restoration site to determine progress toward meeting specific annual criteria, and inform removal of invasive plants along the riparian corridor. Nordic Aquafarms Land-based Aquaculture Role: Botanist/ Permitting Support Client: Nordic Aquafarms Location: Samoa, CA Kelsey conducted special-status plant surveys, analyzed a rare plant population onsite, assessed vegetation alliances, and mapped sensitive natural communities and invasive- dominated dune communities. She wrote a Habitat Mitigation and Monitoring Plan for translocation of rare dark eyed gilia and several acres of invasive plant removal from dune habitats on the North Spit of Humboldt Bay. Cannibal Island Restoration Project Role: Botanist/ Permitting Support Client: CalTrout Location: Loleta, CA Kelsey conducted floristic surveys for special status plants and mapped rare salt marsh plant populations at this tidal restoration site. She also delineated and mapped estuarine and agricultural wetlands, sensitive vegetation communities including native salt marsh and eelgrass, other sensitive habitats such as intertidal mudflats, and stands of invasive dense-flowered cordgrass to establish pre-project baseline conditions. Elevation data was collected by habitat type to predict vegetation changes following tidal restoration. Kelsey McDonald has 10 years of professional experience in environmental science and resource management, with a special focus on coastal restoration and plant ecology on the North Coast of California. Kelsey has experience conducting aquatic resource delineations, floristic surveys and other special status plant surveys, vegetation and sensitive habitat mapping, and restoration monitoring. Kelsey also has experience writing habitat mitigation and monitoring plans, aquatic resource delineation reports, invasive plant management plans, and other natural resource management plans. Kelsey is experienced in assessing potential impacts to rare plants, vegetation communities, and other natural resources, and writing mitigation measures. Her academic research focused on aquatic dispersal of invasive dense flowered cordgrass in Humboldt Bay, and morphological differences in dunes associated with the invasion and removal of invasive European beach grass on the North Spit of Humboldt Bay. Relevance to the project Membership – California Native Plant Society (CNPS) Certified Consulting Botanist Qualifications/Accreditations – MS, Environmental and Natural Resource Science, Humboldt State University 2014 – BA, Environmental Studies, Scripps College, 2009 Experience 10 years Location Eureka, California Kelsey McDonald Environmental Permitting Support Project Experience GHD City of Ukiah Great Redwood Trail Phase 4 92 Page 769 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 93 Martin Slough Enhancement Project Role: Ornithologist/Permitting Client: Redwood Community Action Agency Location: Eureka, CA Project involved improvements to aquatic and riparian habitat in a tidally influenced slough. Performed pre-construction nesting bird surveys in advance of planned improvements in and along the slough. Monitored, documented, mapped, and reported any sensitive nesting bird activity to the client, contractor, the California Department of Fish and Wildlife (CDFW), and the Coastal Commission (CC). Numerous protected nesting birds (including raptors) were detected during surveys. Established nest avoidance buffers for avian species in coordination with the CDFW and CC to ensure compliance with project’s 1602 LSAA permit conditions, Coastal Development Permit, the federal MBTA, and the state FGC. The local CDFW office appreciated the quality of GHD’s work and referenced the nesting bird survey data (and GHD) in a recent presentation at a national wildlife conference. Centerville Road Improvement PM 4.62 Role: Ornithologist/Permitting Client: Humboldt County Public Works Location: Centerville, CA Completed a habitat evaluation of the project area at Centerville Beach for Western Snowy Plovers based on Primary Constituent Elements outlined in designated critical habitat for the Pacific Coast population. This required monitoring, documenting, and reporting wildlife activity. Authored the project’s Western Snowy Plover memo. Monitored preliminary project investigations (including geotechnical borings and cultural resources excavations) to avoid disturbance to potential plovers in the vicinity. Provided staff with environmental awareness training for Western Snowy Plover. Co-author of the project’s Natural Environment Study and Biological Assessment submitted to Caltrans. Elizabeth Meisman is a biologist based in Eureka, California. She received her Bachelor of Science degree in Wildlife Conservation Biology and Applied Vertebrate Ecology from Humboldt State University. She has over five years of experience surveying for, banding, and monitoring avian and other wildlife species, and analyzing and compiling wildlife data for technical reports and Geographic Information System (GIS) maps. This experience involves a thorough knowledge concerning the appropriate field techniques for sampling wildlife populations and an understanding of animal behavior and its application to wildlife management plans and construction projects. She has significant experience working with wildlife species in general at research institutions, bird observatories, and on timberlands. Elizabeth recently joined GHD and has contributed to biological resource reports, technical memos, construction monitoring, and special status wildlife surveys, including aquatic, terrestrial mammals, and avian species. Relevance to the project Memberships Audubon Society, National Redwood Region Chapter; California Native Plant Society; California Waterfowl Association; California Women in Timber, North Coast Chapter Representative to State; Humboldt Bay Mycology Society; Ornithological Society of North America; Raptor Research Foundation; The Wildlife Society, International Western Section, California North Coast Chapter, Chapter Representative to Western Section; Western Section Annual Meeting Planning Committee; Women of Wildlife, Diversity Committee; Professional Development Committee, Conservation Affairs Committee; Western Field Ornithologists Qualifications/Accreditations – BS, Wildlife Conservation Biology/Applied Vertebrate Ecology, Humboldt State University, Arcata, CA 2016 Experience 5 years Location Eureka, California Elizabeth Meisman Environmental Permitting Support Project Experience Page 770 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 94 Elizabeth Meisman | Environmental Permitting Support Transmission Line Maintenance Role: Biological Monitor/Permitting Client: Western Area Power Administration (WAPA) Location: Central CA Conducted clearance surveys and construction monitoring for numerous project sites across the Central Valley including Sutter and Colusa National Wildlife Refuges. Navigated across large areas and through private landownerships. Biological surveys included pre-construction nesting bird and federally listed species surveys (including Giant Garter Snake and Valley Elderberry Longhorn Beetle), mapping of nests along transmission lines, and coordination with the federal client to establish nest and habitat protection buffers (in order to comply with the MBTA, CDFW FGC, and the client’s NEPA EA conditions). Coordinated frequently with the construction manager, contractors, WAPA, and state agencies to avoid impacts to protected species while facilitating efficient construction workflow. Facilitated environmental awareness trainings. WAPA work was completed on time and under budget, and no take of protected nesting birds or other sensitive species occurred. Bay to Zoo Trail Project Role: Author Client: City of Eureka Location: Eureka, California The Project would provide non-motorized (primarily pedestrian and bicycle) transportation and recreational access connecting the City of Eureka’s Waterfront Trail to Sequoia Park via a Class I multi-use trail and a Class III bikeway. The trail would be a Class I multi-use trail for segments located in natural areas (i.e. along the slough and through the gulch) and a Class III bikeway where it shares space with motor vehicles in the existing street rights- of-way. Two reconnaissance-level biological field surveys were conducted followed by the preparation of a Biological Resource Report to be utilized in the permitting effort. Long Beach Cruise Terminal Improvement Project Role: Co-Author Client: Carnival Corporation Location: Long Beach, California GHD provided assessments regarding the impacts of improving the existing Carnival Cruise ship berth in the Port of Long Beach (specifically pile driving and dredging) on marine mammals protected under the MMPA and federally endangered and threatened species including the California Least Tern, Green Sea Turtle, Gray Whale (Western North Pacific DPS) and Steelhead (Southern California DPS) (species assessment area of over 5 square miles). Permitting and initial studies completed by GHD included a biological assessment under Section 7 of the Endangered Species Act, an incidental harassment authorization under the Marine Mammal Protection Act, a biological resources report, a noise study, and a 404(b) (1) alternatives analysis for the USACE. GHD also provided a technical review of the project’s CEQA documentation. The documents assessed potential pile driving and dredge impacts within the Port of Long Beach on a fast-track schedule and included extensive federal agency coordination. GHD also developed and Marine Mammal and Sea Turtle Mitigation and Monitoring Plan (approved by NMFS) for the client and organized a team of trained Protected Species Observers to support construction in 2020 (construction now delayed indefinitely due to Covid-19). Page 771 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 95 Experience 32 years Location Sacramento, CA Qualifications/Accreditations Masters in Civil Engineering, Geotechnical Emphasis, San Jose State University, 1995 BS Civil Engineering, San Jose State University, 1989 Civil Engineer, CA C53710 Civil Engineer, CA C53710 Geotechnical Engineer, CA GE2492 Relevant Project Experience Northwest Pacific Rail Trail Phase 2 Role: Geotechnical Engineer Client: City of Ukiah Location: Ukiah, CA Senior Geotechnical Engineer responsible for the geotechnical investigation for nearly one mile of pedestrian trail alignment adjacent a railway, crosswalks at street intersections, and a new bridge with a span of approximately 50 to 75 feet for users to cross Doolin Creek. The project included new Hot Mix Asphalt pavement section, retaining wall, and a foundation system for a 75-foot-long prefabricated steel pedestrian bridge. The team performed geotechnical explorations and laboratory testing, engineering analysis, and prepared a design-level geotechnical investigation report. City of Ukiah Downtown Streetscape Role: Geotechnical Engineer Client: City of Ukiah Location: Ukiah, CA Chris was the Senior Geotechnical Engineer for this streetscape project, which included near 3,000 feet of streetscape, road diet, and utility improvements with local stormwater treatment. Nine borings, percolation testing, and laboratory testing were completed. Challenges included evaluating the remaining existing pavement capacity and life, since the pavement components varied with asphalt, concrete, aggregate base, and cement-treated base. Recommendations for infiltration, new flexible and rigid pavements, HMA overlay and pipe deflection parameters were included. SMART Various Non-Motorized Pathway Segments Role: Geotechnical Engineer Client: Sonoma Marin Area Rail Transit Location: Petaluma, Penngrove, and Santa Rosa, CA The project include 10 miles of new non-motorized 10-foot wide HMA-paved pathway segments, two 120-foot long prefabricated pedestrian bridges, modular block retaining walls, and 10 culvert extensions. Exploration included 19 exploratory borings; review of six previous geotechnical report was also performed. Geotechnical challenges included expansive soil and liquefiable soil, Recommendations for bridge foundations, retaining walls, earthwork, and pathway pavements were included in a geotechnical report. Chris has more than 32 years of experience with civil, geotechnical, and pavement engineering and project management services for a variety of clients throughout California and the western US. Chris also manages large and complex geotechnical projects, including pavements, transportation, public works, essential facilities, flood control, power, industrial, commercial, residential, and ports. His technical experience includes field exploration and testing, seismic analysis, liquefaction mitigation, geologic hazards, shallow and deep foundations, retaining walls, mass grading earthwork and testing, underground structures and utilities, tie backs, rock anchors, shoring, chemical treatment of soils, grouting, mitigation of expansive soils, surcharging compressible soils, rigid and flexible pavement design, slope evaluation and stabilization, and implementation of geosynthetics. Relevance to the project Chris Trumball PE, GE, D.GE Geotechnical Lead Page 772 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 96 Chris Trumball | Geotechnical Lead Windsor River Road Improvements and Multi-Use Path Connector Role: Geotechnical Engineer Client: Sonoma Marin Area Rail Transit Location: Windsor, CA Senior Geotechnical Engineer responsible for the geotechnical investigation for a new roundabout at an intersection with two perpendicular roadways and a skewed Sonoma Marin Area Rail Transit (SMART) rail crossing. Utility improvements included the replacement of 600 lf of water pipeline and 700 lf of sanitary sewer pipeline. The investigation included five borings to evaluate roadway subgrade and settlement conditions as well as potential hazardous materials. Recommendations included earthwork, new Hot Mix Asphalt sections, overlays, vehicular concrete, and curb and gutter. Payran Trail Pedestrian Pathway River Crossing Role: Geotechnical Engineer Client: Sonoma Marin Area Rail Transit Location: Petaluma, CA Senior Geotechnical Engineer responsible for leading a geotechnical investigation for 1.2 miles of pedestrian pathway adjacent an active SMART rail line. Work included a 10-foot- wide HMA-paved pathway and a 210-foot steel pedestrian bridge across the upper Petaluma River with CIDH foundations. Exploration included four borings from 10 to 40 feet deep. Geotechnical challenges included moderate to highly expansive soil, liquefaction, and foundation support. Pedestrian Pathway Role: Geotechnical Engineer Client: Sonoma Marin Area Rail Transit Location: Rohnert Park, CA Senior Geotechnical Engineer responsible for performing geotechnical investigation for 2 miles of pedestrian pathway adjacent an active SMART rail line. Project elements included a 10-foot-wide HMA-paved pathway, two pedestrian bridges, and several retaining walls. Exploration included 19 borings from 10 to 40 feet deep and several grab samples. Geotechnical challenges included highly expansive soil and potentially liquefiable soils at one bridge site. Historic Roseville Old Town Streetscape Improvements Role: Geotechnical Engineer Client: City of Roseville Location: Roseville, CA Senior Geotechnical Engineer responsible for conducting a geotechnical investigation for modification of streets and surrounding environment in Historic Roseville. Work included geotechnical design and construction criteria for new asphalt pavements, asphalt pavement overlays, retaining walls, a railway viewing platform, flatwork, and underground utilities. San Francisco Bay Trail, Doolittle Drive South Segment Role: Geotechnical Engineer Client: East Bay Regional Park District Location: Oakland, CA Senior Geotechnical Engineer responsible for leading the geotechnical team for the design of approximately 3,500 linear feet of bay trail. Approximately 2,500 linear feet will be a raised structural viaduct along the San Leandro Bay shoreline; the remaining 1,000 lineal feet will consist of the restoration/ upgrade of existing trail including a new trail crossing through the existing Martin Luther King Shoreline boat ramp parking lot. Improvements also include the replacement of the existing boat ramp. Geotechnical challenges included settlement of Bay Mud, historical fill, and deep foundations. The geotechnical investigation included over-water and land borings, laboratory testing, settlement, stability, deep foundation, and pavement analyses, and report preparation. Kelly Drive & Park Drive Road Diet & Multi-Use Trail Role: Geotechnical Engineer Client: City of Carlsbad Location: Carlsbad, CA Senior Geotechnical Engineer responsible for the geotechnical investigation for this road improvement project, which included lane reconfiguration, two roundabouts, modular block walls, a pedestrian bridge/walkway, and low impact development (LID) features of infiltration basins and bioswales. The geotechnical scope included six borings with traffic control in active roadways, percolation testing, laboratory testing, and pavement and retaining wall analyses. The geotechnical report included recommendations for earthwork, trench backfill, new Hot Mix Asphalt sections, overlays, vehicular concrete, and modular block retaining walls. Saratoga Drive Role: Geotechnical Engineer Client: City of San Mateo Location: San Mateo, CA Senior Geotechnical Engineer responsible for conducting a geotechnical investigation for a new 1-mile-long, 4-lane divided roadway. Provided geotechnical design and construction criteria for new surcharging compressible soils, subgrade stabilization, asphalt pavements, curb and gutter, sidewalk, underground utilities, and retaining wall/sound walls and monuments supported on deep foundations. Page 773 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 97 Location Rocklin, CA Experience 18 years Qualifications/Accreditations University of the Pacific B.S. Engineering Management, 2015 M.S. Geotechnical Engineering, 2015 Keiko Lewis PE Geotechnical Support Relevant Project Experience Dry Creek Greenway East Phase 1 Role: Geotechnical Engineer Client: City of Roseville Location: Roseville, CA Keiko was Senior Engineer for a Geotechnical Design Report. The project consists of two miles of new 10-ft paved multi-use trail with 2-ft shoulders, new approach embankments for three bridges, new ingress road, various gravity, cantilever, tie- back, and soil nail retaining walls, new parking lot, and a bridge widening. Crawford completed 15 borings, 32 dynamic cone penetrometers (DCP), and 26 hand augers; obtained soil samples for logging and laboratory testing; and performed geotechnical analysis. Recommendations include site preparation and grading, slope geometry/stability for embankment fills, design recommendations for the 21 retaining walls, and HMA, Rigid Pavement, and Concrete Flatwork. South Tahoe Greenway Shared Use Path - Phase 1B and 2 Role: Geotechnical Engineer Client: City of South Lake Tahoe Location: South Lake Tahoe, CA The project will cross barriers and close gaps in the bicycle network to form the major north/south connection in the City of South Lake Tahoe. The Project constructs approximately 0.95 miles of American Association of State Highway and Transportation Officials (AASHTO) compliant trail, including approximately 0.8 miles of ten feet wide asphalt concrete trail and approximately 0.2 miles of elevated boardwalk/bridge. A new shared-use bridge over Trout Creek, improved local street crossings, and interpretive/wayfinding signage are also part of the project. Crawford conducted a geotechnical investigation for the project, including drilling, sampling, and logging of test borings and performing laboratory testing on the samples. Performed geotechnical engineering analysis for design and construction of the trail segments, boardwalk elements, and foundation elements for the proposed pedestrian bridge crossing at Trout Creek. Dos Rios Light Rail Station Role: Geotechnical Engineer Client: Sacramento Regional Transit Location: Sacramento, CA The Sacramento Regional Transit District is constructing a new station platform along the south side of North 12th Street between Ahern Street and Richards Boulevard. Project components include constructing a new station platform, an Overhead Contact System (OCS) and associated signal, sidewalk, and roadway modifications; realigning the existing rail tracks; relocating of the existing switch; and modifying Ahern Street and Sproule Avenue intersections. Keiko provide project set up, drilled exploratory borings, performed lab tests, and prepared a Draft Foundation Report. The report provides geotechnical data, conclusions, and recommendations for the design and construction. Recommendations were provided for foundations, seismicity, grading, utility trenches, and pavement sections. Keiko is in charge of permitting and coordination of drillers and the development and management of Crawford’s soil testing laboratory. She has provided geotechnical laboratory results, organized and conducted field explorations, observed and logged subsurface soils for geotechnical and environmental evaluations, performed engineering analysis, and prepared geotechnical reports for bridges, water/wastewater, roadways and pavement, and transit projects. Relevance to the project Page 774 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 98 Keiko Lewis | Geotechnical Support Area 2 Stormwater to Sewer Connection Removal Role: Geotechnical Engineer Client: City of Modesto Location: Modesto, CA The City of Modesto plans to alter the Roosevelt Park basin design and update the nearby neighborhood storm drainage systems using bioretention planters and below ground infiltration chambers. Keiko visited the site to determine and mark boring locations for USA, scheduled the drilling, and obtained the required boring and encroachment permits from the City and Stanislaus County. Keiko also performed five exploratory borings to obtain soil samples for laboratory testing. Standard Penetration Testing (SPT) and California Modified sampling were performed within the borings to obtain samples and blow count information. Infiltration rate testing was also performed at 12 locations throughout the improvement areas. Grizzly Island Roadway Improvement Hill Slough Restoration Role: Geotechnical Engineer Client: California Department of Fish and Wildlife Location: Solano County, CA Keiko was in charge of project set up, including permitting and site coordination, performed drilling, lab tests, and assisted in the preparation of a foundation report. The pavement is exhibiting some distress, particularly in areas crossing old sloughs. The majority of the proposed roadway surface will be constructed on fill at about elevation 10 ft. Design issues include fluctuating ground water, site corrosivity, compressibility of the organic clayey soils under increased loading, and constructability over soft/wet marshland. Provided recommendations for light weight fill options, including geofoam, light weight aggregates, and tire derived aggregate (TDA). TDA was the top recommendation due to being significantly less expensive than other options, does not present a buoyancy concern, 1/3 the weight of conventional fill, and low environmental impact. Alderpoint Road PM 10.52 Role: Geotechnical Engineer Client: [Client Name] Location: Garberville, CA Geotechnical Investigation for roadway damage along 120 ft. of pavement caused by slope failure. Initial recommendations include a partial reconstructed/reinforced road section with relatively deep sub-drainage elements (trenched underdrain and drainage blanket). Page 775 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 99 Relevant Project Experience North Coast Great Redwood Trail Feasibility Study Role: Assistant Project Manager Client: California Department of Parks and Recreation Location: Northern California As Assistant Project Manager, Brian played an integral role in Alta’s efforts to conduct existing conditions inventories, trail governance and railbanking research, corridor segmenting, prioritization, and cost estimates for a feasibility study for the North Coast Great Redwood Trail. The 300-mile trail will run along active and abandoned railway spanning from San Francisco Bay to Humboldt Bay, passing through some of the most beautiful and rugged landscapes in the United States. Lower Russian River Trail Feasibility Study (LRRT) Role: Lead Designer Client: Sonoma County Location: Sonoma County Brian served as Lead Designer for the development of trail alignment alternatives with supporting preliminary design options for a 19.3-mile long separated paved trail along the Lower Russian River between Forestville and Highway 1. Alta is performing site analyses through environmentally sensitive areas, preparing community surveys, maps, and sketches, participating and facilitating community workshops and meetings, responding to community feedback, and preparing and presenting draft and final feasibility study report. Electric Greenway Role: Project Manager Client: City of Citrus Heights (Owner) GHD (Prime) Location: Citrus Heights, CA The Electric Greenway is a 2.9 mile multi-use trail between Sunrise Boulevard and Wachtel Way largely following an existing Sacramento Municipal Utility District (SMUD) electric corridor. The project is in the City of Citrus Heights and unincorporated Orangevale, connects several neighborhoods to seven parks, several schools and the Sunrise Marketplace. Alta led the preliminary alignment development as well as the masterplans for five parks along the alignment. Alta was also involved in the robust public engagement process. Brian served as Project Manager, leading and making significant contributions to project design and research. Ukiah Northwestern Pacific Rail Trail Role: Project Manager Client: City of Ukiah Location: Ukiah, CA Alta prepared a conceptual design for the Northwestern Pacific (NWP) Railroad corridor immediately adjacent to Downtown Ukiah, California. The NWP Rail Trail will form the north-south spine of Ukiah’s non-motorized transportation system. Alta prepared preliminary designs, cost estimates, and conceptual/ schematic design plans for the approximately 1.5-mile rail-with- trail facility. Alta identified appropriate trail design solutions, roadway crossing treatments, and other best practices for the rail-with-trail. Brian served as Project Manager of this effort. Brian is a registered landscape architect with 12 years of experience whose expertise includes management of complex construction documents, bicycle and pedestrian facilities, multi-use pathways, permit agency coordination, irrigation plans, and planting and landscape plans. Whether managing a large- or small-scale design project, Brian’s goal with each project is to work closely with the client and deliver a product that the entire project team is happy with. He has contributed expert graphics and design production services for a variety of project types from trail improvement projects to Complete Streets concepts. Relevance to the project Qualifications/Accreditations Bachelor of Landscape Architecture, CalPoly San Luis Obispo, 2008 Registered Landscape Architect: California (#6173) Experience 12 years Location Oakland, CA Brian Burchfield PLA Planning & Landscape Design/Public Outreach Page 776 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 100 Iron Horse Trail Active Transportation Corridor Study Role: Design Associate Client: Contra Costa County Department of Conservation and Development Location: Contra Costa County Brian is serving as Design Associate in Alta’s efforts to help Contra Costa County develop and active transportation study for the Iron Horse Trail. The study will test new approaches for future active transportation mobility and develop a comprehensive, achievable vision for creating a next- generation regional transportation corridor. Mountain View and Sunnyvale Bay Trail Improvements Role: Project Manager Client: Google Location: Mountain View, CA Alta led a design project to resurface and improve the Bay Trail from Crittenden Lane in Mountain View to Carl Road in Sunnyvale, a distance of four miles. The primary objective of the project was to improve safety and function for bicyclists while staying consistent with the rustic aesthetic and permeable pavement requirements of the Don Edwards National Wildlife Refuge through which the trail passes. Brian managed the consultant team through the complex design and permitting process. He also provided bid and construction administration services. SR 128 Corridor Valley Trail Feasibility Study Role: Design Associate Client: Mendocino Council of Governments Location: Mendocino County Alta prepared a feasibility plan for a multi-use trail along the scenic State Route 128 corridor in Mendocino County. The trail will connect the communities of Yorkville, Boonville, Philo and Navarro and improve bicycle and pedestrian circulation between the schools, businesses, and recreational opportunities in this corridor. Brian served as Design Associate. Salinas Williams Road Improvements Project Role: Project Manager Client: City of Salinas (Owner), Harris & Associates (Prime) Location: Salinas, CA As Alta’s project Landscape Architect and Project Manager, Brian lead efforts to improve safety, mobility, and active transportation connectivity along the Williams Road corridor. Alta prepared a comprehensive transportation analysis of the one-half mile corridor between E. Alisal Street to Grandhaven, and developed 30% concept design support for traffic, landscape architecture, and lighting. The plan also provides street beautification and gateway treatments. Brian Burchfield | Planning & Landscape Design Page 777 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 101 Relevant Project Experience North Coast Great Redwood Trail Feasibility Study Role: Project Manager Client: California Department of Parks and Recreation Location: Northern California As Project Manager, Deven led Alta’s efforts to conduct existing conditions inventories, trail governance and railbanking research, corridor segmenting, prioritization, and cost estimates for a feasibility study for the North Coast Great Redwood Trail. The 300-mile trail will run along active and abandoned railway spanning from San Francisco Bay to Humboldt Bay, passing through some of the most beautiful and rugged landscapes in the United States. Lower Russian River Trail Feasibility Study (LRRT) Role: Senior Advisor and QC Lead Client: Sonoma County Location: Sonoma County Alta led a feasibility study in Sonoma County to identify the safest and most feasible route for a 19.3-mile long separated paved trail along the Lower Russian River between Forestville and Highway 1. Alta performed site analyses through environmentally sensitive areas; prepared community surveys, maps, and sketches; and participated in and facilitated community workshops and meetings. Deven served as Senior Advisor and QC Lead for this project. Tigard Street Heritage Trail Role: Project Manager Client: City of Tigard Location: Tigard, OR As the lead consultant, Alta provided a full range of services from conceptual design to construction administration for the Tigard Street Heritage Trail—a trail that follows an inactive rail corridor, and will provide a safe off-street walking, running and biking commuter route that ties into the heart of Tigard’s Main Street. Alta conducted robust community engagement efforts, evaluated existing conditions, and developed final construction documents. Deven was Project Manager of this effort. Dumbarton Quarry Lakes Trail, Fremont Role: Project Manager Client: City of Fremont Location: Fremont, CA Deven is serving as Project Manger in Alta’s work with the City of Fremont to achieve environmental clearance and preliminary Deven is an experienced project manager and designer, adept at overseeing and facilitating design and implementation for mobility corridors, trails, parks, and open space projects. He manages large, interdisciplinary consultant teams on projects that meet client expectations and are delivered on time and within budget. He is highly organized and excels in the production of reports, scheduling, and overseeing quality assurance processes. Deven has delivered some of the largest and most complex active transportation projects in the country, and is currently serving as the Alta Project Manager for the LA River Path, a $365 million, eight-mile corridor through downtown Los Angeles and one of the most high-profile active transportation projects in the world. Relevance to the project Devon Young PLA, ASLA Planning & Landscape Design/Public Outreach Experience 15 years Location Oakland, CA Qualifications/Accreditations MLA, University of Oregon 2013 BA, International Studies, UCSB 2005 Professional Landscape Architect: Oregon (#0958) Co-Leader of Alta’s Wayfinding Service Area Core Team Leader of Alta’s Trails and Greenways Service Area Page 778 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 102 Devon Young | Planning & Landscape Design Support engineering for an east-west trail between Dumbarton bridge and Quarry Lakes/Niles Canyon. The proposed trail will provide trail connections to priority development areas, transit centers, regional open space areas, and residential neighborhoods through the use of paved Class I multi-use pathways, Class IV separated bikeways, protected intersections, and ADA compliant sidewalks. Santa Clara County Central Bike Superhighway Role: Principal-in-Charge Client: Santa Clara Valley Transit Authority (VTA) Location: Santa Clara County, CA Alta is leading a study for the Santa Clara Valley Transportation Authority to identify a preferred alignment and design for a continuous, connected, low-stress bicycle superhighway between Santa Clara and East San José. Multi-jurisdictional coordination is essential to establishing consistent, comfortable conditions along the corridor, and Alta’s outreach approach is focused on “sharing the power” and enabling community-based organizations to take ownership of the process. Deven is the Principal-in-Charge. CV Link Role: Project Manager Client: Coachella Valley Association of Governments Location: Coachella Valley, CA Deven is the Project Manager for CV Link, an innovative, multimodal facility of national importance that connects communities in the Coachella Valley. The proposed pathway system will accommodate low speed electric vehicles in addition to bicyclists and pedestrians. Deven is currently managing a team of 12 subconsultants to implement the first 50 miles of pathway. This management has included extensive outreach to develop the overall project identity as well as agency and engineering coordination at the district, county, state and national levels. Deven has guided the team through this complex project to deliver both the PA/ED and is currently working on delivering final PS&E. Metro LA River Path Role: Project Manager Client: Los Angeles County Metropolitan Transportation Authority (Metro) Location: Los Angeles, CA Deven is Alta’s Project Manager for Metro’s LA River Path project. Alta is co-leading the team selected to design this landmark active mobility project for LA. This $365 million effort—one of the largest active transportation path projects in the world—will close an eight-mile gap along the Los Angeles River (LA River) in downtown Los Angeles and Vernon. Once complete, the LA River Path will be a 32-mile continuous pathway for walking and biking from Long Beach to the San Fernando Valley, providing a world-class facility for Angelenos and the region. Page 779 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 103 Location Oakland, CA Experience 12 years Memberships Member, American Society of Landscape Architects Northern California Chapter Ryan seeks to create projects of lasting social and environmental value through the design of compelling places. He has worked on an array of urban design and landscape architecture projects, widely ranging in scale and scope. His work in streetscape design, aff ordable housing, and civic engagement has allowed him to develop a diverse background. Ryan has also spent time serving with Bike & Build, planning and leading service-oriented bicycling trips to benefi t aff ordable housing and empower young adults for a lifetime of service and civic engagement. Relevance to the project Key technical skills Trails and greenways, Green infrastructure, complete streets, site design, construction documentation Qualifications/Accreditations BS, Landscape Architecture, The Ohio State University, 2009 Relevant Project Experience North Coast Great Redwood Trail Feasibility Study, CA Role: Design Associate/Outreach Support Client: California Department of Parks and Recreation Location: Northern California Alta is part of the consultant team selected by the California Department of Parks and Recreation to lead a feasibility study for the North Coast Great Redwood Trail. The 300-mile trail will run along active and abandoned railway spanning from San Francisco Bay to Humboldt Bay, and will take cyclists, hikers, and horseback riders through some of the most beautiful landscapes in the United States. The trail is expected to attract hundreds of thousands of visitors and serve as an economic driver to the communities in the area. Electric Greenway Role: Design Associate/Outreach Support Client: City of Citrus Heights Location: Citrus Heights, CA The Electric Greenway is a 2.9 mile multi-use trail between Sunrise Boulevard and Wachtel Way largely following an existing Sacramento Municipal Utility District (SMUD) electric corridor. The project is in the City of Citrus Heights and unincorporated Orangevale, connects several neighborhoods to seven parks, several schools and the Sunrise Marketplace. Alta led the preliminary alignment development as well as the masterplans for five parks along the alignment. Alta was also involved in the robust public engagement process. Lower Russian River Trail Feasibility Study (LRRT) Role: Design Associate/Outreach Support Client: Sonoma County Location: Sonoma County, CA Alta is leading a feasibility study in Sonoma County to identify the safest and most feasible route for a 19.3-mile long separated paved trail along the Lower Russian River between Forestville and Highway 1. Alta is performing site analyses through environmentally sensitive areas, preparing community surveys, maps, and sketches, participating and facilitating community workshops and meetings, responding to community feedback, and preparing and presenting draft and fi nal feasibility study report. Iron Horse Trail Active Transportation Corridor Study, Role: Design Associate/Outreach Support Client: Contra Costa County Location: Contra Costa County, CA Alta is helping Contra Costa County develop the Iron Horse Trail Active Transportation Corridor Study to test new approaches for future active transportation mobility and develop a comprehensive, achievable vision for creating a next-generation regional transportation corridor. Ryan Booth Planning & Landscape Design/Public Outreach Page 780 of 800 www.ghd.com GHD City of Ukiah Great Redwood Trail Phase 4 104 Key technical skills Illustrative design, complete streets design Qualifications/Accreditations Masters in Landscape Architecture, University of Oregon, 2021 Bachelor of Arts in Biology, University of Hawaii at Manoa, 2015 Location Oakland, CA Experience 3 years Project Experience CV Link Role: Designer/Outreach Support Client: Coachella Valley Association of Governments Location: Coachella Valley, CA Carmela assisted with exhibit preparation and outreach support or CV Link, an innovative, multimodal facility of national importance that connects communities in the Coachella Valley. In 2013, Alta began development of the CV Link Master Plan for a nearly 80-mile portion of the multimodal pathway connecting the nine cities of the Eastern Riverside County region. The proposed pathway system will accommodate low speed electric vehicles in addition to bicyclists and pedestrians. Alta provided recommendations for on-street segments at the highest design standard, and supporting infrastructure, including LSEV charging facilities. Alta also recommended an implementation strategy with immediate next steps and segments for near-term construction or upgrades. Middlefield Road Diet Evaluation Role: Designer/Outreach Support Client: City of Palo Alto Location: Palo Alto, CA Alta evaluated changes in transportation conditions over a one-year period along Middlefield Road in Palo Alto, from San Francisquito Creek to Channing Avenue, resulting from a four-to- three-lane road diet (reduction in traffic lanes). To track changes in performance of the study corridor during the three evaluation periods (Spring 2017, Fall 2017, and Spring 2018), Alta collected quantitative and qualitative data to help evaluate changes in safety, demand, reliability, and public opinion. Alta summarized the findings in a report about the three evaluation periods and presented the findings to the City Council. Carmela assisted with traffic analysis and evaluations. 72nd Avenue Transportation Study Role: Designer/Outreach Support Client: City of Tigard Location: Tigard, OR As a subconsultant, Alta supported work to determine a desired configuration of 72nd Avenue from Pacific Highway south through the Tigard Triangle to approximately SW Tech Center Drive on the south end of the Hwy 217/72nd Ave interchange. Existing issues in this corridor include poor walking and cycling conditions, particularly in the Hwy 217 interchange area and near Pacific Hwy (Hwy 99W), and a lack of alternate routes. Significant traffic congestion exists, particularly on southbound 72nd Avenue through the Hwy 217 interchange. Carmela helped the project team develop design consideration renderings for they study. Carmela is an active transportation designer with a strong appreciation for culture, community and a passion for integrating science with design to improve communities. As a design professional, she is passionate about creating spaces that are safe, inclusive, and fun. Relevance to the project Carmela Sambo Planning & Landscape Design/Public Outreach Page 781 of 800 → ghd.com Page 782 of 800 GHD Inc. 2235 Mercury Way Suite 150 Santa Rosa CA 95407 USA T 1 707 523 1010 F 1 707 527 8679 E santarosa@ghd.com W www.ghd.com September 2, 2021 City of Ukiah Department of Public Works 300 Seminary Avenue Ukiah, CA 95482-5400 Attn: Andrew Stricklin, Associate Engineer RE: Fee Proposal for Great Redwood Trail Phase 4 – Specification No. 21-02 Dear Mr. Stricklin: Thank you for the opportunity to propose our team’s qualifications to provide design services. Enclosed please find our team’s associated fee schedules for your consideration. GHD will perform these services on a Time and Materials Basis with a not-to-exceed amount of $312,491. We welcome the opportunity to review our approach and other assumptions with you and are confident that we can come to a mutually beneficial agreement. As noted, GHD and our entire team are excited for the opportunity to help deliver this important project and look forward to working with you. If you have any questions about our qualifications or fees, please contact me at (707) 540-9687. Sincerely, GHD, Inc Matt Kennedy, PE TE Principal in Charge - Authorized Official Page 783 of 800 Fee Proposal For the Great Redwood Trail Phase 4 - Specification No. 21-02 PROJECT NAME: City of Ukiah Northwester Pacific Rail Trail Phase 4 PROJECT NUMBER: 12557341 ` Date: 9/2/2021 LABOR COSTS Firm---> Employee--->Kennedy Tortora Schmal Daas Harvey Tortora Burns Gould Maddock Howard 2-man Crew Hummel Bohannon Penry Lee Guggiana Osorno Piper Varies Wolf Silva Hours Fee Role--->Principal Proj. Mngr. Civil Engineer Civil Engineer Storm Design Civil Drafter Structural Engr. Structural Designer Land Surveyor Land Surveyor Field Crew UAV Pilot Survey Tech Traffic Traffic Elec.Elec.Landscape Admin Agency Permitting QA/QC Task Rate-->$255.00 $215.00 $215.00 $170.00 $195.00 $80.00 $195.00 $155.00 $155.00 $215.00 $305.00 $170.00 $100.00 $235.00 $215.00 $215.00 $155.00 $170.00 $135.00 $235.00 $275.00 Task1: Project Management 134 $29,770 $600 $5,166 $0 $35,536 1.1 Project Management and Coordination 6 40 46 $10,130 $0 $5,166 $0 $15,296 1.2 Project Meetings 4 16 4 4 12 8 8 8 64 $13,600 $0 $0 $0 $13,600 1.3 Quality Assurance / Quality Control 4 8 12 24 $6,040 $0 $0 $0 $6,040 Airfare 0 $0 $300 $0 $0 $300 Lodging (per Diem $200/person/day)0 $0 $200 $0 $0 $200 Rental Car and Gas 0 $0 $100 $0 $0 $100 Task 2: Review and Evaluate Existing Documents and DataReview and Evaluate Existing Documents and Data 22 $4,470 $0 $0 $0 $4,470 2.1 Review and Summary of Plans, Surveys, Records 4 4 4 2 2 4 2 22 $4,470 $0 $0 $0 $4,470 0 $0 $0 $0 $0 $0 Task 3: Topographic Survey and Right of Way 170 $27,550 $4,500 $0 $0 $32,050 3.1 Topographic Survey and ROW Field Work 8 2 12 30 52 $10,430 $0 $0 $0 $10,430 3.2 Topographic survey and ROW Mapping 2 2 4 20 12 30 48 118 $17,120 $0 $0 $0 $17,120 Equipment 0 $0 $2,500 $0 $0 $2,500 Per Diem 0 $0 $1,000 $0 $0 $1,000 Mileage 0 $0 $1,000 $0 $0 $1,000 Task 4: Geotechnical Investigation and Report 14 $2,510 $0 $0 $26,166 $28,676 4.1 Geotechnical Analysis and Report 2 4 4 4 14 $2,510 $0 $0 $26,166 $28,676 0 $0 $0 $0 $0 $0 Task 5: Preliminary (30%) Design 266 $37,940 $950 $11,392 $0 $50,282 5.1 Drainage Study 4 12 40 16 72 $4,720 $0 $0 $0 $4,720 5.2 Preliminary Plans 2 16 24 40 32 8 8 8 2 8 8 2 158 $26,730 $0 $11,392 $0 $38,122 5.3 Preliminary Estimate 2 4 16 4 2 2 4 2 36 $6,490 $0 $0 $0 $6,490 0 $0 $0 $0 $0 $0 Airfare 0 $0 $400 $0 $0 $400 Lodging (per Diem $200/person/day)0 $0 $400 $0 $0 $400 Rental Car and Gas 0 $0 $150 $0 $0 $150 Task 6: Engineering Design (60%, 90%, and final)782 $118,960 $4,500 $38,018 $0 $161,478 6.1 60% Plans, Specs and Estimate 2 24 32 60 60 16 20 16 12 24 32 4 302 $46,610 $0 $13,081 $0 $59,691 6.2 90% Plans, Specs and Estimate 2 24 24 40 40 12 16 12 12 12 24 2 220 $34,720 $0 $10,283 $0 $45,003 6.3 100% (Final Bid Ready) Submittal 2 16 20 24 40 8 12 8 8 8 16 2 164 $25,180 $0 $7,517 $0 $32,697 6.4 Permitting and Agency Coordination 16 4 16 16 6 26 8 92 $11,590 $0 $0 $0 $11,590 6.5 Signage 2 2 4 $860 $0 $6,536 $0 $7,396 reproduction and copies 0 $0 $500 $150 $0 $650 Airfare 0 $0 $1,000 $0 $0 $1,000 Lodging (per Diem $200/person/day)0 $0 $2,000 $450 $0 $2,450 Rental Car and Gas 0 $0 $1,000 $0 $0 $1,000 Task 7: Supporting Biological Resources Surveys and Studies (Optional)0 $0 $0 $0 $0 $0 7.1 Biological Resource Survey and Report 0 $0 $0 $0 $0 $0 7.2 Sensitive Natural Community Mapping, and Habitat Assessment 0 $0 $0 $0 $0 $0 7.3 Biological Resources Report 0 $0 $0 $0 $0 $0 7.2 Aquatic Resources Delineation 0 $0 $0 $0 $0 $0 0 $0 $0 $0 $0 $0 Task 8: Project Stormwater Pollution Prevention Plan (SWPPP) [Optional] 8.1 SWPPP 0 $0 $0 $0 $0 $0 0 $0 $0 $0 $0 $0 TOTAL HOURS 22 176 136 208 40 204 50 60 30 14 12 60 48 32 62 46 56 82 12 16 22 SUBTOTAL FEE $5,610 $37,840 $29,240 $35,360 $6,800 $16,320 $9,750 $9,300 $4,650 $3,010 $3,660 $10,200 $4,800 $7,520 $14,570 $9,890 $8,680 $13,940 $1,620 $3,760 $6,050 0% MARKUP ON SUBS NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA NA TOTAL FEE $5,610 $37,840 $29,240 $35,360 $6,800 $16,320 $9,750 $9,300 $4,650 $3,010 $3,660 $10,200 $4,800 $7,520 $14,570 $9,890 $8,680 $13,940 $1,620 $3,760 $6,050 The fee presented above is an estimate. We welcome the opportunity to discuss the proposed scope and fee and we are open to negotiating any changes the City feels would better suit the project needs. 2642 $221,200 $312,491 GHD Inc Subtotals Total FeeSubconsultant $54,575 Expenses $10,550 Alta Planning + design Air Fair, Lodging, meals, and rental car Subconsultant Crawford $26,166 Page 784 of 800 De v e n Y o u n g , Pr i n c i p a l i n C h a r g e Br i a n B u r c h f i e l d , Pr o j e c t M a n a g e r Ry a n B o o t h , De s i g n A s s o c i a t e Ca r m e l a S a m b o , De s i g n e r Ho u r s Ma t e r i a l s Co s t 232$ 183$ 152$ 97$ Project Initiation and Management 5 16 4 0 25 4,696$ Project Kick Off 1 4 4 9 1,572$ Ongoing Project Management 4 12 16 3,124$ Preliminary (30%) Design 2 12 20 48 82 10,356$ 2 12 20 48 82 10,356$ PS&E (60%, 90%, 100% Final)4 42 54 116 216 28,074$ 60 % Plans and Estimate 1 20 22 48 91 11,892$ 90% Plans, Specifications and Estimate 1 12 20 40 73 9,348$ 100% Final Plans, Specifications and Estimate 2 10 12 28 52 6,834$ Interpretive Signage 1 10 0 40 51 5,942$ 1 10 40 51 5,942$ OPTIONAL TASK: Public Outreach -$ -$ TOTAL HOURS (not including optional tasks)12 80 78 204 374 49,068$ ODC1 Travel Costs 250$ 250$ ODC2 Per Diem (Meals & Lodging)200$ 200$ ODC7 Plotting, Printing Postage 150$ 150$ ODC8 -$ ODC9 -$ Estimated Salary Escalation -$ -$ TOTAL DIRECT COSTS 600$ TOTAL (not including optional tasks) 49,668$ Alta Planning + Design COSTS Ukiah Great Redwood Trail DIRECT COSTS Page 785 of 800 Crawford Associates, Inc., 1100 Corporate Way, Suite 230, Sacramento, CA 95831 - (916) 455-4225 - www.crawford-inc.com Project Name: Description: County / City: TASK CLASSIFICATION / SERVICES HOURS / QUANTITY RATE UNIT MULT SUBTOTAL TOTAL TASK No. 1 - Field Preparation and Preliminary Review Principal 2 215.00$ Hour 1 430.00$ Senior Project Manager 2 180.00$ Hour 1 360.00$ Project Manager 2 175.00$ Hour 1 350.00$ Senior Engineer 4 155.00$ Hour 1 620.00$ Project Engineer II 2 145.00$ Hour 1 290.00$ Project Engineer I 4 135.00$ Hour 1 540.00$ Staff Engineer 2 115.00$ Hour 1 230.00$ Administrative Assistant 2 90.00$ Hour 1 180.00$ Mileage (Site visit, USA Marking)20 0.60$ Mile 1 12.00$ 3,012$ TASK No. 2 - Subsurface Exploration and Sampling Senior Engineer 4 155.00$ Hour 1 620.00$ Project Engineer I 19 115.00$ Hour 1 2,185.00$ Per Diem (Drilling)2 150.00$ Day 1 300.00$ Mileage (Drilling)320 0.60$ Mile 1 192.00$ Drilling Rig 1 6,000.00$ Day 1.15 6,900.00$ Steel Liners (MCAL/SPT)16 8.00$ Each 1 128.00$ 10,325$ TASK No. 3 - Laboratory Testing Project Engineer I 1 135.00$ Hour 1 135.00$ #200 Wash 2 135.00$ Test 1 270.00$ Grain Size Analysis to #200 2 135.00$ Test 1 270.00$ Moisture & Density 4 60.00$ Test 1 240.00$ Plasticity Index 2 250.00$ Test 1 500.00$ R-Value 3 250.00$ Test 1 750.00$ 1 310.00$ Test 1 310.00$ 2,475$ TASK No. 4 - Geotechnical Report Principal 1 215.00$ Hour 1 215.00$ Senior Project Manager 3 180.00$ Hour 1 540.00$ Project Manager 1 175.00$ Hour 1 175.00$ Senior Engineer 6 155.00$ Hour 1 930.00$ Project Engineer II 24 145.00$ Hour 1 3,480.00$ Project Engineer I 4 135.00$ Hour 1 540.00$ Staff Engineer 5 115.00$ Hour 1 575.00$ Administrative Assistant 2 90.00$ Hour 1 180.00$ 6,635$ TASK No. 5 - Consultations and Design Team Support Senior Project Manager 4 180.00$ Hour 1 720.00$ Senior Engineer 4 155.00$ Hour 1 620.00$ 1,340$ CRAWFORD & ASSOCIATES TOTAL 23,787.00$ Chemical Analysis (pH, Sulfate, Chloride, Redox Potential, Sulfate Reducing Bacteria) Proposal Date: August 24, 2021 GEOTECHNICAL ENGINEERING SERVICES - COST PROPOSAL Great Redwood Trail Phase 4 Ukiah, Mendocino County Page 786 of 800 Rate Rate A01 Senior Technical Director 1 $275 C03 Senior Admin Officer 1 $155 A02 Senior Technical Director 2 $255 C04 Senior Admin Officer 2 $125 A03 Senior Technical Director 3 $235 C05 Admin Officer 1 $105 A04 Technical Director 1 $215 C06 Admin Officer 2 $90 A05 Technical Director 2 $195 C07 Admin Officer 3 $75 A06 Senior Professional 1 $170 D01 Business Services Manager 1 $275 A07 Senior Professional 2 $155 D02 Business Services Manager 2 $255 A08 Professional 1 $135 D03 Senior Admin Officer 1 $215 A09 Professional 2 $120 D04 Senior Admin Officer 2 $170 A10 Professional 3 $110 D05 Admin Officer 1 $155 A11 Intern $80 D06 Admin Officer 2 $110 B01 Lead Design Technician 1 $250 D07 Admin Officer 3 $100 B02 Lead Design Technician 2 $225 D08 Admin Officer 4 $90 B03 Lead Design Technician 3 $205 D09 Admin Officer 5 $85 B04 Senior Design Technician 1 $165 D10 Admin Officer 6 $75 B05 Senior Design Technician 2 $155 S01 Senior Construction Manager $250 B06 Design Technician 1 $145 S02 Construction Manager $205 B07 Design Technician 2 $130 S03 Lead Site Engineer/Supervisor $175 B08 Drafting/Design 1 $120 S06 Lead Inspector $165 B09 Drafting/Design 2 $110 S07 Senior Inspector $150 B10 Drafting/Design 3 $100 S08 Inspector / Specialist 1 $135 B11 Drafting/Design 4 $90 S09 Inspector / Specialist 2 $110 B12 Intern Drafting/Design $80 S10 Clerk / Specialist 3 $80 C01 Business Services Manager 1 $250 S15 Operator/Laborer 1 $125 C02 Business Services Manager 2 $210 S16 Operator/Laborer 2 $105 S17 Operator/Laborer 3 $95 1 2 3 4 a. General Associated Project Charges (APC): $6.50 / hour b. Environmental Department/Construction Inspector: $11.50 / hour c. Field Survey APC: $15.00 / hour 5 6 7 8 The Rate Schedule is subject to change annually (July 1st each year). FY 2021 US West Region Rate Schedule Reimbursement for direct expenses incurred for proposed services, including sub-consultant services, will be billed at cost plus 15% The cost of using equipment and specialized supplies is billed on the basis of employee hours dedicated to the projects at the following rates Reimbursement for vehicles used for proposed services will be at the federally approved mileage rates or at a negotiated monthly rate. If prevailing wage are applicable, the above billing rates and APC will be adjusted proportionate to the increase in labor cost Overtime for non-exempt employees will be charged at 1.5 times the hourly billing rate. Finance Class Code Finance Class Code Rates are for employees of all GHD compaines. All travel cost will be invoiced at coach class rates. Lodging and meal expenses will be at cost unless per diem rate is negotiatied. Page 787 of 800 Alta Planning + Design, Inc. Billing Rates ‐ 2021 Labor Category Rate Typical Classifications Included in Rate Labor Category 1a $335 Senior Principal Labor Category 1b $283 Principal Labor Category 1c $263 Principal Labor Category 2 $232 Principal Labor Category 3 $225 Principal, Senior Associate Labor Category 4 $211 Principal, Senior Associate Labor Category 5 $203 Principal, Senior Associate Labor Category 6 $195 Principal, Senior Associate Labor Category 7 $191 Principal, Senior Associate Labor Category 8 $183 Senior Associate, Associate Labor Category 9 $174 Senior Associate, Associate Labor Category 10 $170 Senior Associate, Associate Labor Category 11 $163 Associate, Senior Labor Category 12 $152 Associate, Senior Labor Category 13 $142 Associate, Senior Labor Category 14 $130 Senior, Level I Labor Category 15 $119 Senior, Level I Labor Category 16 $109 Level I, Level II Labor Category 17 $97 Level I, Level II Labor Category 18 $82 Administration Labor Category 19 $75 Intern Rates are presented in US Dollars (US$) and are subject to change at any time. Subconsultants and reimbursable expenses will be charged at cost + 10% markup. Mileage will be charged at the provisional standard rate. In‐house reproductions will be charged as follows: Color copies $0.65/ page Black and white copies $0.20/page 24” x 36” large format plot $17.50/sheet 36” x 48” large format plot $32.50/sheet Page 788 of 800 PROFESSIONAL TITLE RATE CONSTRUCTION/EQUIPMENT DETAIL RATE Principal 215.00$ Traffic Control (Major) DBE or PW DAY 2,500.00$ Senior Project Manager 180.00$ Traffic Control Equipment (Minor) Non-DBE DAY 700.00$ Project Manager 175.00$ Seismic Refraction (12 Channel) DAY 1,200.00$ Senior Geologist / Environmental 155.00$ Core Machine with Generator DAY 2,500.00$ Senior Engineer 155.00$ Core Machine Bit INCH 3.00$ Project Engineer II 145.00$ Core Box EACH 17.25$ Project Engineer I 135.00$ Hot Mix Asphalt Patching (1st Core)FIRST 1,000.00$ Staff Engineer 115.00$ Hot Mix Asphalt Patching (2 or More)EACH AFTER 500.00$ Administrative Assistant 90.00$ Wildcat DCP Equipment DAY 750.00$ Soils Technician (Prevailing Wage) **130.00$ Wildcat DCP Tip EACH 15.00$ Concrete Technician (Prevailing Wage) **120.00$ Survey Equipment (Tripod, Level, Rod)DAY 150.00$ Laborer Technician (Prevailing Wage) **110.00$ Survey Equipment (Liquid Level)DAY 150.00$ Percolation Equipment DAY 150.00$ REIMBURSABLES Hand Auger DAY 150.00$ Mileage $ 0.60 / Per Mile Backfill BAG 8.00$ Outside Costs 15% Markup Steel Liners (MCAL/SPT)EACH 8.00$ Permit Fees (City/County)15% Markup Nuclear Density Test EACH 6.00$ Per Diem (Lodging & Meals)County Rate CLASSIFICATION TESTING #200 Wash ASTM D1140 110.00$ Grain Size Analysis to #200 (Sieve Analysis)ASTM D6913 150.00$ EXTRAS Grain Size with Hydrometer ASTM D6913, D7928 240.00$ Rush Testing 50% Markup Hydrometer Analysis ASTM D7928 175.00$ (This guarantees your samples get top priority)Moisture & Density ASTM D2216, D7263 60.00$ Moisture Content ASTM D2216, CTM 226 40.00$ Non-Plastic Index Result ASTM D4318 125.00$ Plasticity Index ASTM D4318 250.00$ STRENGTH TESTING California Impact CTM 216 280.00$ Compaction Curve (4" Mold)ASTM D698/D1557 265.00$ Compaction Curve (6" Mold)ASTM D698/D1557 295.00$ Compaction Curve Checkpoint (4" Mold)ASTM D698/D1557 66.00$ Compaction Curve Checkpoint (6" Mold)ASTM D698/D1557 74.00$ Compression (Rock)ASTM 7012 275.00$ Compressive Strength of Cylinders ASTM C39 34.50$ Direct Shear (CD 3pt) Peak Only ASTM D3080 500.00$ Point Load (Rock)ASTM D5731 65.00$ R-Value ASTM D2844, CAL 301 350.00$ Triaxial Shear-UU ASTM D2850 165.00$ Triaxial Staged-UU ASTM D2850 265.00$ Unconfined Compression (Rock)ASTM D7012 225.00$ Unconfined Compression (Soil)ASTM D2166 165.00$ CONSOLIDATION & EXPANSION 1-D Consolidation ASTM D2435 300.00$ 1-D Consolidation (Time Rate) / Per Point ASTM D2435 75.00$ Expansion Index ASTM D4829 210.00$ CHEMICAL ANALYSIS TESTING pH & Resistivity CTM 643 100.00$ Sulfate Content CTM 417 50.00$ Chloride Content CTM 422 50.00$ Redox Potential and Sulfate Reducing Bacteria ASTM D1498 110.00$ PAVEMENT TESTING Asphalt Ignition Calibration CTM 382 345.00$ Grain Size Analysis CTM 209 150.00$ Percent Asphalt Ignition Oven CTM 382 145.00$ Sand Equivalent CTM 217 130.00$ Stabilometer Value CTM 366 200.00$ Theoretical Max Specific Gravity/Density CTM 309 200.00$ SEISMIC ANALYSIS EZ Frisk Site Specific Analysis PER PROJECT 1,500.00$ Rates are applicable through Dec 31, 2021. An escalation factor of 3% per year may apply for work completed after 2021. 2021 PROFESSIONAL & LAB RATES Corporate Office: 1100 Corporate Drive, Suite 230, Sacramento, CA 95831 -(916) 455-4225 Modesto: 1165 Scenic Drive, Suite B, Modesto, CA 95350 -(209) 312-7668 Pleasanton: 6200 Stoneridge Mall Road, Suite 330, Pleasanton, CA 94588 -(925) 401-3515 Rocklin: 4220 Rocklin Road, Suite 1,Rocklin, CA 95677 -(916) 455-4225 Ukiah: 100 North Pine Street, Ukiah, CA 95482 -(707) 240-4400 Page 789 of 800 Page 1 of 2 Agenda Item No: 13.b. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2021-1053 AGENDA SUMMARY REPORT SUBJECT: Possible Introduction by Title Only of an Ordinance Amending Division 1, Chapter 4, Article 4B of the City Code Regarding the Procedure for Filling Vacancies on the Design Review Board. DEPARTMENT: City Clerk PREPARED BY: Kristine Lawler, City Clerk PRESENTER: Kristine Lawler, City Clerk and Craig Schlatter, Community Development Director. ATTACHMENTS: 1. Proposed Ordinance - Redline 2. Proposed Ordinance - Clean 3. Design Review Board Application 4. Design Review Board Roster Summary: The City Council will discuss and consider introducing an Ordinance Amending Section 1161 of Division 1, Chapter 4, Article 4B of the City Code Regarding Appointment of Design Review Board Members. Background: The Design Review Board (DRB) consists of five members who have experience in architecture and design, landscape architecture, building contracting, urban planning, civil engineering, or similar field of study. Up to two members shall be at-large without a residence or business located within the City. If no at- large candidates are available, the City Council may fill the board seats with City residents or City business owners. The function of the DRB is to review proposed site development permit applications, planned development applications and precise development plans, work with staff and the applicants to ensure design consistency with the Ukiah General Plan, Zoning Code, and Design Review Guidelines, and make recommendations concerning architecture, site design layout, landscaping, parking, signage, exterior lighting, and other aspects of urban design to City Staff, the Zoning Administrator, Planning Commission and City Council as appropriate. The current practice for making appointments to the DRB is that at or near the beginning of his or her four- year term of office, each member of the City Council may nominate one Board member who shall be appointed to the Board, if approved by a majority vote of the City Council. Each Board member's term of office shall coincide with the four-year term of office of the City Council member who nominated him or her. Discussion: Staff is proposing to amend the appointment process for the DRB to reflect the same appointment process now used for Planning Commissioners. The DRB Appointment Ordinance, a redlined version of which is attached here as Attachment 1 and a clean version as Attachment 2, amends Section 1161 of Division 1, Chapter 4, Article 4B of the City Code so that vacancies on the DRB will be filled through a process in which interested candidates will file an application (a draft version of which is attached here as Attachment 3) stating their interest in the position and setting forth qualifications. After all applications are received, the City Council will review applications, interview candidates, and select a new DRB Member by majority vote. Council is authorized to establish a formal review and selection process by resolution of the Council. DRB Members serve at the will of the City Council and will serve a term of four (4) years, though Members may be appointed to successive terms without limitations. Page 790 of 800 Page 2 of 2 Should a DRB Member vacate the position before the end of their term, replacement candidates will be invited to submit applications for the vacant position, after which the City Council will initiate the review process and select a candidate by majority vote. The interview and voting process for a vacant DRB Member position will take place at a single City Council meeting, unless a different procedure is approved by a majority vote of the City Council. Please note that adoption of this Ordinance will not affect the terms of the current DRB Members. They will continue to serve at the will of the Council. The current DRB Roster showing the term expirations is attached here as Attachment 4. Recommended Action: Introduce by Title Only an Ordinance Amending Division 1, Chapter 4, Article 4B of the City Code Regarding the Procedure for Filling Vacancies on the Design Review Board. BUDGET AMENDMENT REQUIRED: N/A CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: Craig Schlatter, Community Development Director Page 791 of 800 1 ORDINANCE NO. ______ ORDINANCE OF THE CITY COUNCIL OF THE CITY OF UKIAH AMENDING DIVISION 1, CHAPTER 4, ARTICLE 4B, SECTION 1161 OF THE CITY CODE REGARDING APPOINTMENT OF DESIGN REVIEW BOARD MEMBERS. The City Council of the City of Ukiah hereby ordains as follows: SECTION ONE. Section 1161 of Division 1, Chapter 4, Article 4B of the Ukiah City Code is hereby amended to read as follows: §1161 MEMBERS; APPOINTMENT; TERM Members of the Design Review Board shall be appointed by a majority of the City Council, each to serve at the will of the City Council up to a term of four (4) years. Members may be appointed to successive terms without limitations. Members shall be appointed according to procedures established by resolution of the City Council and shall be required to complete an application. Board shall consist of a total of five (5) members, of which at least three (3) members shall be residents of the City or a business owner in the City and up to two (2) members shall be at-large without a residence or business located within the City. If no at-large candidates are available, the City Council may fill the board seats with City residents or City business owners. At or near the beginning of his or her four (4) year term of office, each member of the City Council may nominate one Board member who shall be appointed to the Board, if approved by a majority vote of the City Council. Each Board member’s term of office shall coincide with the four (4) year term of office of the City Council member who nominated him or her, regardless of whether that City Council member serves his or her full four (4) year term. If a Board member vacates his or her office before the expiration of his or her term of office, a successor shall be appointed by a majority of the City Council upon receipt and review of applications for the vacant appointment. the City Council member who nominated that Board member (or a City Council member elected or appointed to fill the remaining unexpired term of office of the City Council member who appointed the Board member) may nominate a replacement to serve the remainder of that Board member’s term of office, who shall be appointed, if the nomination is approved by a majority vote of the City Council. If a City Council member’s nomination receives less than a majority vote, he or she may nominate additional candidates, one at a time, until one of them is appointed by a majority vote of the City Council. Board members shall be nominated and voted upon at a single City Council meeting, unless a different procedure is approved by a majority vote of the City Council. If a City Council member fails to nominate a Board member within sixty (60) days after the vacancy occurs, a majority of the City Council shall fill the vacancy following the procedure used to appoint members to other City Commissions and Boards. SECTION TWO. 1.Publication: Within fifteen (15) days after its adoption, this Ordinance shall be published once in a newspaper of general circulation in the City of Ukiah. In lieu of ATTACHMENT 1 Page 792 of 800 2 publishing the full text of the Ordinance, the City may publish a summary of the Ordinance once 5 days prior to its adoption and again within fifteen (15) days after its adoption. 2. Effective Date: The ordinance shall become effective thirty (30) days after its adoption. Introduced by title only on __________, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: Adopted on ___________, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: _______________ Juan V. Orozco, Mayor ATTEST: _______ Kristine Lawler, City Clerk Page 793 of 800 ATTACHMENT 2 1 ORDINANCE NO. ______ ORDINANCE OF THE CITY COUNCIL OF THE CITY OF UKIAH AMENDING DIVISION 1, CHAPTER 4, ARTICLE 4B, SECTION 1161 OF THE CITY CODE REGARDING APPOINTMENT OF DESIGN REVIEW BOARD MEMBERS. The City Council of the City of Ukiah hereby ordains as follows: SECTION ONE. Section 1161 of Division 1, Chapter 4, Article 4B of the Ukiah City Code is hereby amended to read as follows: §1161 MEMBERS; APPOINTMENT; TERM Members of the Design Review Board shall be appointed by a majority of the City Council, each to serve at the will of the City Council up to a term of four (4) years. Members may be appointed to successive terms without limitations. Members shall be appointed according to procedures established by resolution of the City Council and shall be required to complete an application. If a Board member vacates his or her office before the expiration of his or her term of office, a successor shall be appointed by a majority of the City Council upon receipt and review of applications for the vacant appointment. Board members shall be nominated and voted upon at a single City Council meeting, unless a different procedure is approved by a majority vote of the City Council. SECTION TWO. 1. Publication: Within fifteen (15) days after its adoption, this Ordinance shall be published once in a newspaper of general circulation in the City of Ukiah. In lieu of publishing the full text of the Ordinance, the City may publish a summary of the Ordinance once 5 days prior to its adoption and again within fifteen (15) days after its adoption. 2. Effective Date: The ordinance shall become effective thirty (30) days after its adoption. Introduced by title only on __________, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: Adopted on ___________, 2021, by the following roll call vote: AYES: NOES: ABSENT: ABSTAIN: _______________ Juan V. Orozco, Mayor ATTEST: _______ Kristine Lawler, City Clerk Page 794 of 800 Updated August 22, 2016 DESIGN REVIEW BOARD APPLICATION FOR APPOINTMENT A. General Information Full Name Date Residence Address (Physical Address, not PO) Mailing Address (if different from above) Home Phone ( ) Work Phone ( ) Email @ Cell Phone ( ) Employer Business Address Job Title/Position Employed Since How long have you resided in: Ukiah? Mendocino County? California? Please list community groups or organizations you are affiliated with and list any offices held. B. Please answer the following on a separate sheet(s) of paper and attach. 1.Why are you applying to serve on the City of Ukiah's Design Review Board? 2.What is your understanding of the purpose, role and responsibility of the Design Review Board? 3.Please list any volunteer, civic or charitable organizations to which you serve or have served. Have you held an officer position in any of these organizations? 4.How do you believe your own skills, experience, expertise and perspectives will be beneficial to the work of the Design Review Board? 5.Can you commit to preparing for and attending at least one meeting of the Design Review Board per month? Note: for most monthly agendas, the average time needed for preparation and attendance is 2-3 hours. 6.Please describe your experience in architecture/design, community, city, urban or environmental planning, construction, engineering or surveying, and/or historical or cultural preservation. 7.Are you interested in serving on any other Boards or Commissions of the City? If so, which one(s)? _____________________________________________________________________________________________ Signature of Applicant Date Thank you for your interest in serving your community and the City of Ukiah. Please return this application and attachments to the City Clerk’s office at 300 Seminary Avenue, Ukiah, CA 95482. If you have any questions, please contact the City Clerk’s office at (707) 463-6217. ATTACHMENT 3 Page 795 of 800 9/8/2021 Design Review Board Board Contact Person: Michelle Irace – 463-6207 Established: Ordinance 1136, Adopted on June 6, 2012 City Dept. Affiliation: Planning Department Membership: Board shall consist of a total of five (5) members, of which at least three (3) members shall be residents of the City or a business owner in the City and up to two (2) members shall be at-large without a residence or business located within the City. If no at-large candidates are available, the City Council may fill the board seats with City residents or City business owners. Board members shall have sufficient education and/or experience to perform and fulfill the duties required in section 1169 (See Function). This education and/or experience may consist of a college degree, professional license, or employment experience in architecture and design, landscape architecture, building contracting, urban planning, civil engineering, or similar field of study. Alternatively, the City Council may determine that a combination of education and/or experience in lieu of a college degree, professional license, or employment experience may qualify a candidate for the Board. Term: At or near the beginning of his or her four (4) year term of office, each members of the City Council may nominate one Board members who shall be appointed to the Board, if approved by a majority vote of the City Council. Each Board member's term of office. Appointed By: City Council: If a City Council member's nomination receives less than a majority vote, he or she may nominate additional candidates, one at a time, until one of them is appointed by a majority vote of the City Council. Board members shall be nominated and voted upon at a single City Council meeting, unless a different procedure is approved by a majority vote of the City Council. If a City Council member fails to nominate a Board member within sixty (60) days after the vacancy occurs, a majority of the City Council shall fill the vacancy following the procedure used to appoint Members to other City Commissions and Boards. Meets: The Board shall hold at least one regular meeting each month at a time and place established by the Board, unless a lack of business or a lack of a quorum occurs. Function: It shall be the function and duty of the Design Review Board to review proposed site development permit applications, planned development applications and precise development plans, work with staff and the applicants to ensure design consistency with the Ukiah General Plan, Zoning Code, and Design Review Guidelines, and make recommendations concerning architecture, site design layout, landscaping, parking, signage, exterior lighting, and other aspects of urban design to city staff, Zoning Administrator, Planning Commission and City Council as appropriate. Name/Address Contact Info Member Position Current Appt. Date Expiration Date Howell Hawkes Member - City Resident/Property or Business Owner 12/19/2018 12/7/2022 Colin Morrow . Member - City Resident/Property or Business Owner 12/19/2018 12/7/2022 Tom Liden Member - City Resident/Property or Business Owner 12/19/2018 12/7/2022 VACANT Member - Community at Large VACANT Member - Community at Large ATTACHMENT 4 Page 796 of 800 Page 1 of 1 Agenda Item No: 13.c. MEETING DATE/TIME: 9/15/2021 ITEM NO: 2019-62 AGENDA SUMMARY REPORT SUBJECT: Receive Updates on City Council Committee and Ad Hoc Assignments, and, if Necessary, Consider Modifications to Assignments and/or the Creation/Elimination of Ad Hoc(s). DEPARTMENT: City Clerk PREPARED BY: Kristine Lawler, City Clerk PRESENTER: Mayor Orozco and Various Councilmembers ATTACHMENTS: 1. 2021 City Council Special Assignments Summary: City Council members will provide reports and updates on their committee and ad hoc assignments. If necessary, the Council may consider modifications. Background: City Council members are assigned to a number of committees and ad hoc activities. These assignments are included as Attachment 1. Discussion: Previously, the City Council discussed having more time allocated to reporting on committee and ad hoc activities. Often, the Council Reports section of the regular agenda is rushed due to impending business (i.e., public hearings), and not enough time is afforded for reports beyond community activities. In an effort to foster regular updates on committee and ad hoc assignments, this item is being placed on the agenda to provide the City Council members an expanded opportunity to report on assignments and modify assignments as necessary. Recommended Action: Receive report(s). The Council will consider modifications to committee and ad hoc assignments along with the creation/elimination ad hoc(s). BUDGET AMENDMENT REQUIRED: No CURRENT BUDGET AMOUNT: N/A PROPOSED BUDGET AMOUNT: N/A FINANCING SOURCE: N/A PREVIOUS CONTRACT/PURCHASE ORDER NO.: N/A COORDINATED WITH: N/A Page 797 of 800  2021 CITY COUNCIL SPECIAL ASSIGNMENTS COUNTY/REGIONAL OnGoing One + Alternate MTG DATE/TIME MEETING LOCATION MAILING ADDRESS/CONTACT COMMITTEE FUNCTION ASSIGNED TO PRINCIPAL STAFF SUPPORT Disaster Council Shall meet a minimum of once a year at a time and place designated upon call of the chair Place designated upon call of the chair or, if she/he is unavailable or unable to call such meeting, the first vice chair and then the City Manager or her/his designee. Office of Emergency Management 300 Seminary Ave. Ukiah, CA 95482 467-5765 - Tami Bartolomei Develop any necessary emergency and mutual aid plans, agreements, ordinances, resolutions, rules, and regulations. Orozco Duenas- Alternate Tami Bartolomei, Office of Emergency Management Coordinator; 467-5765 tbartolomei@cityofukiah.com Greater Ukiah Business & Tourism Alliance 3rd Tuesday of month, 11:30 a.m. 200 S School St. Ukiah, CA 95482 200 S School St. Ukiah, CA 95482 Promotes tourism and works to strengthen and promote the historic downtown and businesses within the greater Ukiah area Duenas Rodin - Alternate Shannon Riley,Deputy City Manager; 467-5793 sriley@cityofukiah.com Mendocino Council of Governments (MCOG) 1st Monday of month, 1:30 p.m. Board of Supervisors Chambers 501 Low Gap Road Ukiah, CA Executive Director 367 N. State Street, Ste. 206 Ukiah, CA 95482 463-1859 Plan and allocate State funding, transportation, infrastructure and project County wide Brown Rodin- Alternate Tim Eriksen, Public Works Director/City Engineer; 463-6280 teriksen@cityofukiah.com Mendocino County Inland Water and Power Commission (IWPC) 2nd Thursday of month, 6:00 p.m. Civic Center 300 Seminary Avenue conference room 5 IWPC Staff P.O. Box 1247 Ukiah, CA 95482 391-7574 - Candace Horsley Develops coordination for water resources and current water rights: Potter Valley project - Eel River Diversion Orozco Brown- Alternate Sean White,Director of Water Resources; 463-5712 swhite@cityofukiah.com Mendocino Solid Waste Management Authority (MSWMA) 3rd Thursday of every other month (varies), 10:00 a.m. Willits Council Chambers Solid Waste Director 3200 Taylor Drive Ukiah, CA 95482 468-9710 County-wide Solid Waste JPA Brown Duenas- Alternate Tim Eriksen, Public Works Director/City Engineer; 463-6280 teriksen@cityofukiah.com Mendocino Transit Authority (MTA) Board of Directors Last Wednesday of month, 1:30 p.m. Alternating locations - Ukiah Conference Center or Fort Bragg, or Point Arena Executive Director 241 Plant Road Ukiah, CA 95482 462-1422 County-wide bus transportation issues and funding Duenas Orozco - Alternate Tim Eriksen, Public Works Director/City Engineer; 463-6280 teriksen@cityofukiah.com North Coast Opportunities (NCO)4th Wednesday of month, 2 p.m. Alternating locations - Ukiah and Lakeport Ross Walker, Governing Board Chair North Coast Opportunities 413 North State Street Ukiah, CA 95482 Assist low income and disadvantaged people to become self reliant Bartolomei (appointed 12/19/18) Tami Bartolomei, Community Services Administrator; 467-5765 tbartolomei@cityofukiah.com North Coast Rail Authority (NCRA)2nd Wednesday of month, 10:30 a.m.Various Locations - announced 419 Talmage Road, Suite M Ukiah, CA 95482 463-3280 Provides a unified and revitalized rail infrastructure meeting the freight and passenger needs of the region Shannon Riley, Deputy City Manager Shannon Riley,Deputy City Manager; 467-5793 sriley@cityofukiah.com Russian River Watershed Association (RRWA) 4th Thursday of month, 9:00 a.m. (only 5 times a year) Windsor Town Hall Russian River Watershed Association Attn: Daria Isupov 425 South Main St., Sebastopol, CA 95472 508-3670 Consider issues related to Russian river - plans projects and funding requests Rodin Brown- Alternate Tim Eriksen, Public Works Director/City Engineer; 463-6280 teriksen@cityofukiah.com Ukiah Valley Basin Groundwater Sustainability Agency (GSA) 2nd Thursday of month, 1:30 p.m. Board of Supervisors Chambers; 501 Low Gap Road Ukiah, CA County Executive Office Nicole French 501 Low Gap Rd., Rm. 1010 Ukiah, CA 95482 463-4441 GSA serves as the Groundwater Sustainability Agency in the Ukiah Valley basin Crane Duenas- Alternate Sean White, Director of Water Resources; 463-5712 swhite@cityofukiah.com COUNTY/REGIONAL One + Staff Alternate MTG DATE/TIME MEETING LOCATION MAILING ADDRESS/CONTACT COMMITTEE FUNCTION ASSIGNED TO PRINCIPAL STAFF SUPPORT Economic Development & Financing Corporation (EDFC) 2nd Thursday of month, 2:00 p.m. Primarily 631 S. Orchard Street (location varies) Executive Director 631 South Orchard Avenue Ukiah, CA 95482 467-5953 Multi-agency co-op for economic development and business loan program Riley (appointed 12/19/18) Shannon Riley, Deputy City Manager; 467-5793 sriley@cityofukiah.com Sun House Guild ex officio 2nd Tuesday of month, 4:30 p.m. Sun House 431 S. Main St. Ukiah, CA 431 S. Main Street Ukiah, CA 95482 467-2836 Support and expand Grace Hudson Museum Orozco Neil Davis- Alternate David Burton, Museum Director; 467-2836 dburton@cityofukiah.com Continued - COUNTY/REGIONAL One + Staff Alternate MTG DATE/TIME MEETING LOCATION MAILING ADDRESS/CONTACT COMMITTEE FUNCTION ASSIGNED TO PRINCIPAL STAFF SUPPORT Mendocino Youth Project JPA Board of Directors 3rd Wednesday of month, 7:45 a.m. 776 S. State Street Conference Room Mendocino Co. Youth Project 776 S. State Street, Ste. 107 Ukiah, CA 95482 707-463-4915 Targets all youth with a focus on drug and alcohol prevention, healthy alternatives and empowering youth to make healthy choices Cedric Crook, Patrol Lieutenant Cedric Crook, Patrol Lieutenant Nob; 463- 6771; ccrook@cityofukiah.com Northern California Power Agency (NCPA) 4th Thursday of month, 9:00 a.m. (see NCPA calendar) Roseville, CA and other locations 651 Commerce Drive Roseville, CA 95678 916-781-4202 Pool of public utilities for electric generation and dispatch Crane Grandi - Alternate Mel Grandi, Electric Utility Director; 463-6295 mgrandi@cityofukiah.com 1 5/20/2021 ATTACHMENT 1 Page 798 of 800  2021 CITY COUNCIL SPECIAL ASSIGNMENTS LOCAL/COUNTY/REGIONAL/LIASONS OnGoing One or Two Council and/or Staff MTG DATE/TIME LOCATION MAILING ADDRESS/CONTACT COMMITTEE FUNCTION ASSIGNED TO PRINCIPAL STAFF SUPPORT Adventist Health Community Advisory Council Quarterly: Aug. 27, 6:45 a.m. Nov 5, 6:45 a.m. 275 Hospital Drive Ukiah, CA 95482 275 Hospital Drive Ukiah, CA 95482 707-463-7623 Allyne Brown - Allyne.Brown@ah.org Provides the Adventist Health Ukiah Valley (AHUV) Governing Board and Administration with advice, support, and suggestions on matter of importance to Mendocino, Lake and Sonoma Counties. Brown Rodin - Alternate Kristine Lawler, City Clerk, 463-6217 klawler@cityofukiah.com League of California Cities Redwood Empire Legislative Committee Prior to Division Meetings, meets 3x in person and then via conference call Various locations that are announced Redwood Empire League President; Public Affairs Program Manager (916) 658-8243 Elected city officials and professional city staff attend division meetings throughout the year to share what they are doing and advocate for their interests in Sacramento Rodin Orozco-Alternate Sage Sangiacomo, City Manager; 463-6221 ssangiacomo@cityofukiah.com City Selection Committee Called as required by the Clerk of the Board BOS Conference Room 501 Low Gap Rd. Rm. 1090 Ukiah, CA C/O: BOS 501 Low Gap Rd., Rm 1090 Ukiah, CA 95482 463-4441 Makes appointments to LAFCO and Airport Land Use Commission Mayor Kristine Lawler, City Clerk; 463-6217 klawler@cityofukiah.com Investment Oversight Committee Varies Civic Center 300 Seminary Ave. Ukiah, CA 95482 Civic Center 300 Seminary Ave. Ukiah, CA 95482 Reviews City investments, policies, and strategies Crane Orozco, Alternate Alan Carter, Treasurer Dan Buffalo, Director of Finance; 463-6220 dbuffalo@cityofukiah.com Library Advisory Board 3rd Wednesdays of alternate months; 1:00 p.m. Various Mendocino County Libraries Ukiah County Library 463-4491 Review library policy and activities Supervisor Mulheren Kristine Lawler, City Clerk; 463-6217; klawler@cityofukiah.com Ukiah Players Theater Board of Directors 3rd Tuesday of month, 6:00 p.m 1041 Low Gap Rd Ukiah, CA 95482 462-1210 1041 Low Gap Rd Ukiah, CA 95482 462-1210 To oversee the activities, organization and purpose of the Ukiah Players Theater Greg Owen, Airport Manager (appointed 12/19/18) Kristine Lawler, City Clerk; 463-6217 klawler@cityofukiah.com Ukiah Unified School District (UUSD) Committee Quarterly 511 S. Orchard, Ste. D Ukiah, CA 95482 511 S. Orchard Ukiah, CA 95482 Information exchange with UUSD Board Chair, Mayor, Superintendent, and City Manager Mayor, City Manager and Police Chief Sage Sangiacomo, City Manager; 463-6221 ssangiacomo@cityofukiah.com Russian River Flood Control District (RRFCD) Liaison 1st Monday of month, 5:30 p.m. 151 Laws Ave.,Suite D Ukiah, CA 151 Laws Ave., Ukiah, CA 95482; rrfc@pacific.net; 462-5278 Proactively manage the water resources of the upper Russian River for the benefit of the people and environment of Mendocino County White/Orozco Sean White, Director of Water Resources; 463-5712 swhite@cityofukiah.com HHSA Advisory Board 2nd Wednesday of month; 9:00 a.m. Big Sur Room County Department of Social Services Executive Director Jackie Williams - 462-1934 c/o Ford St. Project 139 Ford St. Ukiah CA 95482 Discussions and possible work on health and human service issues Brown - Liaison Shannon Riley, Deputy City Manager; 467- 5793 sriley@cityofukiah.com Mendocino County Local Area Formation Commission (LAFCO) 1st Monday of month, 9:00 a.m.Board of Supervisors Chambers Executive Director 200 S. School Street, Ste. 2 Ukiah, CA 95482 463-4470 Required by legislation - planning spheres of influence, annexation, service areas, and special districts (positions not active) Crane Rodin Craig Schlatter, Director of Community Development; 463-6219; cschlatter@cityofukiah.com Mendocino County Airport Land Use Commission As needed BOS Conference Room 501 Low Gap Rd., Rm. 1090, Ukiah, CA Mendocino County Executive Office 501 Low Gap Rd. Rm. 1010 Ukiah, CA 95482 To formulate a land use compatibility plan, provide for the orderly growth of the airport and the surrounding area, and safeguard the general welfare of the inhabitants within the vicinity Owen/Schlatter Greg Owen, Airport Manager; 467-2855; gowen@cityofukiah.com Craig Schlatter, Director of Community Development; 463-6219; cschlatter@cityofukiah.com Mendocino County 1st District Liaison Monthly; TBD Civic Center Annex conference room #5 411 West Clay St. Ukiah, CA 95482 Civic Center 300 Seminary Ave. Ukiah, CA 95482 To coordinate activities and policy development with the City's 1st District Supervisor Brown Crane- Alternate Sage Sangiacomo, City Manager; 463-6221; ssangiacomo@cityofukiah.com Mendocino County 2nd District Liaison 1st Wednesdays of month, 8:00 a.m. Civic Center Annex conference room #5 411 West Clay St. Ukiah, CA 95482 Civic Center 300 Seminary Ave. Ukiah, CA 95482 To coordinate activities and policy development with the County's 2nd District Supervisor Brown Shannon Riley, Deputy City Manager; 467- 5793 sriley@cityofukiah.com LOCAL/COUNTY/REGIONAL/LIASONS OnGoing One or Two Council and/or Staff MTG DATE/TIME LOCATION MAILING ADDRESS/CONTACT COMMITTEE FUNCTION ASSIGNED TO PRINCIPAL STAFF SUPPORT Fire Executive Committee 2nd Wednesdays of month, 3:45 p.m. Ukiah Valley Conference Center, 200 S. School Street Ukiah, CA Stephanie Abba Civic Center 300 Seminary Ave. Ukiah, CA 95482 sabba@cityofukiah.com Per the recently adopted agreement between the City of Ukiah and the Ukiah Valley Fire Protection District Orozco/Brown Doug Hutchison, Fire Chief; 463-6263; dhutchison@cityofukiah.com STANDING COMMITTEES MTG DATE/TIME LOCATION MAILING ADDRESS/CONTACT COMMITTEE FUNCTION ASSIGNED TO PRINCIPAL STAFF SUPPORT Equity and Diversity TBD Virtual Meeting Room (link to be created) Civic Center 300 Seminary Ave. Ukiah, CA 95482 Improve diversity and equity in the City’s workforce and municipal services Orozco/Duenas Traci Boyl, City Manager's Office Management Analyst; 467-5720 tboyl@cityofukiah.com 2 5/20/2021 Page 799 of 800 COMMITTEE ASSIGNED TO PRINCIPAL STAFF SUPPORT Electric Grid Operational Improvements Crane/Orozco Mel Grandi, Electric Utility Director; 463-6295 mgrandi@cityofukiah.com Trench Cut Policy Development Crane/Brown Tim Eriksen, Public Works Director/City Engineer; 463-6280 teriksen@cityofukiah.com Budget Development Best Practices and Financial Policy For FY 21/22 Budget Crane/Brown Dan Buffalo, Director of Finance; 463-6220 dbuffalo@cityofukiah.com Sheri Mannion, Human Resource Director/Risk Manager; 463-6272, smannion@cityofukiah.com Advance Planning & Policy for Sphere of Influence (SOI), Municipal Service Review (MSR), Annexation, Tax Sharing, Detachment, and Out of Area Service Agreements Crane/Rodin Sage Sangiacomo, City Manager 463-6221 ssangiacomo@cityofukiah.com Shannon Riley, Deputy City Manager 467-5793 sriley@cityofukiah.com Craig Schlatter, Community Development Director 463-6219 cschlatter@cityofukiah.com Sean White, Director of Water Resources; 463-5712 swhite@cityofukiah.com Tim Eriksen, Public Works Director/City Engineer; 463-6280 teriksen@cityofukiah.com Mel Grandi, Electric Utility Director; 463-6295 mgrandi@cityofukiah.com Dan Buffalo, Director of Finance; 463-6220 dbuffalo@cityofukiah.com 2021 Electric Rate Study Crane/Duenas Mel Grandi, Electric Utility Director; 463‐6295  mgrandi@cityofukiah.com Housing Element and Implementation Review Rodin/Orozco Craig Schlatter, Community Development Director 463-6219 cschlatter@cityofukiah.com Planning Commissioner Appointment Process Crane/Rodin Craig Schlatter,Community Development Director 463‐6219 cschlatter@cityofukiah.com Darcy Vaughn, Assistant City Attorney 462‐6846 dvaughn@cityofukiah.onmicrosoft.com UVSD/ City Relations Ad hoc committee to address specific issues with the Ukiah Valley Sanitation District, including discussion of overall sewer system service delivery policies, operating policy revisions, potential revisions to the current Operating Agreement, and cost sharing Crane/Brown Dan Buffalo, Director of Finance;  463‐6220 dbuffalo@cityofukiah.com Sean White, Water Resources Director 463‐5712 swhite@cityofukiah.com  Upper Russian River Water Agency/City Relations Crane/Brown Sean White, Director of Water Resources;  463‐5712 swhite@cityofukiah.com    2021 AD HOC COMMITTEES 3 4/16/2021 Page 800 of 800